F465774

General Info

Members Datasets Scaffolds Average Seq Length
578 331 545 103

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0861108|Ga0501031_0861108_148_501
Length 117
Sequence MIEYTLALRADVWMGENRMIVVTGSVIARQETLDEILRLSLEHVHRSRSEPGCLSHAVHIDYENPLRLVFVERWADRDALLAHFAVPASREFVKALQPLAAAATTIEIYDARQLEKL

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221596 Acidovorax sp. Root70 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221717 Acidovorax sp. Root267 Isolate Unclassified
14 2738541277 Variovorax sp. GV051 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2738541337 Pelomonas sp. BT06 Isolate Unclassified
17 2738543019 Variovorax sp. GV040 Isolate Unclassified
18 2818991446 Variovorax sp. 1180 Isolate Unclassified
19 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
20 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
21 2885198086 Variovorax sp. 679 Isolate Unclassified
22 2885211737 Variovorax sp. 553 Isolate Unclassified
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
25 2928037797 Variovorax sp. 1126 Isolate Unclassified
26 2928044640 Variovorax sp. 1128 Isolate Unclassified
27 2928051484 Variovorax sp. 1133 Isolate Unclassified
28 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
29 2928070936 Variovorax gossypii 1167 Isolate Unclassified
30 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
31 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
32 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
33 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
47 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
48 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
222 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
223 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
224 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
225 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
311 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
312 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
313 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
314 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
315 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
316 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
317 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
318 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
319 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
329 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
330 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.17
Isolates 5.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.22
Nodule 0.52
Rhizoplane 2.6
Rhizosphere 52.08
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10046416 3300001989 Bacteria 1422
2 JGI25158J39367_1024790 3300002739 Bacteria 709
3 JGI25152J39213_1006255 3300002773 Bacteria 3289
4 JGI25152J39213_1011969 3300002773 Bacteria 1888
5 JGI25150J39212_1002176 3300002774 Bacteria 5026
6 JGI25150J39212_1032152 3300002774 Bacteria 718
7 JGI25159J45721_1007273 3300002987 Bacteria 3190
8 JGI25159J45721_1013477 3300002987 Bacteria 1888
9 JGI25151J46595_10020167 3300003187 Bacteria 2815
10 JGI25151J46595_10035621 3300003187 Bacteria 1888
11 JGI25151J46595_10065077 3300003187 Bacteria 1137
12 JGI25151J46595_10071347 3300003187 Bacteria 1050
13 JGI25153J46596_10029393 3300003215 Bacteria 1888
14 JGI25153J46596_10053786 3300003215 Bacteria 1137
15 rootH1_10002678 3300003316 Bacteria 1467
16 rootL2_10039438 3300003322 Bacteria 5108
17 rootH1_10015317 3300003323 Bacteria 3745
18 JGI25160J50197_1021864 3300003354 Bacteria 1888
19 JGI25160J50197_1025982 3300003354 Bacteria 1623
20 JGI25161J50226_1010282 3300003374 Bacteria 1261
21 JGI25161J50226_1010317 3300003374 Bacteria 1255
22 Ga0006562J51391_1061291 3300003578 Bacteria 2320
23 Ga0055532_1021318 3300003758 Bacteria 667
24 Ga0055527_1018798 3300003760 Bacteria 733
25 Ga0055535_1000383 3300003761 Bacteria 41879
26 Ga0055542_1000268 3300003762 Bacteria 58408
27 Ga0055526_1025345 3300003771 Bacteria 1905
28 Ga0055526_1025601 3300003771 Bacteria 1888
29 Ga0055537_1000050 3300003773 Bacteria 86738
30 Ga0055537_1010866 3300003773 Bacteria 1888
31 Ga0055537_1018605 3300003773 Bacteria 1104
32 Ga0055524_1020580 3300003775 Bacteria 2217
33 Ga0055524_1024856 3300003775 Bacteria 1888
34 Ga0055536_1002335 3300003781 Bacteria 10735
35 Ga0055536_1003522 3300003781 Bacteria 8379
36 Ga0055536_1008920 3300003781 Bacteria 4233
37 Ga0055536_1069484 3300003781 Bacteria 700
38 Ga0055534_1000035 3300003784 Bacteria 114162
39 Ga0055534_1006337 3300003784 Bacteria 2994
40 Ga0055534_1010801 3300003784 Bacteria 1888
41 Ga0055534_1048637 3300003784 Bacteria 607
42 Ga0055528_1000757 3300003790 Bacteria 22561
43 Ga0055528_1023383 3300003790 Bacteria 1888
44 Ga0055528_1038614 3300003790 Bacteria 1104
45 Ga0055530_10000937 3300003791 Bacteria 23880
46 Ga0055530_10003756 3300003791 Bacteria 8383
47 Ga0055540_1000291 3300003792 Bacteria 44881
48 Ga0055540_1000814 3300003792 Bacteria 21128
49 Ga0055540_1004996 3300003792 Bacteria 5764
50 Ga0055540_1029104 3300003792 Bacteria 1297
51 Ga0055531_10006028 3300003794 Bacteria 6954
52 Ga0055531_10006383 3300003794 Bacteria 6704
53 Ga0055531_10008545 3300003794 Bacteria 5377
54 Ga0055543_1011525 3300004625 Bacteria 1805
55 Ga0065165_1026007 3300005262 Bacteria 1933
56 Ga0065165_1028085 3300005262 Bacteria 1822
57 Ga0065165_1085570 3300005262 Bacteria 811
58 Ga0070658_10743830 3300005327 Unclassified 851
59 Ga0070660_100064567 3300005339 Bacteria 2848
60 Ga0070660_100637177 3300005339 Bacteria 892
61 Ga0070661_100270392 3300005344 Bacteria 1316
62 Ga0070661_100334375 3300005344 Bacteria 1185
63 Ga0070668_100159177 3300005347 Bacteria 1831
64 Ga0070669_100226168 3300005353 Bacteria 1481
65 Ga0070659_100475671 3300005366 Unclassified 1062
66 Ga0070659_100591677 3300005366 Bacteria 953
67 Ga0070710_10701219 3300005437 Bacteria 714
68 Ga0070663_100195845 3300005455 Bacteria 1575
69 Ga0070663_100610906 3300005455 Bacteria 918
70 Ga0070662_100036915 3300005457 Bacteria 3461
71 Ga0070662_100248382 3300005457 Bacteria 1429
72 Ga0070662_100871880 3300005457 Bacteria 767
73 Ga0070681_10134153 3300005458 Bacteria 2407
74 Ga0068867_100593773 3300005459 Bacteria 965
75 Ga0070699_100920523 3300005518 Bacteria 801
76 Ga0068853_100009092 3300005539 Bacteria 8000
77 Ga0068853_100214045 3300005539 Bacteria 1757
78 Ga0068853_100598617 3300005539 Bacteria 1047
79 Ga0068853_101318746 3300005539 Bacteria 698
80 Ga0070665_101540327 3300005548 Bacteria 673
81 Ga0070665_102441872 3300005548 Bacteria 525
82 Ga0068855_100029070 3300005563 Bacteria 6610
83 Ga0068855_100134771 3300005563 Bacteria 2818
84 Ga0068857_100624133 3300005577 Bacteria 1020
85 Ga0068857_101146257 3300005577 Bacteria 752
86 Ga0068854_101622413 3300005578 Bacteria 590
87 Ga0068852_100552804 3300005616 Bacteria 1152
88 Ga0068852_102506279 3300005616 Bacteria 536
89 Ga0068864_101678027 3300005618 Bacteria 640
90 Ga0068866_10194237 3300005718 Bacteria 1208
91 Ga0068861_100639513 3300005719 Bacteria 981
92 Ga0068851_10043222 3300005834 Bacteria 2271
93 Ga0068860_100811418 3300005843 Bacteria 949
94 Ga0068860_101017286 3300005843 Bacteria 847
95 Ga0068862_100055309 3300005844 Bacteria 3399
96 Ga0075365_10018891 3300006038 Bacteria 4245
97 Ga0075363_100115336 3300006048 Bacteria 1495
98 Ga0075363_100223986 3300006048 Bacteria 1078
99 Ga0075363_100538491 3300006048 Bacteria 696
100 Ga0075364_10058399 3300006051 Bacteria 2528
101 Ga0075364_10200772 3300006051 Bacteria 1352
102 Ga0075364_10261385 3300006051 Bacteria 1177
103 Ga0075432_10024994 3300006058 Bacteria 2049
104 Ga0075432_10045146 3300006058 Bacteria 1545
105 Ga0075432_10105803 3300006058 Bacteria 1044
106 Ga0075362_10011478 3300006177 Bacteria 3490
107 Ga0075362_10292834 3300006177 Bacteria 807
108 Ga0075367_10109254 3300006178 Bacteria 1696
109 Ga0075367_10116927 3300006178 Bacteria 1641
110 Ga0075367_10166135 3300006178 Bacteria 1373
111 Ga0075367_10379787 3300006178 Bacteria 893
112 Ga0075367_10426374 3300006178 Bacteria 840
113 Ga0075369_10144447 3300006186 Bacteria 1086
114 Ga0075369_10251330 3300006186 Bacteria 821
115 Ga0075366_10028085 3300006195 Bacteria 3301
116 Ga0075366_10032901 3300006195 Bacteria 3053
117 Ga0075366_10058913 3300006195 Bacteria 2281
118 Ga0075366_10424011 3300006195 Bacteria 820
119 Ga0075366_10946485 3300006195 Bacteria 537
120 Ga0097621_101628139 3300006237 Bacteria 614
121 Ga0075370_10000601 3300006353 Bacteria 13893
122 Ga0075370_10001258 3300006353 Bacteria 10790
123 Ga0075370_10035161 3300006353 Bacteria 2811
124 Ga0075370_10040493 3300006353 Bacteria 2628
125 Ga0075370_10193653 3300006353 Bacteria 1198
126 Ga0075370_10311726 3300006353 Bacteria 936
127 Ga0075370_10322206 3300006353 Bacteria 921
128 Ga0075370_10453762 3300006353 Bacteria 771
129 Ga0068871_100243986 3300006358 Bacteria 1563
130 Ga0068865_100745263 3300006881 Bacteria 841
131 Ga0068865_100851652 3300006881 Bacteria 790
132 Ga0099826_10000615 3300006948 Bacteria 18171
133 Ga0099795_10152251 3300007788 Bacteria 948
134 Ga0105244_10000502 3300009036 Bacteria 35162
135 Ga0105244_10150938 3300009036 Bacteria 1113
136 Ga0105244_10280259 3300009036 Bacteria 773
137 Ga0105240_10088285 3300009093 Bacteria 3794
138 Ga0105240_10362498 3300009093 Bacteria 1641
139 Ga0105245_11294375 3300009098 Bacteria 778
140 Ga0105247_10620496 3300009101 Bacteria 804
141 Ga0105243_10000269 3300009148 Bacteria 58482
142 Ga0105243_10056084 3300009148 Bacteria 3132
143 Ga0105243_10176220 3300009148 Bacteria 1856
144 Ga0105243_10280578 3300009148 Bacteria 1500
145 Ga0105241_10602117 3300009174 Bacteria 993
146 Ga0105237_10009449 3300009545 Bacteria 10443
147 Ga0105237_10232810 3300009545 Bacteria 1843
148 Ga0105238_10080569 3300009551 Bacteria 3245
149 Ga0105238_10179554 3300009551 Bacteria 2094
150 Ga0105238_10632251 3300009551 Bacteria 1080
151 Ga0105249_10158929 3300009553 Bacteria 2182
152 Ga0105239_10212322 3300010375 Bacteria 2170
153 Ga0105239_10515135 3300010375 Bacteria 1361
154 Ga0105239_12886804 3300010375 Bacteria 561
155 Ga0105246_10035346 3300011119 Bacteria 3339
156 Ga0105246_10138712 3300011119 Bacteria 1826
157 Ga0105246_10282131 3300011119 Bacteria 1333
158 Ga0157373_10028560 3300013100 Bacteria 4023
159 Ga0157373_10059295 3300013100 Bacteria 2712
160 Ga0157371_10109095 3300013102 Bacteria 1964
161 Ga0157370_10005005 3300013104 Bacteria 14994
162 Ga0157370_10287675 3300013104 Bacteria 1518
163 Ga0157370_10355247 3300013104 Bacteria 1351
164 Ga0157370_10457504 3300013104 Bacteria 1173
165 Ga0157370_10636244 3300013104 Bacteria 975
166 Ga0157369_10149859 3300013105 Bacteria 2465
167 Ga0157369_11010979 3300013105 Bacteria 851
168 Ga0157378_10901045 3300013297 Bacteria 915
169 Ga0163162_11319215 3300013306 Bacteria 820
170 Ga0157372_10062461 3300013307 Bacteria 4174
171 Ga0157372_10487233 3300013307 Bacteria 1438
172 Ga0157372_10732090 3300013307 Bacteria 1150
173 Ga0182008_10002006 3300014497 Bacteria 13064
174 Ga0182008_10017215 3300014497 Bacteria 3750
175 Ga0157376_10141776 3300014969 Bacteria 2157
176 Ga0182006_1001117 3300015261 Bacteria 17071
177 Ga0182007_10000238 3300015262 Bacteria 37140
178 Ga0182007_10116679 3300015262 Bacteria 891
179 Ga0182005_1135616 3300015265 Bacteria 708
180 Ga0163161_10000171 3300017792 Bacteria 59497
181 Ga0163161_10002666 3300017792 Bacteria 12681
182 Ga0163161_10023346 3300017792 Bacteria 4363
183 Ga0163161_11048057 3300017792 Bacteria 698
184 Ga0209436_103530 3300025208 Bacteria 4121
185 Ga0209436_103818 3300025208 Bacteria 3876
186 Ga0209672_101080 3300025228 Bacteria 11613
187 Ga0209147_102032 3300025229 Bacteria 5810
188 Ga0209258_100009 3300025242 Bacteria 996276
189 Ga0207425_1000266 3300025245 Bacteria 38532
190 Ga0207425_1001945 3300025245 Bacteria 7777
191 Ga0209677_117992 3300025253 Bacteria 870
192 Ga0209148_1000007 3300025254 Bacteria 1592273
193 Ga0209129_1000013 3300025258 Bacteria 524874
194 Ga0209129_1008166 3300025258 Bacteria 2962
195 Ga0209129_1008309 3300025258 Bacteria 2909
196 Ga0209565_1000115 3300025263 Bacteria 115272
197 Ga0209565_1000228 3300025263 Bacteria 61687
198 Ga0209565_1008439 3300025263 Bacteria 2692
199 Ga0209565_1083729 3300025263 Bacteria 522
200 Ga0209673_1000309 3300025273 Bacteria 90058
201 Ga0209673_1000329 3300025273 Bacteria 87170
202 Ga0209673_1001031 3300025273 Bacteria 32924
203 Ga0209130_1000284 3300025284 Bacteria 62277
204 Ga0209130_1000429 3300025284 Bacteria 45047
205 Ga0209130_1001662 3300025284 Bacteria 13593
206 Ga0209675_1000110 3300025291 Bacteria 115272
207 Ga0209675_1000238 3300025291 Bacteria 54807
208 Ga0209675_1000791 3300025291 Bacteria 20977
209 Ga0209675_1041351 3300025291 Bacteria 1006
210 Ga0209676_1000004 3300025292 Bacteria 1138360
211 Ga0209676_1000162 3300025292 Bacteria 159931
212 Ga0209676_1000206 3300025292 Bacteria 132202
213 Ga0209676_1000238 3300025292 Bacteria 117732
214 Ga0209676_1003498 3300025292 Bacteria 9614
215 Ga0209676_1022796 3300025292 Bacteria 2066
216 Ga0209025_1000168 3300025294 Bacteria 162386
217 Ga0209025_1000393 3300025294 Bacteria 90571
218 Ga0209025_1002851 3300025294 Bacteria 17343
219 Ga0209025_1003706 3300025294 Bacteria 14043
220 Ga0209025_1015601 3300025294 Bacteria 4561
221 Ga0209025_1178192 3300025294 Bacteria 549
222 Ga0209564_1000222 3300025295 Bacteria 129405
223 Ga0209564_1001526 3300025295 Bacteria 23009
224 Ga0209758_1000134 3300025297 Bacteria 178294
225 Ga0209758_1007869 3300025297 Bacteria 7090
226 Ga0209050_1000002 3300025298 Bacteria 1792849
227 Ga0209050_1000512 3300025298 Bacteria 65551
228 Ga0209050_1025843 3300025298 Bacteria 1983
229 Ga0209256_1000060 3300025299 Bacteria 262342
230 Ga0209256_1000472 3300025299 Bacteria 60473
231 Ga0207426_1000095 3300025302 Bacteria 274234
232 Ga0207426_1000100 3300025302 Bacteria 262342
233 Ga0209051_1000002 3300025303 Bacteria 1631846
234 Ga0209051_1000274 3300025303 Bacteria 84662
235 Ga0209051_1000311 3300025303 Bacteria 76050
236 Ga0209257_1000002 3300025304 Bacteria 1767052
237 Ga0209257_1000286 3300025304 Bacteria 111738
238 Ga0209257_1000432 3300025304 Bacteria 80643
239 Ga0209257_1000696 3300025304 Bacteria 52123
240 Ga0209257_1001946 3300025304 Bacteria 22293
241 Ga0209257_1006446 3300025304 Bacteria 7556
242 Ga0207656_10026291 3300025321 Bacteria 2372
243 Ga0207655_1002609 3300025728 Bacteria 14322
244 Ga0207642_10473313 3300025899 Bacteria 763
245 Ga0207688_10162534 3300025901 Bacteria 1324
246 Ga0207645_10215473 3300025907 Bacteria 1265
247 Ga0207705_10046851 3300025909 Bacteria 3108
248 Ga0207654_10585369 3300025911 Bacteria 795
249 Ga0207707_10361381 3300025912 Bacteria 1250
250 Ga0207695_10404860 3300025913 Bacteria 1249
251 Ga0207671_10070892 3300025914 Bacteria 2599
252 Ga0207660_10152883 3300025917 Bacteria 1775
253 Ga0207657_10005075 3300025919 Bacteria 13810
254 Ga0207657_11223442 3300025919 Bacteria 570
255 Ga0207649_10247054 3300025920 Bacteria 1283
256 Ga0207649_10269747 3300025920 Bacteria 1233
257 Ga0207652_10471367 3300025921 Bacteria 1131
258 Ga0207694_10217465 3300025924 Bacteria 1558
259 Ga0207694_10972761 3300025924 Bacteria 718
260 Ga0207690_10413709 3300025932 Bacteria 1077
261 Ga0207690_10804073 3300025932 Unclassified 777
262 Ga0207706_10052866 3300025933 Bacteria 3586
263 Ga0207706_10356878 3300025933 Bacteria 1270
264 Ga0207709_10002872 3300025935 Bacteria 10553
265 Ga0207709_10018779 3300025935 Bacteria 3877
266 Ga0207709_10074891 3300025935 Bacteria 2162
267 Ga0207709_10145151 3300025935 Bacteria 1636
268 Ga0207709_11026590 3300025935 Bacteria 675
269 Ga0207709_11542699 3300025935 Unclassified 551
270 Ga0207704_10976749 3300025938 Bacteria 715
271 Ga0207704_11604895 3300025938 Bacteria 559
272 Ga0207679_10049055 3300025945 Bacteria 3078
273 Ga0207667_11907460 3300025949 Unclassified 556
274 Ga0207712_10850762 3300025961 Bacteria 804
275 Ga0207668_10730291 3300025972 Bacteria 872
276 Ga0207668_12122405 3300025972 Bacteria 506
277 Ga0207640_10485588 3300025981 Bacteria 1026
278 Ga0207640_10595088 3300025981 Bacteria 935
279 Ga0207640_10781193 3300025981 Bacteria 826
280 Ga0207640_11773676 3300025981 Bacteria 558
281 Ga0207658_10189876 3300025986 Bacteria 1707
282 Ga0207639_10194065 3300026041 Bacteria 1736
283 Ga0207639_10378987 3300026041 Bacteria 1270
284 Ga0207639_10503950 3300026041 Bacteria 1106
285 Ga0207639_10615840 3300026041 Bacteria 1002
286 Ga0207678_11000360 3300026067 Bacteria 740
287 Ga0207702_10305204 3300026078 Bacteria 1512
288 Ga0207648_10175060 3300026089 Bacteria 1897
289 Ga0207648_10265234 3300026089 Bacteria 1533
290 Ga0207674_10041465 3300026116 Bacteria 4761
291 Ga0207674_10279311 3300026116 Bacteria 1618
292 Ga0207674_10630261 3300026116 Bacteria 1035
293 Ga0207674_11207145 3300026116 Bacteria 726
294 Ga0207675_100507656 3300026118 Bacteria 1201
295 Ga0207698_10054948 3300026142 Bacteria 3066
296 Ga0207698_10243769 3300026142 Bacteria 1640
297 Ga0209282_1000241 3300027666 Bacteria 27542
298 Ga0209974_10240608 3300027876 Unclassified 679
299 Ga0207428_10669822 3300027907 Bacteria 744
300 Ga0268265_10061483 3300028380 Bacteria 2882
301 Ga0268265_10246282 3300028380 Bacteria 1580
302 Ga0268264_10809332 3300028381 Bacteria 936
303 Ga0307515_10308100 3300028794 Bacteria 1261
304 Ga0265338_10206698 3300028800 Bacteria 1477
305 Ga0265338_10473568 3300028800 Bacteria 884
306 Ga0265332_10159502 3300031238 Bacteria 943
307 Ga0265325_10002780 3300031241 Bacteria 11684
308 Ga0265340_10095426 3300031247 Bacteria 1387
309 Ga0265340_10167958 3300031247 Bacteria 994
310 Ga0265339_10014407 3300031249 Bacteria 4765
311 Ga0265327_10006939 3300031251 Bacteria 8901
312 Ga0265327_10109760 3300031251 Bacteria 1320
313 Ga0265316_10266511 3300031344 Bacteria 1255
314 Ga0307513_10406383 3300031456 Bacteria 1095
315 Ga0307408_100000111 3300031548 Bacteria 90575
316 Ga0307408_100098212 3300031548 Bacteria 2225
317 Ga0265313_10174052 3300031595 Bacteria 908
318 Ga0307508_10724830 3300031616 Bacteria 605
319 Ga0307514_10007518 3300031649 Bacteria 9389
320 Ga0265314_10216242 3300031711 Bacteria 1122
321 Ga0265342_10548298 3300031712 Bacteria 587
322 Ga0307516_10027676 3300031730 Bacteria 5748
323 Ga0307405_10282877 3300031731 Bacteria 1249
324 Ga0307405_10917916 3300031731 Bacteria 742
325 Ga0307405_11305168 3300031731 Bacteria 631
326 Ga0307413_10268216 3300031824 Bacteria 1276
327 Ga0307410_10227546 3300031852 Bacteria 1438
328 Ga0307410_10302126 3300031852 Bacteria 1263
329 Ga0307406_10000046 3300031901 Bacteria 69556
330 Ga0307406_10105261 3300031901 Bacteria 1930
331 Ga0307407_10034959 3300031903 Bacteria 2756
332 Ga0307407_10101301 3300031903 Bacteria 1788
333 Ga0307407_10764988 3300031903 Bacteria 732
334 Ga0307412_10001515 3300031911 Bacteria 12884
335 Ga0307412_10056317 3300031911 Bacteria 2619
336 Ga0307412_10188608 3300031911 Bacteria 1557
337 Ga0307412_10513116 3300031911 Bacteria 1000
338 Ga0307409_101044993 3300031995 Bacteria 836
339 Ga0307414_10037744 3300032004 Bacteria 3237
340 Ga0307414_10067057 3300032004 Bacteria 2568
341 Ga0307414_10225092 3300032004 Bacteria 1542
342 Ga0307411_10018921 3300032005 Bacteria 3964
343 Ga0307411_10031021 3300032005 Bacteria 3283
344 Ga0307415_101766300 3300032126 Bacteria 598
345 Ga0307510_10651308 3300033180 Unclassified 511
346 Ga0373957_0107613 3300035120 Bacteria 1121
347 Ga0373927_0013460 3300035695 Bacteria 5436
348 Ga0373947_0028423 3300035725 Bacteria 3279
349 Ga0395899_0533783 3300037312 Bacteria 756
350 Ga0395900_0829048 3300037418 Bacteria 851
351 Ga0395901_0048523 3300038443 Bacteria 4409
352 Ga0436365_0305578 3300039437 Bacteria 559
353 Ga0439466_0009501 3300041411 Bacteria 3633
354 Ga0439465_0001088 3300041413 Bacteria 8701
355 Ga0451841_0556179 3300041498 Bacteria 1015
356 Ga0451853_1766864 3300041512 Bacteria 1478
357 Ga0439431_0018070 3300041997 Bacteria 1665
358 Ga0439442_005658 3300042002 Bacteria 2501
359 Ga0450920_026301 3300042122 Bacteria 1135
360 Ga0450923_000886 3300042125 Bacteria 3675
361 Ga0450906_000564 3300042145 Bacteria 7832
362 Ga0450910_052449 3300042147 Bacteria 676
363 Ga0439446_0008417 3300042156 Bacteria 2738
364 Ga0450908_083188 3300042184 Bacteria 576
365 Ga0450908_084531 3300042184 Bacteria 571
366 Ga0439434_0006121 3300042435 Bacteria 3508
367 Ga0450918_024734 3300042531 Bacteria 1050
368 Ga0451577_0596048 3300042876 Unclassified 1003
369 Ga0451577_1989491 3300042876 Bacteria 508
370 Ga0453684_0114072 3300044712 Bacteria 3277
371 Ga0453684_0633627 3300044712 Unclassified 1168
372 Ga0451576_0020692 3300045051 Bacteria 7160
373 Ga0451576_0653259 3300045051 Bacteria 1105
374 Ga0495627_003670 3300046453 Bacteria 6664
375 Ga0495650_0028820 3300046471 Bacteria 2540
376 Ga0495650_0118923 3300046471 Bacteria 974
377 Ga0495610_0140803 3300046512 Bacteria 1038
378 Ga0495620_0022543 3300046515 Bacteria 3030
379 Ga0495631_0000468 3300046518 Bacteria 27243
380 Ga0495637_0012963 3300046520 Bacteria 3972
381 Ga0495637_0133008 3300046520 Bacteria 948
382 Ga0495654_0001128 3300046530 Bacteria 19241
383 Ga0495654_0066994 3300046530 Bacteria 1710
384 Ga0495654_0087835 3300046530 Bacteria 1446
385 Ga0495654_0163631 3300046530 Bacteria 975
386 Ga0495586_0139164 3300046535 Bacteria 1362
387 Ga0495621_0008758 3300046539 Bacteria 3045
388 Ga0495597_0118478 3300046542 Bacteria 1105
389 Ga0495622_0298980 3300046557 Bacteria 702
390 Ga0495668_0058980 3300046616 Bacteria 2118
391 Ga0495668_0070257 3300046616 Bacteria 1925
392 Ga0495668_0248802 3300046616 Bacteria 973
393 Ga0495625_0000057 3300046660 Bacteria 181623
394 Ga0495625_0020334 3300046660 Bacteria 5127
395 Ga0495625_0307429 3300046660 Bacteria 1013
396 Ga0495635_0554672 3300046663 Bacteria 753
397 Ga0495659_0152391 3300046664 Bacteria 929
398 Ga0495588_0027837 3300046674 Bacteria 2826
399 Ga0495588_0077355 3300046674 Bacteria 1735
400 Ga0495588_0087450 3300046674 Bacteria 1630
401 Ga0495657_0409579 3300046675 Bacteria 797
402 Ga0495647_0451251 3300046681 Bacteria 595
403 Ga0495658_0327178 3300046683 Bacteria 972
404 Ga0495658_0391581 3300046683 Bacteria 885
405 Ga0495670_0075240 3300046691 Bacteria 1714
406 Ga0495670_0128233 3300046691 Bacteria 1321
407 Ga0495671_0027188 3300046692 Bacteria 2956
408 Ga0495660_0048944 3300046810 Bacteria 2310
409 Ga0495676_0240763 3300047321 Bacteria 1239
410 Ga0496100_0262177 3300048903 Bacteria 1282
411 Ga0496100_1597943 3300048903 Bacteria 515
412 Ga0496101_0016285 3300048904 Bacteria 5018
413 Ga0496102_0295686 3300048905 Bacteria 1526
414 Ga0496103_0311677 3300048906 Bacteria 1012
415 Ga0496104_0655641 3300048907 Bacteria 958
416 Ga0496105_0131644 3300048908 Bacteria 2062
417 Ga0496107_0267176 3300048910 Bacteria 1273
418 Ga0496108_0030102 3300048911 Bacteria 4499
419 Ga0496109_0026336 3300048912 Bacteria 5186
420 Ga0496109_0894028 3300048912 Bacteria 826
421 Ga0496110_1491880 3300048913 Bacteria 586
422 Ga0496116_0012920 3300048919 Bacteria 6778
423 Ga0496116_0232557 3300048919 Bacteria 933
424 Ga0496116_0263168 3300048919 Bacteria 849
425 Ga0496117_0032396 3300048920 Bacteria 3971
426 Ga0496117_0082322 3300048920 Bacteria 2108
427 Ga0496117_0123556 3300048920 Bacteria 1585
428 Ga0496117_0254563 3300048920 Bacteria 955
429 Ga0496118_0014242 3300048921 Bacteria 7457
430 Ga0496118_0036830 3300048921 Bacteria 3948
431 Ga0496118_0259751 3300048921 Bacteria 981
432 Ga0496119_0268023 3300048922 Unclassified 854
433 Ga0496119_0398323 3300048922 Bacteria 657
434 Ga0496121_0056163 3300048924 Bacteria 3272
435 Ga0496121_0101316 3300048924 Bacteria 2221
436 Ga0496121_0841438 3300048924 Bacteria 534
437 Ga0496121_0841459 3300048924 Bacteria 534
438 Ga0496122_0047474 3300048925 Bacteria 3315
439 Ga0496122_0083887 3300048925 Bacteria 2207
440 Ga0496122_0181293 3300048925 Bacteria 1255
441 Ga0496122_0428536 3300048925 Bacteria 663
442 Ga0496123_0070830 3300048926 Bacteria 2179
443 Ga0496123_0113658 3300048926 Bacteria 1541
444 Ga0496124_0024885 3300048927 Bacteria 5433
445 Ga0496124_0199831 3300048927 Bacteria 1521
446 Ga0496124_0304846 3300048927 Bacteria 1148
447 Ga0496124_0321306 3300048927 Bacteria 1108
448 Ga0496125_0061047 3300048928 Bacteria 3026
449 Ga0496125_0095570 3300048928 Bacteria 2210
450 Ga0496125_0131435 3300048928 Bacteria 1761
451 Ga0496125_0331254 3300048928 Bacteria 918
452 Ga0496125_0378398 3300048928 Bacteria 835
453 Ga0496126_0066554 3300048929 Bacteria 3221
454 Ga0496126_0471940 3300048929 Bacteria 1007
455 Ga0495678_040121 3300049459 Bacteria 1884
456 Ga0501031_0861108 3300049568 Unclassified 580
457 Ga0501032_0045593 3300049569 Bacteria 2965
458 Ga0501032_0061612 3300049569 Bacteria 2514
459 Ga0501033_0035303 3300049570 Bacteria 3749
460 Ga0501033_0128631 3300049570 Bacteria 1836
461 Ga0501033_0585519 3300049570 Bacteria 766
462 Ga0501034_0289993 3300049571 Bacteria 1575
463 Ga0501034_0545287 3300049571 Unclassified 1069
464 Ga0501036_0164281 3300049572 Bacteria 1871
465 Ga0501036_1011246 3300049572 Bacteria 680
466 Ga0501037_0049265 3300049573 Unclassified 3085
467 Ga0501037_0260523 3300049573 Bacteria 1211
468 Ga0501038_0157873 3300049574 Unclassified 1845
469 Ga0501039_0035541 3300049575 Bacteria 3845
470 Ga0501039_0154432 3300049575 Bacteria 1803
471 Ga0501043_0167158 3300049579 Bacteria 1717
472 Ga0501043_0201970 3300049579 Unclassified 1542
473 Ga0501043_0360973 3300049579 Bacteria 1102
474 Ga0501046_0044381 3300049580 Bacteria 3535
475 Ga0501046_0121967 3300049580 Bacteria 1983
476 Ga0501047_0067648 3300049581 Bacteria 3442
477 Ga0501047_0119163 3300049581 Bacteria 2521
478 Ga0501068_0046616 3300049584 Bacteria 2614
479 Ga0501070_0442895 3300049586 Bacteria 1048
480 Ga0501070_0548686 3300049586 Bacteria 925
481 Ga0501071_0834618 3300049587 Bacteria 711
482 Ga0501072_0182472 3300049588 Bacteria 1674
483 Ga0501074_0170532 3300049590 Bacteria 1553
484 Ga0501223_116986 3300049663 Unclassified 560
485 Ga0501249_033051 3300049679 Bacteria 1158
486 Ga0501079_0777182 3300049741 Unclassified 754
487 Ga0501080_0081186 3300049742 Bacteria 3013
488 Ga0501035_0035688 3300049822 Bacteria 4511
489 Ga0501035_0153304 3300049822 Bacteria 1998
490 Ga0501044_0281700 3300049823 Bacteria 1596
491 Ga0501044_0380952 3300049823 Bacteria 1325
492 nmdc:mga03683_10478_c1 3300050489 Bacteria 2192
493 nmdc:mga03683_15295_c1 3300050489 Bacteria 2861
494 nmdc:mga03683_191045_c1 3300050489 Bacteria 937
495 nmdc:mga03n38_385179_c1 3300050490 Bacteria 769
496 nmdc:mga03n38_39788_c1 3300050490 Bacteria 2040
497 nmdc:mga03n38_6606_c1 3300050490 Bacteria 4044
498 nmdc:mga00v17_14956_c1 3300050491 Bacteria 4346
499 nmdc:mga00v17_200186_c1 3300050491 Bacteria 1291
500 nmdc:mga00v17_227197_c1 3300050491 Bacteria 1209
501 nmdc:mga00v17_74965_c1 3300050491 Bacteria 2103
502 nmdc:mga00v17_928230_c1 3300050491 Bacteria 550
503 nmdc:mga0k408_104471_c1 3300050493 Bacteria 1672
504 nmdc:mga0k408_106381_c1 3300050493 Bacteria 1657
505 nmdc:mga0k408_237729_c1 3300050493 Bacteria 1088
506 nmdc:mga0k408_819797_c1 3300050493 Bacteria 542
507 nmdc:mga06z11_583989_c1 3300050494 Bacteria 679
508 nmdc:mga06z11_851166_c1 3300050494 Bacteria 556
509 nmdc:mga07m45_135133_c1 3300050496 Bacteria 1427
510 nmdc:mga07m45_20054_c1 3300050496 Bacteria 2733
511 nmdc:mga07m45_270225_c1 3300050496 Bacteria 989
512 nmdc:mga07m45_52852_c1 3300050496 Bacteria 2295
513 nmdc:mga07m45_59_c1 3300050496 Bacteria 45010
514 nmdc:mga07m45_710412_c1 3300050496 Bacteria 578
515 nmdc:mga0sz30_223334_c1 3300050516 Bacteria 837
516 nmdc:mga0sz30_284964_c1 3300050516 Bacteria 736
517 nmdc:mga0sz30_374998_c1 3300050516 Bacteria 637
518 Ga0500610_0000858 3300053079 Bacteria 9747
519 Ga0495619_0842790 3300053085 Bacteria 619
520 Ga0500566_0164658 3300053094 Bacteria 1152
521 Ga0500641_0012007 3300053096 Bacteria 3156
522 Ga0500560_083818 3300053107 Bacteria 1061
523 Ga0500562_067886 3300053108 Bacteria 961
524 Ga0500569_333096 3300053109 Bacteria 507
525 Ga0500572_014686 3300053111 Bacteria 1962
526 Ga0500593_000730 3300053117 Bacteria 12447
527 Ga0500594_0043436 3300053118 Bacteria 1239
528 Ga0500595_038315 3300053119 Bacteria 1559
529 Ga0500607_002971 3300053121 Bacteria 12883
530 Ga0500628_164546 3300053129 Bacteria 627
531 Ga0500655_008189 3300053133 Bacteria 1881
532 Ga0500658_0000175 3300053134 Bacteria 30638
533 Ga0500658_0000714 3300053134 Bacteria 13735
534 Ga0500559_0052329 3300053136 Bacteria 1804
535 Ga0500559_0567983 3300053136 Bacteria 516
536 Ga0500577_0261951 3300053142 Bacteria 752
537 Ga0500616_0009338 3300053153 Bacteria 5973
538 Ga0500627_0000917 3300053158 Bacteria 7930
539 Ga0500633_0171482 3300053160 Bacteria 814
540 Ga0500634_0021265 3300053161 Bacteria 3515
541 Ga0500638_012949 3300053162 Bacteria 3755
542 Ga0500611_055466 3300053727 Bacteria 922
543 Ga0500625_104933 3300053729 Bacteria 1175
544 Ga0500596_009087 3300053735 Bacteria 1562
545 Ga0501084_0312234 3300054114 Unclassified 1328

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100334375 Ga0070661_1003343751 94
2 3300005548 Ga0070665_101540327 Ga0070665_1015403272 94
3 3300006881 Ga0068865_100851652 Ga0068865_1008516522 94
4 3300009098 Ga0105245_11294375 Ga0105245_112943752 94
5 3300009101 Ga0105247_10620496 Ga0105247_106204962 94
6 3300017792 Ga0163161_11048057 Ga0163161_110480572 94
7 3300025920 Ga0207649_10269747 Ga0207649_102697472 94
8 3300025938 Ga0207704_10976749 Ga0207704_109767492 94
9 3300025972 Ga0207668_12122405 Ga0207668_121224052 94
10 3300026067 Ga0207678_11000360 Ga0207678_110003602 94
11 3300046663 Ga0495635_0554672 Ga0495635_0554672_369_674 94
12 3300046675 Ga0495657_0409579 Ga0495657_0409579_110_415 94
13 3300048903 Ga0496100_1597943 Ga0496100_1597943_96_386 94
14 3300048907 Ga0496104_0655641 Ga0496104_0655641_348_638 94
15 3300048908 Ga0496105_0131644 Ga0496105_0131644_220_510 94
16 3300048911 Ga0496108_0030102 Ga0496108_0030102_28_318 94
17 3300048912 Ga0496109_0026336 Ga0496109_0026336_2054_2344 94
18 3300048912 Ga0496109_0894028 Ga0496109_0894028_273_563 94
19 3300048913 Ga0496110_1491880 Ga0496110_1491880_37_327 94
20 3300053085 Ga0495619_0842790 Ga0495619_0842790_61_366 94
21 iso_pu_bacteria 2547132374 2548497070 95
22 iso_pu_bacteria 2643221596 2643992027 95
23 iso_pu_bacteria 2643221717 2644645945 95
24 iso_pu_bacteria 2738541337 2739053553 95
25 3300028800 Ga0265338_10206698 Ga0265338_102066982 96
26 3300031251 Ga0265327_10109760 Ga0265327_101097602 96
27 iso_pu_bacteria 2643221639 2644220369 96
28 iso_pu_bacteria 2643221646 2644259295 96
29 3300005347 Ga0070668_100159177 Ga0070668_1001591772 97
30 3300005457 Ga0070662_100248382 Ga0070662_1002483822 97
31 3300005616 Ga0068852_102506279 Ga0068852_1025062791 97
32 3300005719 Ga0068861_100639513 Ga0068861_1006395132 97
33 3300005843 Ga0068860_101017286 Ga0068860_1010172862 97
34 3300005844 Ga0068862_100055309 Ga0068862_1000553092 97
35 3300009174 Ga0105241_10602117 Ga0105241_106021172 97
36 3300009551 Ga0105238_10179554 Ga0105238_101795544 97
37 3300010375 Ga0105239_12886804 Ga0105239_128868041 97
38 3300025304 Ga0209257_1000696 Ga0209257_100069635 97
39 3300025911 Ga0207654_10585369 Ga0207654_105853691 97
40 3300025924 Ga0207694_10217465 Ga0207694_102174652 97
41 3300025972 Ga0207668_10730291 Ga0207668_107302911 97
42 3300026118 Ga0207675_100507656 Ga0207675_1005076562 97
43 3300026142 Ga0207698_10243769 Ga0207698_102437691 97
44 3300028380 Ga0268265_10246282 Ga0268265_102462822 97
45 3300028800 Ga0265338_10473568 Ga0265338_104735682 97
46 3300031238 Ga0265332_10159502 Ga0265332_101595022 97
47 3300031241 Ga0265325_10002780 Ga0265325_1000278012 97
48 3300031247 Ga0265340_10095426 Ga0265340_100954262 97
49 3300031247 Ga0265340_10167958 Ga0265340_101679582 97
50 3300031249 Ga0265339_10014407 Ga0265339_100144072 97
51 3300031344 Ga0265316_10266511 Ga0265316_102665112 97
52 3300031595 Ga0265313_10174052 Ga0265313_101740522 97
53 3300031711 Ga0265314_10216242 Ga0265314_102162422 97
54 3300031712 Ga0265342_10548298 Ga0265342_105482981 97
55 3300046616 Ga0495668_0058980 Ga0495668_0058980_1473_1766 97
56 3300046660 Ga0495625_0307429 Ga0495625_0307429_290_583 97
57 3300053119 Ga0500595_038315 Ga0500595_038315_307_600 97
58 3300005459 Ga0068867_100593773 Ga0068867_1005937732 98
59 3300005518 Ga0070699_100920523 Ga0070699_1009205231 98
60 3300005578 Ga0068854_101622413 Ga0068854_1016224132 98
61 3300005718 Ga0068866_10194237 Ga0068866_101942372 98
62 3300005843 Ga0068860_100811418 Ga0068860_1008114182 98
63 3300006195 Ga0075366_10058913 Ga0075366_100589133 98
64 3300006353 Ga0075370_10035161 Ga0075370_100351613 98
65 3300009148 Ga0105243_10056084 Ga0105243_100560843 98
66 3300009553 Ga0105249_10158929 Ga0105249_101589292 98
67 3300025899 Ga0207642_10473313 Ga0207642_104733131 98
68 3300025935 Ga0207709_10074891 Ga0207709_100748913 98
69 3300025935 Ga0207709_11542699 Ga0207709_115426991 98
70 3300025961 Ga0207712_10850762 Ga0207712_108507622 98
71 3300025981 Ga0207640_11773676 Ga0207640_117736762 98
72 3300026089 Ga0207648_10175060 Ga0207648_101750602 98
73 3300028381 Ga0268264_10809332 Ga0268264_108093321 98
74 3300031730 Ga0307516_10027676 Ga0307516_100276765 98
75 3300033180 Ga0307510_10651308 Ga0307510_106513081 98
76 3300039437 Ga0436365_0305578 Ga0436365_0305578_77_373 98
77 3300042876 Ga0451577_0596048 Ga0451577_0596048_605_901 98
78 3300044712 Ga0453684_0633627 Ga0453684_0633627_825_1121 98
79 3300046471 Ga0495650_0118923 Ga0495650_0118923_635_931 98
80 3300046535 Ga0495586_0139164 Ga0495586_0139164_837_1133 98
81 3300050491 nmdc:mga00v17_74965_c1 nmdc:mga00v17_74965_c1_1291_1587 98
82 3300050493 nmdc:mga0k408_819797_c1 nmdc:mga0k408_819797_c1_157_453 98
83 3300003322 rootL2_10039438 rootL2_100394387 99
84 3300003323 rootH1_10015317 rootH1_100153174 99
85 3300005327 Ga0070658_10743830 Ga0070658_107438301 99
86 3300005339 Ga0070660_100064567 Ga0070660_1000645675 99
87 3300005366 Ga0070659_100475671 Ga0070659_1004756711 99
88 3300005437 Ga0070710_10701219 Ga0070710_107012192 99
89 3300005455 Ga0070663_100195845 Ga0070663_1001958452 99
90 3300005458 Ga0070681_10134153 Ga0070681_101341533 99
91 3300005539 Ga0068853_101318746 Ga0068853_1013187461 99
92 3300005563 Ga0068855_100134771 Ga0068855_1001347715 99
93 3300005618 Ga0068864_101678027 Ga0068864_1016780272 99
94 3300007788 Ga0099795_10152251 Ga0099795_101522511 99
95 3300013100 Ga0157373_10028560 Ga0157373_100285603 99
96 3300013104 Ga0157370_10287675 Ga0157370_102876753 99
97 3300013307 Ga0157372_10062461 Ga0157372_100624614 99
98 3300013307 Ga0157372_10732090 Ga0157372_107320901 99
99 3300025909 Ga0207705_10046851 Ga0207705_100468513 99
100 3300025912 Ga0207707_10361381 Ga0207707_103613811 99
101 3300025917 Ga0207660_10152883 Ga0207660_101528834 99
102 3300025919 Ga0207657_10005075 Ga0207657_1000507511 99
103 3300025921 Ga0207652_10471367 Ga0207652_104713673 99
104 3300025932 Ga0207690_10804073 Ga0207690_108040731 99
105 3300025949 Ga0207667_11907460 Ga0207667_119074602 99
106 3300025981 Ga0207640_10485588 Ga0207640_104855882 99
107 3300026041 Ga0207639_10615840 Ga0207639_106158403 99
108 3300026116 Ga0207674_10279311 Ga0207674_102793112 99
109 3300026116 Ga0207674_11207145 Ga0207674_112071452 99
110 3300027876 Ga0209974_10240608 Ga0209974_102406081 99
111 3300031251 Ga0265327_10006939 Ga0265327_100069393 99
112 3300031548 Ga0307408_100000111 Ga0307408_10000011149 99
113 3300031731 Ga0307405_10282877 Ga0307405_102828772 99
114 3300031731 Ga0307405_11305168 Ga0307405_113051682 99
115 3300031901 Ga0307406_10000046 Ga0307406_1000004638 99
116 3300032004 Ga0307414_10225092 Ga0307414_102250922 99
117 3300032126 Ga0307415_101766300 Ga0307415_1017663001 99
118 3300035695 Ga0373927_0013460 Ga0373927_0013460_2165_2464 99
119 3300035725 Ga0373947_0028423 Ga0373947_0028423_1560_1859 99
120 3300037312 Ga0395899_0533783 Ga0395899_0533783_71_370 99
121 3300037418 Ga0395900_0829048 Ga0395900_0829048_169_468 99
122 3300038443 Ga0395901_0048523 Ga0395901_0048523_3553_3852 99
123 3300042876 Ga0451577_1989491 Ga0451577_1989491_15_314 99
124 3300044712 Ga0453684_0114072 Ga0453684_0114072_2039_2362 99
125 3300045051 Ga0451576_0653259 Ga0451576_0653259_673_996 99
126 3300046530 Ga0495654_0001128 Ga0495654_0001128_8321_8626 99
127 3300046542 Ga0495597_0118478 Ga0495597_0118478_10_315 99
128 3300048922 Ga0496119_0268023 Ga0496119_0268023_453_752 99
129 3300048928 Ga0496125_0131435 Ga0496125_0131435_168_467 99
130 3300048929 Ga0496126_0066554 Ga0496126_0066554_1628_1927 99
131 3300049568 Ga0501031_0861108 Ga0501031_0861108_148_501 99
132 3300049569 Ga0501032_0045593 Ga0501032_0045593_2614_2913 99
133 3300049569 Ga0501032_0061612 Ga0501032_0061612_209_562 99
134 3300049570 Ga0501033_0035303 Ga0501033_0035303_1593_1892 99
135 3300049570 Ga0501033_0128631 Ga0501033_0128631_937_1236 99
136 3300049570 Ga0501033_0585519 Ga0501033_0585519_276_575 99
137 3300049571 Ga0501034_0289993 Ga0501034_0289993_1042_1341 99
138 3300049571 Ga0501034_0545287 Ga0501034_0545287_509_862 99
139 3300049572 Ga0501036_0164281 Ga0501036_0164281_169_522 99
140 3300049572 Ga0501036_1011246 Ga0501036_1011246_87_386 99
141 3300049573 Ga0501037_0049265 Ga0501037_0049265_11_364 99
142 3300049573 Ga0501037_0260523 Ga0501037_0260523_185_484 99
143 3300049574 Ga0501038_0157873 Ga0501038_0157873_81_434 99
144 3300049575 Ga0501039_0035541 Ga0501039_0035541_1684_2037 99
145 3300049575 Ga0501039_0154432 Ga0501039_0154432_613_912 99
146 3300049579 Ga0501043_0167158 Ga0501043_0167158_806_1105 99
147 3300049579 Ga0501043_0201970 Ga0501043_0201970_190_543 99
148 3300049579 Ga0501043_0360973 Ga0501043_0360973_108_407 99
149 3300049580 Ga0501046_0044381 Ga0501046_0044381_3102_3455 99
150 3300049580 Ga0501046_0121967 Ga0501046_0121967_1625_1924 99
151 3300049581 Ga0501047_0067648 Ga0501047_0067648_1143_1442 99
152 3300049581 Ga0501047_0119163 Ga0501047_0119163_1984_2337 99
153 3300049584 Ga0501068_0046616 Ga0501068_0046616_713_1066 99
154 3300049586 Ga0501070_0442895 Ga0501070_0442895_531_830 99
155 3300049586 Ga0501070_0548686 Ga0501070_0548686_416_769 99
156 3300049587 Ga0501071_0834618 Ga0501071_0834618_254_607 99
157 3300049588 Ga0501072_0182472 Ga0501072_0182472_515_868 99
158 3300049590 Ga0501074_0170532 Ga0501074_0170532_860_1213 99
159 3300049663 Ga0501223_116986 Ga0501223_116986_103_402 99
160 3300049679 Ga0501249_033051 Ga0501249_033051_447_746 99
161 3300049741 Ga0501079_0777182 Ga0501079_0777182_382_735 99
162 3300049742 Ga0501080_0081186 Ga0501080_0081186_20_334 99
163 3300049822 Ga0501035_0035688 Ga0501035_0035688_604_903 99
164 3300049822 Ga0501035_0153304 Ga0501035_0153304_509_862 99
165 3300049823 Ga0501044_0281700 Ga0501044_0281700_524_823 99
166 3300049823 Ga0501044_0380952 Ga0501044_0380952_503_856 99
167 3300053096 Ga0500641_0012007 Ga0500641_0012007_1238_1546 99
168 3300053727 Ga0500611_055466 Ga0500611_055466_171_470 99
169 3300054114 Ga0501084_0312234 Ga0501084_0312234_927_1280 99
170 iso_pu_bacteria 2643221628 2644160354 99
171 iso_pu_bacteria 2945909444 2945910756 99
172 iso_pu_bacteria 2945945610 2945946639 99
173 iso_pu_bacteria 2945984333 2945987071 99
174 3300003781 Ga0055536_1003522 Ga0055536_10035225 100
175 3300025292 Ga0209676_1000238 Ga0209676_10002385 100
176 3300025294 Ga0209025_1178192 Ga0209025_11781921 100
177 3300045051 Ga0451576_0020692 Ga0451576_0020692_1750_2094 100
178 3300048929 Ga0496126_0471940 Ga0496126_0471940_92_394 100
179 iso_pu_bacteria 2513020051 2513229418 101
180 iso_pu_bacteria 2599185214 2599622735 101
181 iso_pu_bacteria 2599185226 2599671214 101
182 iso_pu_bacteria 2599185227 2599679749 101
183 iso_pu_bacteria 2599185229 2599691765 101
184 iso_pu_bacteria 2643221658 2644324917 101
185 iso_pu_bacteria 2643221672 2644396786 101
186 iso_pu_bacteria 2738541277 2738718635 101
187 iso_pu_bacteria 2738541307 2738884759 101
188 iso_pu_bacteria 2738543019 2739280653 101
189 iso_pu_bacteria 2818991446 2819599929 101
190 iso_pu_bacteria 2831265667 2831267196 101
191 iso_pu_bacteria 2838054893 2838056286 101
192 iso_pu_bacteria 2885198086 2885204774 101
193 iso_pu_bacteria 2885211737 2885218539 101
194 iso_pu_bacteria 2899924645 2899926667 101
195 iso_pu_bacteria 2904541872 2904548699 101
196 iso_pu_bacteria 2928037797 2928044247 101
197 iso_pu_bacteria 2928044640 2928048379 101
198 iso_pu_bacteria 2928051484 2928052345 101
199 iso_pu_bacteria 2928064002 2928064985 101
200 iso_pu_bacteria 2928070936 2928074532 101
201 iso_pu_bacteria 2929160207 2929164635 101
202 3300003187 JGI25151J46595_10071347 JGI25151J46595_100713472 103
203 3300003773 Ga0055537_1000050 Ga0055537_100005064 103
204 3300003784 Ga0055534_1000035 Ga0055534_100003592 103
205 3300003790 Ga0055528_1000757 Ga0055528_100075714 103
206 3300005548 Ga0070665_102441872 Ga0070665_1024418721 103
207 3300006038 Ga0075365_10018891 Ga0075365_100188914 103
208 3300006048 Ga0075363_100115336 Ga0075363_1001153362 103
209 3300006048 Ga0075363_100223986 Ga0075363_1002239862 103
210 3300006051 Ga0075364_10058399 Ga0075364_100583994 103
211 3300006051 Ga0075364_10200772 Ga0075364_102007721 103
212 3300006051 Ga0075364_10261385 Ga0075364_102613852 103
213 3300006058 Ga0075432_10024994 Ga0075432_100249942 103
214 3300006058 Ga0075432_10045146 Ga0075432_100451462 103
215 3300006177 Ga0075362_10011478 Ga0075362_100114783 103
216 3300006177 Ga0075362_10292834 Ga0075362_102928342 103
217 3300006178 Ga0075367_10116927 Ga0075367_101169272 103
218 3300006178 Ga0075367_10379787 Ga0075367_103797872 103
219 3300006178 Ga0075367_10426374 Ga0075367_104263742 103
220 3300006186 Ga0075369_10251330 Ga0075369_102513301 103
221 3300006195 Ga0075366_10028085 Ga0075366_100280853 103
222 3300006195 Ga0075366_10032901 Ga0075366_100329014 103
223 3300006195 Ga0075366_10424011 Ga0075366_104240112 103
224 3300006353 Ga0075370_10000601 Ga0075370_1000060111 103
225 3300006353 Ga0075370_10001258 Ga0075370_100012589 103
226 3300006353 Ga0075370_10311726 Ga0075370_103117262 103
227 3300006353 Ga0075370_10322206 Ga0075370_103222062 103
228 3300006948 Ga0099826_10000615 Ga0099826_100006155 103
229 3300009148 Ga0105243_10280578 Ga0105243_102805782 103
230 3300011119 Ga0105246_10035346 Ga0105246_100353463 103
231 3300013104 Ga0157370_10005005 Ga0157370_100050052 103
232 3300014497 Ga0182008_10017215 Ga0182008_100172153 103
233 3300015262 Ga0182007_10116679 Ga0182007_101166791 103
234 3300017792 Ga0163161_10000171 Ga0163161_1000017128 103
235 3300017792 Ga0163161_10002666 Ga0163161_100026666 103
236 3300025258 Ga0209129_1008166 Ga0209129_10081662 103
237 3300025263 Ga0209565_1000115 Ga0209565_100011594 103
238 3300025273 Ga0209673_1001031 Ga0209673_100103125 103
239 3300025291 Ga0209675_1000110 Ga0209675_100011094 103
240 3300025294 Ga0209025_1000168 Ga0209025_10001682 103
241 3300025294 Ga0209025_1003706 Ga0209025_100370618 103
242 3300025901 Ga0207688_10162534 Ga0207688_101625342 103
243 3300025935 Ga0207709_10145151 Ga0207709_101451513 103
244 3300025935 Ga0207709_11026590 Ga0207709_110265902 103
245 3300026089 Ga0207648_10265234 Ga0207648_102652342 103
246 3300027666 Ga0209282_1000241 Ga0209282_10002418 103
247 3300027907 Ga0207428_10669822 Ga0207428_106698222 103
248 3300028380 Ga0268265_10061483 Ga0268265_100614832 103
249 3300028794 Ga0307515_10308100 Ga0307515_103081002 103
250 3300031456 Ga0307513_10406383 Ga0307513_104063832 103
251 3300031548 Ga0307408_100098212 Ga0307408_1000982122 103
252 3300031616 Ga0307508_10724830 Ga0307508_107248301 103
253 3300031649 Ga0307514_10007518 Ga0307514_100075184 103
254 3300031824 Ga0307413_10268216 Ga0307413_102682162 103
255 3300031852 Ga0307410_10227546 Ga0307410_102275462 103
256 3300031852 Ga0307410_10302126 Ga0307410_103021262 103
257 3300031901 Ga0307406_10105261 Ga0307406_101052612 103
258 3300031903 Ga0307407_10034959 Ga0307407_100349594 103
259 3300031903 Ga0307407_10101301 Ga0307407_101013012 103
260 3300031903 Ga0307407_10764988 Ga0307407_107649882 103
261 3300031911 Ga0307412_10001515 Ga0307412_1000151515 103
262 3300031911 Ga0307412_10056317 Ga0307412_100563172 103
263 3300031911 Ga0307412_10188608 Ga0307412_101886082 103
264 3300031911 Ga0307412_10513116 Ga0307412_105131162 103
265 3300031995 Ga0307409_101044993 Ga0307409_1010449932 103
266 3300032004 Ga0307414_10037744 Ga0307414_100377442 103
267 3300032004 Ga0307414_10067057 Ga0307414_100670574 103
268 3300032005 Ga0307411_10018921 Ga0307411_100189214 103
269 3300032005 Ga0307411_10031021 Ga0307411_100310212 103
270 3300041411 Ga0439466_0009501 Ga0439466_0009501_50_361 103
271 3300041413 Ga0439465_0001088 Ga0439465_0001088_8379_8690 103
272 3300041498 Ga0451841_0556179 Ga0451841_0556179_193_504 103
273 3300041512 Ga0451853_1766864 Ga0451853_1766864_652_963 103
274 3300041997 Ga0439431_0018070 Ga0439431_0018070_938_1249 103
275 3300042002 Ga0439442_005658 Ga0439442_005658_183_494 103
276 3300042122 Ga0450920_026301 Ga0450920_026301_653_964 103
277 3300042125 Ga0450923_000886 Ga0450923_000886_1811_2122 103
278 3300042145 Ga0450906_000564 Ga0450906_000564_447_758 103
279 3300042147 Ga0450910_052449 Ga0450910_052449_184_495 103
280 3300042156 Ga0439446_0008417 Ga0439446_0008417_2351_2662 103
281 3300042184 Ga0450908_083188 Ga0450908_083188_86_397 103
282 3300042184 Ga0450908_084531 Ga0450908_084531_210_521 103
283 3300042435 Ga0439434_0006121 Ga0439434_0006121_1825_2136 103
284 3300042531 Ga0450918_024734 Ga0450918_024734_188_499 103
285 3300046530 Ga0495654_0163631 Ga0495654_0163631_229_540 103
286 3300046660 Ga0495625_0000057 Ga0495625_0000057_33219_33530 103
287 3300046674 Ga0495588_0077355 Ga0495588_0077355_1100_1411 103
288 3300050489 nmdc:mga03683_10478_c1 nmdc:mga03683_10478_c1_1052_1363 103
289 3300050489 nmdc:mga03683_15295_c1 nmdc:mga03683_15295_c1_527_838 103
290 3300050489 nmdc:mga03683_191045_c1 nmdc:mga03683_191045_c1_333_644 103
291 3300050490 nmdc:mga03n38_39788_c1 nmdc:mga03n38_39788_c1_887_1198 103
292 3300050490 nmdc:mga03n38_6606_c1 nmdc:mga03n38_6606_c1_1175_1486 103
293 3300050491 nmdc:mga00v17_14956_c1 nmdc:mga00v17_14956_c1_428_739 103
294 3300050491 nmdc:mga00v17_200186_c1 nmdc:mga00v17_200186_c1_711_1022 103
295 3300050491 nmdc:mga00v17_227197_c1 nmdc:mga00v17_227197_c1_279_590 103
296 3300050493 nmdc:mga0k408_104471_c1 nmdc:mga0k408_104471_c1_657_968 103
297 3300050493 nmdc:mga0k408_106381_c1 nmdc:mga0k408_106381_c1_892_1203 103
298 3300050493 nmdc:mga0k408_237729_c1 nmdc:mga0k408_237729_c1_152_463 103
299 3300050494 nmdc:mga06z11_851166_c1 nmdc:mga06z11_851166_c1_136_447 103
300 3300050496 nmdc:mga07m45_135133_c1 nmdc:mga07m45_135133_c1_419_730 103
301 3300050496 nmdc:mga07m45_20054_c1 nmdc:mga07m45_20054_c1_1611_1922 103
302 3300050496 nmdc:mga07m45_59_c1 nmdc:mga07m45_59_c1_31280_31591 103
303 3300050516 nmdc:mga0sz30_223334_c1 nmdc:mga0sz30_223334_c1_468_779 103
304 3300050516 nmdc:mga0sz30_374998_c1 nmdc:mga0sz30_374998_c1_314_625 103
305 3300005353 Ga0070669_100226168 Ga0070669_1002261681 104
306 3300006178 Ga0075367_10166135 Ga0075367_101661351 104
307 3300006237 Ga0097621_101628139 Ga0097621_1016281392 104
308 3300035120 Ga0373957_0107613 Ga0373957_0107613_439_753 104
309 3300046471 Ga0495650_0028820 Ga0495650_0028820_98_418 104
310 3300046681 Ga0495647_0451251 Ga0495647_0451251_55_369 104
311 3300046683 Ga0495658_0391581 Ga0495658_0391581_533_847 104
312 3300001989 JGI24739J22299_10046416 JGI24739J22299_100464162 105
313 3300002739 JGI25158J39367_1024790 JGI25158J39367_10247901 105
314 3300002773 JGI25152J39213_1006255 JGI25152J39213_10062555 105
315 3300002773 JGI25152J39213_1011969 JGI25152J39213_10119691 105
316 3300002774 JGI25150J39212_1002176 JGI25150J39212_10021762 105
317 3300002774 JGI25150J39212_1032152 JGI25150J39212_10321521 105
318 3300002987 JGI25159J45721_1007273 JGI25159J45721_10072732 105
319 3300002987 JGI25159J45721_1013477 JGI25159J45721_10134771 105
320 3300003187 JGI25151J46595_10020167 JGI25151J46595_100201674 105
321 3300003187 JGI25151J46595_10035621 JGI25151J46595_100356211 105
322 3300003187 JGI25151J46595_10065077 JGI25151J46595_100650772 105
323 3300003215 JGI25153J46596_10029393 JGI25153J46596_100293931 105
324 3300003215 JGI25153J46596_10053786 JGI25153J46596_100537861 105
325 3300003316 rootH1_10002678 rootH1_100026782 105
326 3300003354 JGI25160J50197_1021864 JGI25160J50197_10218641 105
327 3300003354 JGI25160J50197_1025982 JGI25160J50197_10259821 105
328 3300003374 JGI25161J50226_1010282 JGI25161J50226_10102822 105
329 3300003374 JGI25161J50226_1010317 JGI25161J50226_10103172 105
330 3300003578 Ga0006562J51391_1061291 Ga0006562J51391_10612912 105
331 3300003758 Ga0055532_1021318 Ga0055532_10213182 105
332 3300003760 Ga0055527_1018798 Ga0055527_10187982 105
333 3300003761 Ga0055535_1000383 Ga0055535_10003836 105
334 3300003762 Ga0055542_1000268 Ga0055542_100026838 105
335 3300003771 Ga0055526_1025345 Ga0055526_10253451 105
336 3300003771 Ga0055526_1025601 Ga0055526_10256011 105
337 3300003773 Ga0055537_1010866 Ga0055537_10108661 105
338 3300003773 Ga0055537_1018605 Ga0055537_10186051 105
339 3300003775 Ga0055524_1020580 Ga0055524_10205803 105
340 3300003775 Ga0055524_1024856 Ga0055524_10248561 105
341 3300003781 Ga0055536_1002335 Ga0055536_10023356 105
342 3300003781 Ga0055536_1008920 Ga0055536_10089205 105
343 3300003781 Ga0055536_1069484 Ga0055536_10694842 105
344 3300003784 Ga0055534_1006337 Ga0055534_10063372 105
345 3300003784 Ga0055534_1010801 Ga0055534_10108011 105
346 3300003784 Ga0055534_1048637 Ga0055534_10486371 105
347 3300003790 Ga0055528_1023383 Ga0055528_10233831 105
348 3300003790 Ga0055528_1038614 Ga0055528_10386141 105
349 3300003791 Ga0055530_10000937 Ga0055530_100009372 105
350 3300003791 Ga0055530_10003756 Ga0055530_100037569 105
351 3300003792 Ga0055540_1000291 Ga0055540_10002912 105
352 3300003792 Ga0055540_1000814 Ga0055540_100081410 105
353 3300003792 Ga0055540_1004996 Ga0055540_10049965 105
354 3300003792 Ga0055540_1029104 Ga0055540_10291041 105
355 3300003794 Ga0055531_10006028 Ga0055531_100060282 105
356 3300003794 Ga0055531_10006383 Ga0055531_100063831 105
357 3300003794 Ga0055531_10008545 Ga0055531_100085457 105
358 3300004625 Ga0055543_1011525 Ga0055543_10115251 105
359 3300005262 Ga0065165_1026007 Ga0065165_10260071 105
360 3300005262 Ga0065165_1028085 Ga0065165_10280851 105
361 3300005262 Ga0065165_1085570 Ga0065165_10855702 105
362 3300005339 Ga0070660_100637177 Ga0070660_1006371771 105
363 3300005344 Ga0070661_100270392 Ga0070661_1002703922 105
364 3300005366 Ga0070659_100591677 Ga0070659_1005916772 105
365 3300005455 Ga0070663_100610906 Ga0070663_1006109062 105
366 3300005457 Ga0070662_100036915 Ga0070662_1000369152 105
367 3300005457 Ga0070662_100871880 Ga0070662_1008718802 105
368 3300005539 Ga0068853_100009092 Ga0068853_1000090922 105
369 3300005539 Ga0068853_100214045 Ga0068853_1002140452 105
370 3300005539 Ga0068853_100598617 Ga0068853_1005986172 105
371 3300005563 Ga0068855_100029070 Ga0068855_1000290702 105
372 3300005577 Ga0068857_100624133 Ga0068857_1006241331 105
373 3300005577 Ga0068857_101146257 Ga0068857_1011462572 105
374 3300005616 Ga0068852_100552804 Ga0068852_1005528042 105
375 3300005834 Ga0068851_10043222 Ga0068851_100432223 105
376 3300006048 Ga0075363_100538491 Ga0075363_1005384911 105
377 3300006058 Ga0075432_10105803 Ga0075432_101058032 105
378 3300006178 Ga0075367_10109254 Ga0075367_101092542 105
379 3300006186 Ga0075369_10144447 Ga0075369_101444472 105
380 3300006195 Ga0075366_10946485 Ga0075366_109464851 105
381 3300006353 Ga0075370_10040493 Ga0075370_100404932 105
382 3300006353 Ga0075370_10193653 Ga0075370_101936532 105
383 3300006353 Ga0075370_10453762 Ga0075370_104537622 105
384 3300006358 Ga0068871_100243986 Ga0068871_1002439862 105
385 3300006881 Ga0068865_100745263 Ga0068865_1007452632 105
386 3300009036 Ga0105244_10000502 Ga0105244_100005024 105
387 3300009036 Ga0105244_10150938 Ga0105244_101509382 105
388 3300009036 Ga0105244_10280259 Ga0105244_102802591 105
389 3300009093 Ga0105240_10088285 Ga0105240_100882855 105
390 3300009093 Ga0105240_10362498 Ga0105240_103624982 105
391 3300009148 Ga0105243_10000269 Ga0105243_100002692 105
392 3300009148 Ga0105243_10176220 Ga0105243_101762202 105
393 3300009545 Ga0105237_10009449 Ga0105237_1000944913 105
394 3300009545 Ga0105237_10232810 Ga0105237_102328102 105
395 3300009551 Ga0105238_10080569 Ga0105238_100805692 105
396 3300009551 Ga0105238_10632251 Ga0105238_106322512 105
397 3300010375 Ga0105239_10212322 Ga0105239_102123223 105
398 3300010375 Ga0105239_10515135 Ga0105239_105151352 105
399 3300011119 Ga0105246_10138712 Ga0105246_101387122 105
400 3300011119 Ga0105246_10282131 Ga0105246_102821312 105
401 3300013100 Ga0157373_10059295 Ga0157373_100592954 105
402 3300013102 Ga0157371_10109095 Ga0157371_101090951 105
403 3300013104 Ga0157370_10355247 Ga0157370_103552472 105
404 3300013104 Ga0157370_10457504 Ga0157370_104575042 105
405 3300013104 Ga0157370_10636244 Ga0157370_106362442 105
406 3300013105 Ga0157369_10149859 Ga0157369_101498592 105
407 3300013105 Ga0157369_11010979 Ga0157369_110109792 105
408 3300013297 Ga0157378_10901045 Ga0157378_109010452 105
409 3300013306 Ga0163162_11319215 Ga0163162_113192151 105
410 3300013307 Ga0157372_10487233 Ga0157372_104872332 105
411 3300014497 Ga0182008_10002006 Ga0182008_1000200614 105
412 3300014969 Ga0157376_10141776 Ga0157376_101417762 105
413 3300015261 Ga0182006_1001117 Ga0182006_100111712 105
414 3300015262 Ga0182007_10000238 Ga0182007_1000023826 105
415 3300015265 Ga0182005_1135616 Ga0182005_11356161 105
416 3300017792 Ga0163161_10023346 Ga0163161_100233464 105
417 3300025208 Ga0209436_103530 Ga0209436_1035303 105
418 3300025208 Ga0209436_103818 Ga0209436_1038183 105
419 3300025228 Ga0209672_101080 Ga0209672_1010807 105
420 3300025229 Ga0209147_102032 Ga0209147_1020321 105
421 3300025242 Ga0209258_100009 Ga0209258_100009203 105
422 3300025245 Ga0207425_1000266 Ga0207425_100026611 105
423 3300025245 Ga0207425_1001945 Ga0207425_10019454 105
424 3300025253 Ga0209677_117992 Ga0209677_1179921 105
425 3300025254 Ga0209148_1000007 Ga0209148_1000007203 105
426 3300025258 Ga0209129_1000013 Ga0209129_1000013443 105
427 3300025258 Ga0209129_1008309 Ga0209129_10083093 105
428 3300025263 Ga0209565_1000228 Ga0209565_100022839 105
429 3300025263 Ga0209565_1008439 Ga0209565_10084392 105
430 3300025263 Ga0209565_1083729 Ga0209565_10837291 105
431 3300025273 Ga0209673_1000309 Ga0209673_100030970 105
432 3300025273 Ga0209673_1000329 Ga0209673_100032975 105
433 3300025284 Ga0209130_1000284 Ga0209130_100028428 105
434 3300025284 Ga0209130_1000429 Ga0209130_100042919 105
435 3300025284 Ga0209130_1001662 Ga0209130_100166216 105
436 3300025291 Ga0209675_1000238 Ga0209675_100023851 105
437 3300025291 Ga0209675_1000791 Ga0209675_10007912 105
438 3300025291 Ga0209675_1041351 Ga0209675_10413512 105
439 3300025292 Ga0209676_1000004 Ga0209676_1000004302 105
440 3300025292 Ga0209676_1000162 Ga0209676_100016255 105
441 3300025292 Ga0209676_1000206 Ga0209676_100020622 105
442 3300025292 Ga0209676_1003498 Ga0209676_10034982 105
443 3300025292 Ga0209676_1022796 Ga0209676_10227964 105
444 3300025294 Ga0209025_1000393 Ga0209025_100039331 105
445 3300025294 Ga0209025_1002851 Ga0209025_10028512 105
446 3300025294 Ga0209025_1015601 Ga0209025_10156012 105
447 3300025295 Ga0209564_1000222 Ga0209564_1000222111 105
448 3300025295 Ga0209564_1001526 Ga0209564_10015263 105
449 3300025297 Ga0209758_1000134 Ga0209758_1000134153 105
450 3300025297 Ga0209758_1007869 Ga0209758_10078698 105
451 3300025298 Ga0209050_1000002 Ga0209050_1000002812 105
452 3300025298 Ga0209050_1000512 Ga0209050_100051247 105
453 3300025298 Ga0209050_1025843 Ga0209050_10258432 105
454 3300025299 Ga0209256_1000060 Ga0209256_1000060220 105
455 3300025299 Ga0209256_1000472 Ga0209256_100047245 105
456 3300025302 Ga0207426_1000095 Ga0207426_1000095152 105
457 3300025302 Ga0207426_1000100 Ga0207426_1000100220 105
458 3300025303 Ga0209051_1000002 Ga0209051_1000002580 105
459 3300025303 Ga0209051_1000274 Ga0209051_100027487 105
460 3300025303 Ga0209051_1000311 Ga0209051_100031130 105
461 3300025304 Ga0209257_1000002 Ga0209257_1000002721 105
462 3300025304 Ga0209257_1000286 Ga0209257_100028699 105
463 3300025304 Ga0209257_1000432 Ga0209257_100043266 105
464 3300025304 Ga0209257_1001946 Ga0209257_10019461 105
465 3300025304 Ga0209257_1006446 Ga0209257_10064462 105
466 3300025321 Ga0207656_10026291 Ga0207656_100262912 105
467 3300025728 Ga0207655_1002609 Ga0207655_100260912 105
468 3300025907 Ga0207645_10215473 Ga0207645_102154732 105
469 3300025913 Ga0207695_10404860 Ga0207695_104048602 105
470 3300025914 Ga0207671_10070892 Ga0207671_100708921 105
471 3300025919 Ga0207657_11223442 Ga0207657_112234422 105
472 3300025920 Ga0207649_10247054 Ga0207649_102470542 105
473 3300025924 Ga0207694_10972761 Ga0207694_109727612 105
474 3300025932 Ga0207690_10413709 Ga0207690_104137092 105
475 3300025933 Ga0207706_10052866 Ga0207706_100528664 105
476 3300025933 Ga0207706_10356878 Ga0207706_103568782 105
477 3300025935 Ga0207709_10002872 Ga0207709_100028722 105
478 3300025935 Ga0207709_10018779 Ga0207709_100187794 105
479 3300025938 Ga0207704_11604895 Ga0207704_116048952 105
480 3300025945 Ga0207679_10049055 Ga0207679_100490554 105
481 3300025981 Ga0207640_10595088 Ga0207640_105950881 105
482 3300025981 Ga0207640_10781193 Ga0207640_107811932 105
483 3300025986 Ga0207658_10189876 Ga0207658_101898762 105
484 3300026041 Ga0207639_10194065 Ga0207639_101940652 105
485 3300026041 Ga0207639_10378987 Ga0207639_103789872 105
486 3300026041 Ga0207639_10503950 Ga0207639_105039502 105
487 3300026078 Ga0207702_10305204 Ga0207702_103052042 105
488 3300026116 Ga0207674_10041465 Ga0207674_100414656 105
489 3300026116 Ga0207674_10630261 Ga0207674_106302611 105
490 3300026142 Ga0207698_10054948 Ga0207698_100549482 105
491 3300031731 Ga0307405_10917916 Ga0307405_109179162 105
492 3300046453 Ga0495627_003670 Ga0495627_003670_693_1010 105
493 3300046512 Ga0495610_0140803 Ga0495610_0140803_367_684 105
494 3300046515 Ga0495620_0022543 Ga0495620_0022543_776_1093 105
495 3300046518 Ga0495631_0000468 Ga0495631_0000468_25609_25926 105
496 3300046520 Ga0495637_0012963 Ga0495637_0012963_537_854 105
497 3300046520 Ga0495637_0133008 Ga0495637_0133008_283_600 105
498 3300046530 Ga0495654_0066994 Ga0495654_0066994_804_1121 105
499 3300046530 Ga0495654_0087835 Ga0495654_0087835_862_1179 105
500 3300046539 Ga0495621_0008758 Ga0495621_0008758_1595_1912 105
501 3300046557 Ga0495622_0298980 Ga0495622_0298980_189_506 105
502 3300046616 Ga0495668_0070257 Ga0495668_0070257_847_1164 105
503 3300046616 Ga0495668_0248802 Ga0495668_0248802_463_780 105
504 3300046660 Ga0495625_0020334 Ga0495625_0020334_4121_4438 105
505 3300046664 Ga0495659_0152391 Ga0495659_0152391_105_422 105
506 3300046674 Ga0495588_0027837 Ga0495588_0027837_1453_1770 105
507 3300046674 Ga0495588_0087450 Ga0495588_0087450_427_744 105
508 3300046683 Ga0495658_0327178 Ga0495658_0327178_218_535 105
509 3300046691 Ga0495670_0075240 Ga0495670_0075240_1001_1318 105
510 3300046691 Ga0495670_0128233 Ga0495670_0128233_414_731 105
511 3300046692 Ga0495671_0027188 Ga0495671_0027188_373_690 105
512 3300046810 Ga0495660_0048944 Ga0495660_0048944_926_1243 105
513 3300047321 Ga0495676_0240763 Ga0495676_0240763_230_547 105
514 3300048903 Ga0496100_0262177 Ga0496100_0262177_187_504 105
515 3300048904 Ga0496101_0016285 Ga0496101_0016285_2577_2894 105
516 3300048905 Ga0496102_0295686 Ga0496102_0295686_582_899 105
517 3300048906 Ga0496103_0311677 Ga0496103_0311677_486_803 105
518 3300048910 Ga0496107_0267176 Ga0496107_0267176_143_460 105
519 3300048919 Ga0496116_0012920 Ga0496116_0012920_5582_5899 105
520 3300048919 Ga0496116_0232557 Ga0496116_0232557_473_790 105
521 3300048919 Ga0496116_0263168 Ga0496116_0263168_292_609 105
522 3300048920 Ga0496117_0032396 Ga0496117_0032396_1028_1345 105
523 3300048920 Ga0496117_0082322 Ga0496117_0082322_1153_1470 105
524 3300048920 Ga0496117_0123556 Ga0496117_0123556_1049_1366 105
525 3300048920 Ga0496117_0254563 Ga0496117_0254563_208_525 105
526 3300048921 Ga0496118_0014242 Ga0496118_0014242_6072_6389 105
527 3300048921 Ga0496118_0036830 Ga0496118_0036830_351_668 105
528 3300048921 Ga0496118_0259751 Ga0496118_0259751_256_573 105
529 3300048922 Ga0496119_0398323 Ga0496119_0398323_65_382 105
530 3300048924 Ga0496121_0056163 Ga0496121_0056163_1075_1392 105
531 3300048924 Ga0496121_0101316 Ga0496121_0101316_513_830 105
532 3300048924 Ga0496121_0841438 Ga0496121_0841438_197_514 105
533 3300048924 Ga0496121_0841459 Ga0496121_0841459_197_514 105
534 3300048925 Ga0496122_0047474 Ga0496122_0047474_89_406 105
535 3300048925 Ga0496122_0083887 Ga0496122_0083887_267_584 105
536 3300048925 Ga0496122_0181293 Ga0496122_0181293_704_1021 105
537 3300048925 Ga0496122_0428536 Ga0496122_0428536_324_641 105
538 3300048926 Ga0496123_0070830 Ga0496123_0070830_543_860 105
539 3300048926 Ga0496123_0113658 Ga0496123_0113658_318_635 105
540 3300048927 Ga0496124_0024885 Ga0496124_0024885_144_461 105
541 3300048927 Ga0496124_0199831 Ga0496124_0199831_389_706 105
542 3300048927 Ga0496124_0304846 Ga0496124_0304846_103_420 105
543 3300048927 Ga0496124_0321306 Ga0496124_0321306_576_893 105
544 3300048928 Ga0496125_0061047 Ga0496125_0061047_2008_2325 105
545 3300048928 Ga0496125_0095570 Ga0496125_0095570_923_1240 105
546 3300048928 Ga0496125_0331254 Ga0496125_0331254_545_892 105
547 3300048928 Ga0496125_0378398 Ga0496125_0378398_142_459 105
548 3300049459 Ga0495678_040121 Ga0495678_040121_910_1227 105
549 3300050490 nmdc:mga03n38_385179_c1 nmdc:mga03n38_385179_c1_371_688 105
550 3300050491 nmdc:mga00v17_928230_c1 nmdc:mga00v17_928230_c1_85_402 105
551 3300050494 nmdc:mga06z11_583989_c1 nmdc:mga06z11_583989_c1_42_359 105
552 3300050496 nmdc:mga07m45_270225_c1 nmdc:mga07m45_270225_c1_220_537 105
553 3300050496 nmdc:mga07m45_52852_c1 nmdc:mga07m45_52852_c1_1087_1404 105
554 3300050496 nmdc:mga07m45_710412_c1 nmdc:mga07m45_710412_c1_26_343 105
555 3300050516 nmdc:mga0sz30_284964_c1 nmdc:mga0sz30_284964_c1_180_497 105
556 3300053079 Ga0500610_0000858 Ga0500610_0000858_422_739 105
557 3300053094 Ga0500566_0164658 Ga0500566_0164658_127_444 105
558 3300053107 Ga0500560_083818 Ga0500560_083818_523_840 105
559 3300053108 Ga0500562_067886 Ga0500562_067886_443_760 105
560 3300053109 Ga0500569_333096 Ga0500569_333096_176_493 105
561 3300053111 Ga0500572_014686 Ga0500572_014686_1056_1373 105
562 3300053117 Ga0500593_000730 Ga0500593_000730_3078_3395 105
563 3300053118 Ga0500594_0043436 Ga0500594_0043436_748_1065 105
564 3300053121 Ga0500607_002971 Ga0500607_002971_927_1244 105
565 3300053129 Ga0500628_164546 Ga0500628_164546_187_504 105
566 3300053133 Ga0500655_008189 Ga0500655_008189_185_502 105
567 3300053134 Ga0500658_0000175 Ga0500658_0000175_14865_15182 105
568 3300053134 Ga0500658_0000714 Ga0500658_0000714_13039_13356 105
569 3300053136 Ga0500559_0052329 Ga0500559_0052329_436_753 105
570 3300053136 Ga0500559_0567983 Ga0500559_0567983_179_496 105
571 3300053142 Ga0500577_0261951 Ga0500577_0261951_186_503 105
572 3300053153 Ga0500616_0009338 Ga0500616_0009338_531_848 105
573 3300053158 Ga0500627_0000917 Ga0500627_0000917_1488_1805 105
574 3300053160 Ga0500633_0171482 Ga0500633_0171482_161_478 105
575 3300053161 Ga0500634_0021265 Ga0500634_0021265_663_980 105
576 3300053162 Ga0500638_012949 Ga0500638_012949_2908_3225 105
577 3300053729 Ga0500625_104933 Ga0500625_104933_577_894 105
578 3300053735 Ga0500596_009087 Ga0500596_009087_543_860 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

19

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.9673 2 91
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9588 2 94
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.9537 2 88
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9499 2 93
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.9481 1 94
ID Description Score Start End Superfamily
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9584 2 91 3.30.70.100
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9538 4 93 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9528 2 88 3.30.70.100
af_Q96P71_296_384_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9493 3 89 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9453 2 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7C7XWW2-F1-model_v4 Uncharacterized protein 0.9848 1 97
AF-A0A2V8C7Q6-F1-model_v4 ABM domain-containing protein 0.9843 2 93 GO:0003824
AF-A0A5B2YYZ4-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9766 2 91 GO:0004497
AF-A0A2A6EBY6-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9764 2 91 GO:0004497
AF-A0A3E0HX61-F1-model_v4 Quinol monooxygenase YgiN 0.976 2 91 GO:0004497

Feature Viewer

pLDDT pTM Quality
96.07 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map