F465774
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 331 | 545 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0861108|Ga0501031_0861108_148_501 |
| Length | 117 |
| Sequence | MIEYTLALRADVWMGENRMIVVTGSVIARQETLDEILRLSLEHVHRSRSEPGCLSHAVHIDYENPLRLVFVERWADRDALLAHFAVPASREFVKALQPLAAAATTIEIYDARQLEKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 11 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 12 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 13 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 14 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 15 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 16 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 17 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 18 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 19 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 20 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 21 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 22 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 23 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 24 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 25 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 26 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 27 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 28 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 29 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 30 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 31 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 32 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 33 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 36 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 37 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 38 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 46 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 47 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 221 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 222 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 223 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 224 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 225 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 226 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 227 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 311 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 313 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 316 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 318 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 320 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 326 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 329 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 330 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.12 |
| Metatranscriptomes | 0.17 |
| Isolates | 5.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 33.22 |
| Nodule | 0.52 |
| Rhizoplane | 2.6 |
| Rhizosphere | 52.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10046416 | 3300001989 | Bacteria | 1422 |
| 2 | JGI25158J39367_1024790 | 3300002739 | Bacteria | 709 |
| 3 | JGI25152J39213_1006255 | 3300002773 | Bacteria | 3289 |
| 4 | JGI25152J39213_1011969 | 3300002773 | Bacteria | 1888 |
| 5 | JGI25150J39212_1002176 | 3300002774 | Bacteria | 5026 |
| 6 | JGI25150J39212_1032152 | 3300002774 | Bacteria | 718 |
| 7 | JGI25159J45721_1007273 | 3300002987 | Bacteria | 3190 |
| 8 | JGI25159J45721_1013477 | 3300002987 | Bacteria | 1888 |
| 9 | JGI25151J46595_10020167 | 3300003187 | Bacteria | 2815 |
| 10 | JGI25151J46595_10035621 | 3300003187 | Bacteria | 1888 |
| 11 | JGI25151J46595_10065077 | 3300003187 | Bacteria | 1137 |
| 12 | JGI25151J46595_10071347 | 3300003187 | Bacteria | 1050 |
| 13 | JGI25153J46596_10029393 | 3300003215 | Bacteria | 1888 |
| 14 | JGI25153J46596_10053786 | 3300003215 | Bacteria | 1137 |
| 15 | rootH1_10002678 | 3300003316 | Bacteria | 1467 |
| 16 | rootL2_10039438 | 3300003322 | Bacteria | 5108 |
| 17 | rootH1_10015317 | 3300003323 | Bacteria | 3745 |
| 18 | JGI25160J50197_1021864 | 3300003354 | Bacteria | 1888 |
| 19 | JGI25160J50197_1025982 | 3300003354 | Bacteria | 1623 |
| 20 | JGI25161J50226_1010282 | 3300003374 | Bacteria | 1261 |
| 21 | JGI25161J50226_1010317 | 3300003374 | Bacteria | 1255 |
| 22 | Ga0006562J51391_1061291 | 3300003578 | Bacteria | 2320 |
| 23 | Ga0055532_1021318 | 3300003758 | Bacteria | 667 |
| 24 | Ga0055527_1018798 | 3300003760 | Bacteria | 733 |
| 25 | Ga0055535_1000383 | 3300003761 | Bacteria | 41879 |
| 26 | Ga0055542_1000268 | 3300003762 | Bacteria | 58408 |
| 27 | Ga0055526_1025345 | 3300003771 | Bacteria | 1905 |
| 28 | Ga0055526_1025601 | 3300003771 | Bacteria | 1888 |
| 29 | Ga0055537_1000050 | 3300003773 | Bacteria | 86738 |
| 30 | Ga0055537_1010866 | 3300003773 | Bacteria | 1888 |
| 31 | Ga0055537_1018605 | 3300003773 | Bacteria | 1104 |
| 32 | Ga0055524_1020580 | 3300003775 | Bacteria | 2217 |
| 33 | Ga0055524_1024856 | 3300003775 | Bacteria | 1888 |
| 34 | Ga0055536_1002335 | 3300003781 | Bacteria | 10735 |
| 35 | Ga0055536_1003522 | 3300003781 | Bacteria | 8379 |
| 36 | Ga0055536_1008920 | 3300003781 | Bacteria | 4233 |
| 37 | Ga0055536_1069484 | 3300003781 | Bacteria | 700 |
| 38 | Ga0055534_1000035 | 3300003784 | Bacteria | 114162 |
| 39 | Ga0055534_1006337 | 3300003784 | Bacteria | 2994 |
| 40 | Ga0055534_1010801 | 3300003784 | Bacteria | 1888 |
| 41 | Ga0055534_1048637 | 3300003784 | Bacteria | 607 |
| 42 | Ga0055528_1000757 | 3300003790 | Bacteria | 22561 |
| 43 | Ga0055528_1023383 | 3300003790 | Bacteria | 1888 |
| 44 | Ga0055528_1038614 | 3300003790 | Bacteria | 1104 |
| 45 | Ga0055530_10000937 | 3300003791 | Bacteria | 23880 |
| 46 | Ga0055530_10003756 | 3300003791 | Bacteria | 8383 |
| 47 | Ga0055540_1000291 | 3300003792 | Bacteria | 44881 |
| 48 | Ga0055540_1000814 | 3300003792 | Bacteria | 21128 |
| 49 | Ga0055540_1004996 | 3300003792 | Bacteria | 5764 |
| 50 | Ga0055540_1029104 | 3300003792 | Bacteria | 1297 |
| 51 | Ga0055531_10006028 | 3300003794 | Bacteria | 6954 |
| 52 | Ga0055531_10006383 | 3300003794 | Bacteria | 6704 |
| 53 | Ga0055531_10008545 | 3300003794 | Bacteria | 5377 |
| 54 | Ga0055543_1011525 | 3300004625 | Bacteria | 1805 |
| 55 | Ga0065165_1026007 | 3300005262 | Bacteria | 1933 |
| 56 | Ga0065165_1028085 | 3300005262 | Bacteria | 1822 |
| 57 | Ga0065165_1085570 | 3300005262 | Bacteria | 811 |
| 58 | Ga0070658_10743830 | 3300005327 | Unclassified | 851 |
| 59 | Ga0070660_100064567 | 3300005339 | Bacteria | 2848 |
| 60 | Ga0070660_100637177 | 3300005339 | Bacteria | 892 |
| 61 | Ga0070661_100270392 | 3300005344 | Bacteria | 1316 |
| 62 | Ga0070661_100334375 | 3300005344 | Bacteria | 1185 |
| 63 | Ga0070668_100159177 | 3300005347 | Bacteria | 1831 |
| 64 | Ga0070669_100226168 | 3300005353 | Bacteria | 1481 |
| 65 | Ga0070659_100475671 | 3300005366 | Unclassified | 1062 |
| 66 | Ga0070659_100591677 | 3300005366 | Bacteria | 953 |
| 67 | Ga0070710_10701219 | 3300005437 | Bacteria | 714 |
| 68 | Ga0070663_100195845 | 3300005455 | Bacteria | 1575 |
| 69 | Ga0070663_100610906 | 3300005455 | Bacteria | 918 |
| 70 | Ga0070662_100036915 | 3300005457 | Bacteria | 3461 |
| 71 | Ga0070662_100248382 | 3300005457 | Bacteria | 1429 |
| 72 | Ga0070662_100871880 | 3300005457 | Bacteria | 767 |
| 73 | Ga0070681_10134153 | 3300005458 | Bacteria | 2407 |
| 74 | Ga0068867_100593773 | 3300005459 | Bacteria | 965 |
| 75 | Ga0070699_100920523 | 3300005518 | Bacteria | 801 |
| 76 | Ga0068853_100009092 | 3300005539 | Bacteria | 8000 |
| 77 | Ga0068853_100214045 | 3300005539 | Bacteria | 1757 |
| 78 | Ga0068853_100598617 | 3300005539 | Bacteria | 1047 |
| 79 | Ga0068853_101318746 | 3300005539 | Bacteria | 698 |
| 80 | Ga0070665_101540327 | 3300005548 | Bacteria | 673 |
| 81 | Ga0070665_102441872 | 3300005548 | Bacteria | 525 |
| 82 | Ga0068855_100029070 | 3300005563 | Bacteria | 6610 |
| 83 | Ga0068855_100134771 | 3300005563 | Bacteria | 2818 |
| 84 | Ga0068857_100624133 | 3300005577 | Bacteria | 1020 |
| 85 | Ga0068857_101146257 | 3300005577 | Bacteria | 752 |
| 86 | Ga0068854_101622413 | 3300005578 | Bacteria | 590 |
| 87 | Ga0068852_100552804 | 3300005616 | Bacteria | 1152 |
| 88 | Ga0068852_102506279 | 3300005616 | Bacteria | 536 |
| 89 | Ga0068864_101678027 | 3300005618 | Bacteria | 640 |
| 90 | Ga0068866_10194237 | 3300005718 | Bacteria | 1208 |
| 91 | Ga0068861_100639513 | 3300005719 | Bacteria | 981 |
| 92 | Ga0068851_10043222 | 3300005834 | Bacteria | 2271 |
| 93 | Ga0068860_100811418 | 3300005843 | Bacteria | 949 |
| 94 | Ga0068860_101017286 | 3300005843 | Bacteria | 847 |
| 95 | Ga0068862_100055309 | 3300005844 | Bacteria | 3399 |
| 96 | Ga0075365_10018891 | 3300006038 | Bacteria | 4245 |
| 97 | Ga0075363_100115336 | 3300006048 | Bacteria | 1495 |
| 98 | Ga0075363_100223986 | 3300006048 | Bacteria | 1078 |
| 99 | Ga0075363_100538491 | 3300006048 | Bacteria | 696 |
| 100 | Ga0075364_10058399 | 3300006051 | Bacteria | 2528 |
| 101 | Ga0075364_10200772 | 3300006051 | Bacteria | 1352 |
| 102 | Ga0075364_10261385 | 3300006051 | Bacteria | 1177 |
| 103 | Ga0075432_10024994 | 3300006058 | Bacteria | 2049 |
| 104 | Ga0075432_10045146 | 3300006058 | Bacteria | 1545 |
| 105 | Ga0075432_10105803 | 3300006058 | Bacteria | 1044 |
| 106 | Ga0075362_10011478 | 3300006177 | Bacteria | 3490 |
| 107 | Ga0075362_10292834 | 3300006177 | Bacteria | 807 |
| 108 | Ga0075367_10109254 | 3300006178 | Bacteria | 1696 |
| 109 | Ga0075367_10116927 | 3300006178 | Bacteria | 1641 |
| 110 | Ga0075367_10166135 | 3300006178 | Bacteria | 1373 |
| 111 | Ga0075367_10379787 | 3300006178 | Bacteria | 893 |
| 112 | Ga0075367_10426374 | 3300006178 | Bacteria | 840 |
| 113 | Ga0075369_10144447 | 3300006186 | Bacteria | 1086 |
| 114 | Ga0075369_10251330 | 3300006186 | Bacteria | 821 |
| 115 | Ga0075366_10028085 | 3300006195 | Bacteria | 3301 |
| 116 | Ga0075366_10032901 | 3300006195 | Bacteria | 3053 |
| 117 | Ga0075366_10058913 | 3300006195 | Bacteria | 2281 |
| 118 | Ga0075366_10424011 | 3300006195 | Bacteria | 820 |
| 119 | Ga0075366_10946485 | 3300006195 | Bacteria | 537 |
| 120 | Ga0097621_101628139 | 3300006237 | Bacteria | 614 |
| 121 | Ga0075370_10000601 | 3300006353 | Bacteria | 13893 |
| 122 | Ga0075370_10001258 | 3300006353 | Bacteria | 10790 |
| 123 | Ga0075370_10035161 | 3300006353 | Bacteria | 2811 |
| 124 | Ga0075370_10040493 | 3300006353 | Bacteria | 2628 |
| 125 | Ga0075370_10193653 | 3300006353 | Bacteria | 1198 |
| 126 | Ga0075370_10311726 | 3300006353 | Bacteria | 936 |
| 127 | Ga0075370_10322206 | 3300006353 | Bacteria | 921 |
| 128 | Ga0075370_10453762 | 3300006353 | Bacteria | 771 |
| 129 | Ga0068871_100243986 | 3300006358 | Bacteria | 1563 |
| 130 | Ga0068865_100745263 | 3300006881 | Bacteria | 841 |
| 131 | Ga0068865_100851652 | 3300006881 | Bacteria | 790 |
| 132 | Ga0099826_10000615 | 3300006948 | Bacteria | 18171 |
| 133 | Ga0099795_10152251 | 3300007788 | Bacteria | 948 |
| 134 | Ga0105244_10000502 | 3300009036 | Bacteria | 35162 |
| 135 | Ga0105244_10150938 | 3300009036 | Bacteria | 1113 |
| 136 | Ga0105244_10280259 | 3300009036 | Bacteria | 773 |
| 137 | Ga0105240_10088285 | 3300009093 | Bacteria | 3794 |
| 138 | Ga0105240_10362498 | 3300009093 | Bacteria | 1641 |
| 139 | Ga0105245_11294375 | 3300009098 | Bacteria | 778 |
| 140 | Ga0105247_10620496 | 3300009101 | Bacteria | 804 |
| 141 | Ga0105243_10000269 | 3300009148 | Bacteria | 58482 |
| 142 | Ga0105243_10056084 | 3300009148 | Bacteria | 3132 |
| 143 | Ga0105243_10176220 | 3300009148 | Bacteria | 1856 |
| 144 | Ga0105243_10280578 | 3300009148 | Bacteria | 1500 |
| 145 | Ga0105241_10602117 | 3300009174 | Bacteria | 993 |
| 146 | Ga0105237_10009449 | 3300009545 | Bacteria | 10443 |
| 147 | Ga0105237_10232810 | 3300009545 | Bacteria | 1843 |
| 148 | Ga0105238_10080569 | 3300009551 | Bacteria | 3245 |
| 149 | Ga0105238_10179554 | 3300009551 | Bacteria | 2094 |
| 150 | Ga0105238_10632251 | 3300009551 | Bacteria | 1080 |
| 151 | Ga0105249_10158929 | 3300009553 | Bacteria | 2182 |
| 152 | Ga0105239_10212322 | 3300010375 | Bacteria | 2170 |
| 153 | Ga0105239_10515135 | 3300010375 | Bacteria | 1361 |
| 154 | Ga0105239_12886804 | 3300010375 | Bacteria | 561 |
| 155 | Ga0105246_10035346 | 3300011119 | Bacteria | 3339 |
| 156 | Ga0105246_10138712 | 3300011119 | Bacteria | 1826 |
| 157 | Ga0105246_10282131 | 3300011119 | Bacteria | 1333 |
| 158 | Ga0157373_10028560 | 3300013100 | Bacteria | 4023 |
| 159 | Ga0157373_10059295 | 3300013100 | Bacteria | 2712 |
| 160 | Ga0157371_10109095 | 3300013102 | Bacteria | 1964 |
| 161 | Ga0157370_10005005 | 3300013104 | Bacteria | 14994 |
| 162 | Ga0157370_10287675 | 3300013104 | Bacteria | 1518 |
| 163 | Ga0157370_10355247 | 3300013104 | Bacteria | 1351 |
| 164 | Ga0157370_10457504 | 3300013104 | Bacteria | 1173 |
| 165 | Ga0157370_10636244 | 3300013104 | Bacteria | 975 |
| 166 | Ga0157369_10149859 | 3300013105 | Bacteria | 2465 |
| 167 | Ga0157369_11010979 | 3300013105 | Bacteria | 851 |
| 168 | Ga0157378_10901045 | 3300013297 | Bacteria | 915 |
| 169 | Ga0163162_11319215 | 3300013306 | Bacteria | 820 |
| 170 | Ga0157372_10062461 | 3300013307 | Bacteria | 4174 |
| 171 | Ga0157372_10487233 | 3300013307 | Bacteria | 1438 |
| 172 | Ga0157372_10732090 | 3300013307 | Bacteria | 1150 |
| 173 | Ga0182008_10002006 | 3300014497 | Bacteria | 13064 |
| 174 | Ga0182008_10017215 | 3300014497 | Bacteria | 3750 |
| 175 | Ga0157376_10141776 | 3300014969 | Bacteria | 2157 |
| 176 | Ga0182006_1001117 | 3300015261 | Bacteria | 17071 |
| 177 | Ga0182007_10000238 | 3300015262 | Bacteria | 37140 |
| 178 | Ga0182007_10116679 | 3300015262 | Bacteria | 891 |
| 179 | Ga0182005_1135616 | 3300015265 | Bacteria | 708 |
| 180 | Ga0163161_10000171 | 3300017792 | Bacteria | 59497 |
| 181 | Ga0163161_10002666 | 3300017792 | Bacteria | 12681 |
| 182 | Ga0163161_10023346 | 3300017792 | Bacteria | 4363 |
| 183 | Ga0163161_11048057 | 3300017792 | Bacteria | 698 |
| 184 | Ga0209436_103530 | 3300025208 | Bacteria | 4121 |
| 185 | Ga0209436_103818 | 3300025208 | Bacteria | 3876 |
| 186 | Ga0209672_101080 | 3300025228 | Bacteria | 11613 |
| 187 | Ga0209147_102032 | 3300025229 | Bacteria | 5810 |
| 188 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 189 | Ga0207425_1000266 | 3300025245 | Bacteria | 38532 |
| 190 | Ga0207425_1001945 | 3300025245 | Bacteria | 7777 |
| 191 | Ga0209677_117992 | 3300025253 | Bacteria | 870 |
| 192 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 193 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 194 | Ga0209129_1008166 | 3300025258 | Bacteria | 2962 |
| 195 | Ga0209129_1008309 | 3300025258 | Bacteria | 2909 |
| 196 | Ga0209565_1000115 | 3300025263 | Bacteria | 115272 |
| 197 | Ga0209565_1000228 | 3300025263 | Bacteria | 61687 |
| 198 | Ga0209565_1008439 | 3300025263 | Bacteria | 2692 |
| 199 | Ga0209565_1083729 | 3300025263 | Bacteria | 522 |
| 200 | Ga0209673_1000309 | 3300025273 | Bacteria | 90058 |
| 201 | Ga0209673_1000329 | 3300025273 | Bacteria | 87170 |
| 202 | Ga0209673_1001031 | 3300025273 | Bacteria | 32924 |
| 203 | Ga0209130_1000284 | 3300025284 | Bacteria | 62277 |
| 204 | Ga0209130_1000429 | 3300025284 | Bacteria | 45047 |
| 205 | Ga0209130_1001662 | 3300025284 | Bacteria | 13593 |
| 206 | Ga0209675_1000110 | 3300025291 | Bacteria | 115272 |
| 207 | Ga0209675_1000238 | 3300025291 | Bacteria | 54807 |
| 208 | Ga0209675_1000791 | 3300025291 | Bacteria | 20977 |
| 209 | Ga0209675_1041351 | 3300025291 | Bacteria | 1006 |
| 210 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 211 | Ga0209676_1000162 | 3300025292 | Bacteria | 159931 |
| 212 | Ga0209676_1000206 | 3300025292 | Bacteria | 132202 |
| 213 | Ga0209676_1000238 | 3300025292 | Bacteria | 117732 |
| 214 | Ga0209676_1003498 | 3300025292 | Bacteria | 9614 |
| 215 | Ga0209676_1022796 | 3300025292 | Bacteria | 2066 |
| 216 | Ga0209025_1000168 | 3300025294 | Bacteria | 162386 |
| 217 | Ga0209025_1000393 | 3300025294 | Bacteria | 90571 |
| 218 | Ga0209025_1002851 | 3300025294 | Bacteria | 17343 |
| 219 | Ga0209025_1003706 | 3300025294 | Bacteria | 14043 |
| 220 | Ga0209025_1015601 | 3300025294 | Bacteria | 4561 |
| 221 | Ga0209025_1178192 | 3300025294 | Bacteria | 549 |
| 222 | Ga0209564_1000222 | 3300025295 | Bacteria | 129405 |
| 223 | Ga0209564_1001526 | 3300025295 | Bacteria | 23009 |
| 224 | Ga0209758_1000134 | 3300025297 | Bacteria | 178294 |
| 225 | Ga0209758_1007869 | 3300025297 | Bacteria | 7090 |
| 226 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 227 | Ga0209050_1000512 | 3300025298 | Bacteria | 65551 |
| 228 | Ga0209050_1025843 | 3300025298 | Bacteria | 1983 |
| 229 | Ga0209256_1000060 | 3300025299 | Bacteria | 262342 |
| 230 | Ga0209256_1000472 | 3300025299 | Bacteria | 60473 |
| 231 | Ga0207426_1000095 | 3300025302 | Bacteria | 274234 |
| 232 | Ga0207426_1000100 | 3300025302 | Bacteria | 262342 |
| 233 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 234 | Ga0209051_1000274 | 3300025303 | Bacteria | 84662 |
| 235 | Ga0209051_1000311 | 3300025303 | Bacteria | 76050 |
| 236 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 237 | Ga0209257_1000286 | 3300025304 | Bacteria | 111738 |
| 238 | Ga0209257_1000432 | 3300025304 | Bacteria | 80643 |
| 239 | Ga0209257_1000696 | 3300025304 | Bacteria | 52123 |
| 240 | Ga0209257_1001946 | 3300025304 | Bacteria | 22293 |
| 241 | Ga0209257_1006446 | 3300025304 | Bacteria | 7556 |
| 242 | Ga0207656_10026291 | 3300025321 | Bacteria | 2372 |
| 243 | Ga0207655_1002609 | 3300025728 | Bacteria | 14322 |
| 244 | Ga0207642_10473313 | 3300025899 | Bacteria | 763 |
| 245 | Ga0207688_10162534 | 3300025901 | Bacteria | 1324 |
| 246 | Ga0207645_10215473 | 3300025907 | Bacteria | 1265 |
| 247 | Ga0207705_10046851 | 3300025909 | Bacteria | 3108 |
| 248 | Ga0207654_10585369 | 3300025911 | Bacteria | 795 |
| 249 | Ga0207707_10361381 | 3300025912 | Bacteria | 1250 |
| 250 | Ga0207695_10404860 | 3300025913 | Bacteria | 1249 |
| 251 | Ga0207671_10070892 | 3300025914 | Bacteria | 2599 |
| 252 | Ga0207660_10152883 | 3300025917 | Bacteria | 1775 |
| 253 | Ga0207657_10005075 | 3300025919 | Bacteria | 13810 |
| 254 | Ga0207657_11223442 | 3300025919 | Bacteria | 570 |
| 255 | Ga0207649_10247054 | 3300025920 | Bacteria | 1283 |
| 256 | Ga0207649_10269747 | 3300025920 | Bacteria | 1233 |
| 257 | Ga0207652_10471367 | 3300025921 | Bacteria | 1131 |
| 258 | Ga0207694_10217465 | 3300025924 | Bacteria | 1558 |
| 259 | Ga0207694_10972761 | 3300025924 | Bacteria | 718 |
| 260 | Ga0207690_10413709 | 3300025932 | Bacteria | 1077 |
| 261 | Ga0207690_10804073 | 3300025932 | Unclassified | 777 |
| 262 | Ga0207706_10052866 | 3300025933 | Bacteria | 3586 |
| 263 | Ga0207706_10356878 | 3300025933 | Bacteria | 1270 |
| 264 | Ga0207709_10002872 | 3300025935 | Bacteria | 10553 |
| 265 | Ga0207709_10018779 | 3300025935 | Bacteria | 3877 |
| 266 | Ga0207709_10074891 | 3300025935 | Bacteria | 2162 |
| 267 | Ga0207709_10145151 | 3300025935 | Bacteria | 1636 |
| 268 | Ga0207709_11026590 | 3300025935 | Bacteria | 675 |
| 269 | Ga0207709_11542699 | 3300025935 | Unclassified | 551 |
| 270 | Ga0207704_10976749 | 3300025938 | Bacteria | 715 |
| 271 | Ga0207704_11604895 | 3300025938 | Bacteria | 559 |
| 272 | Ga0207679_10049055 | 3300025945 | Bacteria | 3078 |
| 273 | Ga0207667_11907460 | 3300025949 | Unclassified | 556 |
| 274 | Ga0207712_10850762 | 3300025961 | Bacteria | 804 |
| 275 | Ga0207668_10730291 | 3300025972 | Bacteria | 872 |
| 276 | Ga0207668_12122405 | 3300025972 | Bacteria | 506 |
| 277 | Ga0207640_10485588 | 3300025981 | Bacteria | 1026 |
| 278 | Ga0207640_10595088 | 3300025981 | Bacteria | 935 |
| 279 | Ga0207640_10781193 | 3300025981 | Bacteria | 826 |
| 280 | Ga0207640_11773676 | 3300025981 | Bacteria | 558 |
| 281 | Ga0207658_10189876 | 3300025986 | Bacteria | 1707 |
| 282 | Ga0207639_10194065 | 3300026041 | Bacteria | 1736 |
| 283 | Ga0207639_10378987 | 3300026041 | Bacteria | 1270 |
| 284 | Ga0207639_10503950 | 3300026041 | Bacteria | 1106 |
| 285 | Ga0207639_10615840 | 3300026041 | Bacteria | 1002 |
| 286 | Ga0207678_11000360 | 3300026067 | Bacteria | 740 |
| 287 | Ga0207702_10305204 | 3300026078 | Bacteria | 1512 |
| 288 | Ga0207648_10175060 | 3300026089 | Bacteria | 1897 |
| 289 | Ga0207648_10265234 | 3300026089 | Bacteria | 1533 |
| 290 | Ga0207674_10041465 | 3300026116 | Bacteria | 4761 |
| 291 | Ga0207674_10279311 | 3300026116 | Bacteria | 1618 |
| 292 | Ga0207674_10630261 | 3300026116 | Bacteria | 1035 |
| 293 | Ga0207674_11207145 | 3300026116 | Bacteria | 726 |
| 294 | Ga0207675_100507656 | 3300026118 | Bacteria | 1201 |
| 295 | Ga0207698_10054948 | 3300026142 | Bacteria | 3066 |
| 296 | Ga0207698_10243769 | 3300026142 | Bacteria | 1640 |
| 297 | Ga0209282_1000241 | 3300027666 | Bacteria | 27542 |
| 298 | Ga0209974_10240608 | 3300027876 | Unclassified | 679 |
| 299 | Ga0207428_10669822 | 3300027907 | Bacteria | 744 |
| 300 | Ga0268265_10061483 | 3300028380 | Bacteria | 2882 |
| 301 | Ga0268265_10246282 | 3300028380 | Bacteria | 1580 |
| 302 | Ga0268264_10809332 | 3300028381 | Bacteria | 936 |
| 303 | Ga0307515_10308100 | 3300028794 | Bacteria | 1261 |
| 304 | Ga0265338_10206698 | 3300028800 | Bacteria | 1477 |
| 305 | Ga0265338_10473568 | 3300028800 | Bacteria | 884 |
| 306 | Ga0265332_10159502 | 3300031238 | Bacteria | 943 |
| 307 | Ga0265325_10002780 | 3300031241 | Bacteria | 11684 |
| 308 | Ga0265340_10095426 | 3300031247 | Bacteria | 1387 |
| 309 | Ga0265340_10167958 | 3300031247 | Bacteria | 994 |
| 310 | Ga0265339_10014407 | 3300031249 | Bacteria | 4765 |
| 311 | Ga0265327_10006939 | 3300031251 | Bacteria | 8901 |
| 312 | Ga0265327_10109760 | 3300031251 | Bacteria | 1320 |
| 313 | Ga0265316_10266511 | 3300031344 | Bacteria | 1255 |
| 314 | Ga0307513_10406383 | 3300031456 | Bacteria | 1095 |
| 315 | Ga0307408_100000111 | 3300031548 | Bacteria | 90575 |
| 316 | Ga0307408_100098212 | 3300031548 | Bacteria | 2225 |
| 317 | Ga0265313_10174052 | 3300031595 | Bacteria | 908 |
| 318 | Ga0307508_10724830 | 3300031616 | Bacteria | 605 |
| 319 | Ga0307514_10007518 | 3300031649 | Bacteria | 9389 |
| 320 | Ga0265314_10216242 | 3300031711 | Bacteria | 1122 |
| 321 | Ga0265342_10548298 | 3300031712 | Bacteria | 587 |
| 322 | Ga0307516_10027676 | 3300031730 | Bacteria | 5748 |
| 323 | Ga0307405_10282877 | 3300031731 | Bacteria | 1249 |
| 324 | Ga0307405_10917916 | 3300031731 | Bacteria | 742 |
| 325 | Ga0307405_11305168 | 3300031731 | Bacteria | 631 |
| 326 | Ga0307413_10268216 | 3300031824 | Bacteria | 1276 |
| 327 | Ga0307410_10227546 | 3300031852 | Bacteria | 1438 |
| 328 | Ga0307410_10302126 | 3300031852 | Bacteria | 1263 |
| 329 | Ga0307406_10000046 | 3300031901 | Bacteria | 69556 |
| 330 | Ga0307406_10105261 | 3300031901 | Bacteria | 1930 |
| 331 | Ga0307407_10034959 | 3300031903 | Bacteria | 2756 |
| 332 | Ga0307407_10101301 | 3300031903 | Bacteria | 1788 |
| 333 | Ga0307407_10764988 | 3300031903 | Bacteria | 732 |
| 334 | Ga0307412_10001515 | 3300031911 | Bacteria | 12884 |
| 335 | Ga0307412_10056317 | 3300031911 | Bacteria | 2619 |
| 336 | Ga0307412_10188608 | 3300031911 | Bacteria | 1557 |
| 337 | Ga0307412_10513116 | 3300031911 | Bacteria | 1000 |
| 338 | Ga0307409_101044993 | 3300031995 | Bacteria | 836 |
| 339 | Ga0307414_10037744 | 3300032004 | Bacteria | 3237 |
| 340 | Ga0307414_10067057 | 3300032004 | Bacteria | 2568 |
| 341 | Ga0307414_10225092 | 3300032004 | Bacteria | 1542 |
| 342 | Ga0307411_10018921 | 3300032005 | Bacteria | 3964 |
| 343 | Ga0307411_10031021 | 3300032005 | Bacteria | 3283 |
| 344 | Ga0307415_101766300 | 3300032126 | Bacteria | 598 |
| 345 | Ga0307510_10651308 | 3300033180 | Unclassified | 511 |
| 346 | Ga0373957_0107613 | 3300035120 | Bacteria | 1121 |
| 347 | Ga0373927_0013460 | 3300035695 | Bacteria | 5436 |
| 348 | Ga0373947_0028423 | 3300035725 | Bacteria | 3279 |
| 349 | Ga0395899_0533783 | 3300037312 | Bacteria | 756 |
| 350 | Ga0395900_0829048 | 3300037418 | Bacteria | 851 |
| 351 | Ga0395901_0048523 | 3300038443 | Bacteria | 4409 |
| 352 | Ga0436365_0305578 | 3300039437 | Bacteria | 559 |
| 353 | Ga0439466_0009501 | 3300041411 | Bacteria | 3633 |
| 354 | Ga0439465_0001088 | 3300041413 | Bacteria | 8701 |
| 355 | Ga0451841_0556179 | 3300041498 | Bacteria | 1015 |
| 356 | Ga0451853_1766864 | 3300041512 | Bacteria | 1478 |
| 357 | Ga0439431_0018070 | 3300041997 | Bacteria | 1665 |
| 358 | Ga0439442_005658 | 3300042002 | Bacteria | 2501 |
| 359 | Ga0450920_026301 | 3300042122 | Bacteria | 1135 |
| 360 | Ga0450923_000886 | 3300042125 | Bacteria | 3675 |
| 361 | Ga0450906_000564 | 3300042145 | Bacteria | 7832 |
| 362 | Ga0450910_052449 | 3300042147 | Bacteria | 676 |
| 363 | Ga0439446_0008417 | 3300042156 | Bacteria | 2738 |
| 364 | Ga0450908_083188 | 3300042184 | Bacteria | 576 |
| 365 | Ga0450908_084531 | 3300042184 | Bacteria | 571 |
| 366 | Ga0439434_0006121 | 3300042435 | Bacteria | 3508 |
| 367 | Ga0450918_024734 | 3300042531 | Bacteria | 1050 |
| 368 | Ga0451577_0596048 | 3300042876 | Unclassified | 1003 |
| 369 | Ga0451577_1989491 | 3300042876 | Bacteria | 508 |
| 370 | Ga0453684_0114072 | 3300044712 | Bacteria | 3277 |
| 371 | Ga0453684_0633627 | 3300044712 | Unclassified | 1168 |
| 372 | Ga0451576_0020692 | 3300045051 | Bacteria | 7160 |
| 373 | Ga0451576_0653259 | 3300045051 | Bacteria | 1105 |
| 374 | Ga0495627_003670 | 3300046453 | Bacteria | 6664 |
| 375 | Ga0495650_0028820 | 3300046471 | Bacteria | 2540 |
| 376 | Ga0495650_0118923 | 3300046471 | Bacteria | 974 |
| 377 | Ga0495610_0140803 | 3300046512 | Bacteria | 1038 |
| 378 | Ga0495620_0022543 | 3300046515 | Bacteria | 3030 |
| 379 | Ga0495631_0000468 | 3300046518 | Bacteria | 27243 |
| 380 | Ga0495637_0012963 | 3300046520 | Bacteria | 3972 |
| 381 | Ga0495637_0133008 | 3300046520 | Bacteria | 948 |
| 382 | Ga0495654_0001128 | 3300046530 | Bacteria | 19241 |
| 383 | Ga0495654_0066994 | 3300046530 | Bacteria | 1710 |
| 384 | Ga0495654_0087835 | 3300046530 | Bacteria | 1446 |
| 385 | Ga0495654_0163631 | 3300046530 | Bacteria | 975 |
| 386 | Ga0495586_0139164 | 3300046535 | Bacteria | 1362 |
| 387 | Ga0495621_0008758 | 3300046539 | Bacteria | 3045 |
| 388 | Ga0495597_0118478 | 3300046542 | Bacteria | 1105 |
| 389 | Ga0495622_0298980 | 3300046557 | Bacteria | 702 |
| 390 | Ga0495668_0058980 | 3300046616 | Bacteria | 2118 |
| 391 | Ga0495668_0070257 | 3300046616 | Bacteria | 1925 |
| 392 | Ga0495668_0248802 | 3300046616 | Bacteria | 973 |
| 393 | Ga0495625_0000057 | 3300046660 | Bacteria | 181623 |
| 394 | Ga0495625_0020334 | 3300046660 | Bacteria | 5127 |
| 395 | Ga0495625_0307429 | 3300046660 | Bacteria | 1013 |
| 396 | Ga0495635_0554672 | 3300046663 | Bacteria | 753 |
| 397 | Ga0495659_0152391 | 3300046664 | Bacteria | 929 |
| 398 | Ga0495588_0027837 | 3300046674 | Bacteria | 2826 |
| 399 | Ga0495588_0077355 | 3300046674 | Bacteria | 1735 |
| 400 | Ga0495588_0087450 | 3300046674 | Bacteria | 1630 |
| 401 | Ga0495657_0409579 | 3300046675 | Bacteria | 797 |
| 402 | Ga0495647_0451251 | 3300046681 | Bacteria | 595 |
| 403 | Ga0495658_0327178 | 3300046683 | Bacteria | 972 |
| 404 | Ga0495658_0391581 | 3300046683 | Bacteria | 885 |
| 405 | Ga0495670_0075240 | 3300046691 | Bacteria | 1714 |
| 406 | Ga0495670_0128233 | 3300046691 | Bacteria | 1321 |
| 407 | Ga0495671_0027188 | 3300046692 | Bacteria | 2956 |
| 408 | Ga0495660_0048944 | 3300046810 | Bacteria | 2310 |
| 409 | Ga0495676_0240763 | 3300047321 | Bacteria | 1239 |
| 410 | Ga0496100_0262177 | 3300048903 | Bacteria | 1282 |
| 411 | Ga0496100_1597943 | 3300048903 | Bacteria | 515 |
| 412 | Ga0496101_0016285 | 3300048904 | Bacteria | 5018 |
| 413 | Ga0496102_0295686 | 3300048905 | Bacteria | 1526 |
| 414 | Ga0496103_0311677 | 3300048906 | Bacteria | 1012 |
| 415 | Ga0496104_0655641 | 3300048907 | Bacteria | 958 |
| 416 | Ga0496105_0131644 | 3300048908 | Bacteria | 2062 |
| 417 | Ga0496107_0267176 | 3300048910 | Bacteria | 1273 |
| 418 | Ga0496108_0030102 | 3300048911 | Bacteria | 4499 |
| 419 | Ga0496109_0026336 | 3300048912 | Bacteria | 5186 |
| 420 | Ga0496109_0894028 | 3300048912 | Bacteria | 826 |
| 421 | Ga0496110_1491880 | 3300048913 | Bacteria | 586 |
| 422 | Ga0496116_0012920 | 3300048919 | Bacteria | 6778 |
| 423 | Ga0496116_0232557 | 3300048919 | Bacteria | 933 |
| 424 | Ga0496116_0263168 | 3300048919 | Bacteria | 849 |
| 425 | Ga0496117_0032396 | 3300048920 | Bacteria | 3971 |
| 426 | Ga0496117_0082322 | 3300048920 | Bacteria | 2108 |
| 427 | Ga0496117_0123556 | 3300048920 | Bacteria | 1585 |
| 428 | Ga0496117_0254563 | 3300048920 | Bacteria | 955 |
| 429 | Ga0496118_0014242 | 3300048921 | Bacteria | 7457 |
| 430 | Ga0496118_0036830 | 3300048921 | Bacteria | 3948 |
| 431 | Ga0496118_0259751 | 3300048921 | Bacteria | 981 |
| 432 | Ga0496119_0268023 | 3300048922 | Unclassified | 854 |
| 433 | Ga0496119_0398323 | 3300048922 | Bacteria | 657 |
| 434 | Ga0496121_0056163 | 3300048924 | Bacteria | 3272 |
| 435 | Ga0496121_0101316 | 3300048924 | Bacteria | 2221 |
| 436 | Ga0496121_0841438 | 3300048924 | Bacteria | 534 |
| 437 | Ga0496121_0841459 | 3300048924 | Bacteria | 534 |
| 438 | Ga0496122_0047474 | 3300048925 | Bacteria | 3315 |
| 439 | Ga0496122_0083887 | 3300048925 | Bacteria | 2207 |
| 440 | Ga0496122_0181293 | 3300048925 | Bacteria | 1255 |
| 441 | Ga0496122_0428536 | 3300048925 | Bacteria | 663 |
| 442 | Ga0496123_0070830 | 3300048926 | Bacteria | 2179 |
| 443 | Ga0496123_0113658 | 3300048926 | Bacteria | 1541 |
| 444 | Ga0496124_0024885 | 3300048927 | Bacteria | 5433 |
| 445 | Ga0496124_0199831 | 3300048927 | Bacteria | 1521 |
| 446 | Ga0496124_0304846 | 3300048927 | Bacteria | 1148 |
| 447 | Ga0496124_0321306 | 3300048927 | Bacteria | 1108 |
| 448 | Ga0496125_0061047 | 3300048928 | Bacteria | 3026 |
| 449 | Ga0496125_0095570 | 3300048928 | Bacteria | 2210 |
| 450 | Ga0496125_0131435 | 3300048928 | Bacteria | 1761 |
| 451 | Ga0496125_0331254 | 3300048928 | Bacteria | 918 |
| 452 | Ga0496125_0378398 | 3300048928 | Bacteria | 835 |
| 453 | Ga0496126_0066554 | 3300048929 | Bacteria | 3221 |
| 454 | Ga0496126_0471940 | 3300048929 | Bacteria | 1007 |
| 455 | Ga0495678_040121 | 3300049459 | Bacteria | 1884 |
| 456 | Ga0501031_0861108 | 3300049568 | Unclassified | 580 |
| 457 | Ga0501032_0045593 | 3300049569 | Bacteria | 2965 |
| 458 | Ga0501032_0061612 | 3300049569 | Bacteria | 2514 |
| 459 | Ga0501033_0035303 | 3300049570 | Bacteria | 3749 |
| 460 | Ga0501033_0128631 | 3300049570 | Bacteria | 1836 |
| 461 | Ga0501033_0585519 | 3300049570 | Bacteria | 766 |
| 462 | Ga0501034_0289993 | 3300049571 | Bacteria | 1575 |
| 463 | Ga0501034_0545287 | 3300049571 | Unclassified | 1069 |
| 464 | Ga0501036_0164281 | 3300049572 | Bacteria | 1871 |
| 465 | Ga0501036_1011246 | 3300049572 | Bacteria | 680 |
| 466 | Ga0501037_0049265 | 3300049573 | Unclassified | 3085 |
| 467 | Ga0501037_0260523 | 3300049573 | Bacteria | 1211 |
| 468 | Ga0501038_0157873 | 3300049574 | Unclassified | 1845 |
| 469 | Ga0501039_0035541 | 3300049575 | Bacteria | 3845 |
| 470 | Ga0501039_0154432 | 3300049575 | Bacteria | 1803 |
| 471 | Ga0501043_0167158 | 3300049579 | Bacteria | 1717 |
| 472 | Ga0501043_0201970 | 3300049579 | Unclassified | 1542 |
| 473 | Ga0501043_0360973 | 3300049579 | Bacteria | 1102 |
| 474 | Ga0501046_0044381 | 3300049580 | Bacteria | 3535 |
| 475 | Ga0501046_0121967 | 3300049580 | Bacteria | 1983 |
| 476 | Ga0501047_0067648 | 3300049581 | Bacteria | 3442 |
| 477 | Ga0501047_0119163 | 3300049581 | Bacteria | 2521 |
| 478 | Ga0501068_0046616 | 3300049584 | Bacteria | 2614 |
| 479 | Ga0501070_0442895 | 3300049586 | Bacteria | 1048 |
| 480 | Ga0501070_0548686 | 3300049586 | Bacteria | 925 |
| 481 | Ga0501071_0834618 | 3300049587 | Bacteria | 711 |
| 482 | Ga0501072_0182472 | 3300049588 | Bacteria | 1674 |
| 483 | Ga0501074_0170532 | 3300049590 | Bacteria | 1553 |
| 484 | Ga0501223_116986 | 3300049663 | Unclassified | 560 |
| 485 | Ga0501249_033051 | 3300049679 | Bacteria | 1158 |
| 486 | Ga0501079_0777182 | 3300049741 | Unclassified | 754 |
| 487 | Ga0501080_0081186 | 3300049742 | Bacteria | 3013 |
| 488 | Ga0501035_0035688 | 3300049822 | Bacteria | 4511 |
| 489 | Ga0501035_0153304 | 3300049822 | Bacteria | 1998 |
| 490 | Ga0501044_0281700 | 3300049823 | Bacteria | 1596 |
| 491 | Ga0501044_0380952 | 3300049823 | Bacteria | 1325 |
| 492 | nmdc:mga03683_10478_c1 | 3300050489 | Bacteria | 2192 |
| 493 | nmdc:mga03683_15295_c1 | 3300050489 | Bacteria | 2861 |
| 494 | nmdc:mga03683_191045_c1 | 3300050489 | Bacteria | 937 |
| 495 | nmdc:mga03n38_385179_c1 | 3300050490 | Bacteria | 769 |
| 496 | nmdc:mga03n38_39788_c1 | 3300050490 | Bacteria | 2040 |
| 497 | nmdc:mga03n38_6606_c1 | 3300050490 | Bacteria | 4044 |
| 498 | nmdc:mga00v17_14956_c1 | 3300050491 | Bacteria | 4346 |
| 499 | nmdc:mga00v17_200186_c1 | 3300050491 | Bacteria | 1291 |
| 500 | nmdc:mga00v17_227197_c1 | 3300050491 | Bacteria | 1209 |
| 501 | nmdc:mga00v17_74965_c1 | 3300050491 | Bacteria | 2103 |
| 502 | nmdc:mga00v17_928230_c1 | 3300050491 | Bacteria | 550 |
| 503 | nmdc:mga0k408_104471_c1 | 3300050493 | Bacteria | 1672 |
| 504 | nmdc:mga0k408_106381_c1 | 3300050493 | Bacteria | 1657 |
| 505 | nmdc:mga0k408_237729_c1 | 3300050493 | Bacteria | 1088 |
| 506 | nmdc:mga0k408_819797_c1 | 3300050493 | Bacteria | 542 |
| 507 | nmdc:mga06z11_583989_c1 | 3300050494 | Bacteria | 679 |
| 508 | nmdc:mga06z11_851166_c1 | 3300050494 | Bacteria | 556 |
| 509 | nmdc:mga07m45_135133_c1 | 3300050496 | Bacteria | 1427 |
| 510 | nmdc:mga07m45_20054_c1 | 3300050496 | Bacteria | 2733 |
| 511 | nmdc:mga07m45_270225_c1 | 3300050496 | Bacteria | 989 |
| 512 | nmdc:mga07m45_52852_c1 | 3300050496 | Bacteria | 2295 |
| 513 | nmdc:mga07m45_59_c1 | 3300050496 | Bacteria | 45010 |
| 514 | nmdc:mga07m45_710412_c1 | 3300050496 | Bacteria | 578 |
| 515 | nmdc:mga0sz30_223334_c1 | 3300050516 | Bacteria | 837 |
| 516 | nmdc:mga0sz30_284964_c1 | 3300050516 | Bacteria | 736 |
| 517 | nmdc:mga0sz30_374998_c1 | 3300050516 | Bacteria | 637 |
| 518 | Ga0500610_0000858 | 3300053079 | Bacteria | 9747 |
| 519 | Ga0495619_0842790 | 3300053085 | Bacteria | 619 |
| 520 | Ga0500566_0164658 | 3300053094 | Bacteria | 1152 |
| 521 | Ga0500641_0012007 | 3300053096 | Bacteria | 3156 |
| 522 | Ga0500560_083818 | 3300053107 | Bacteria | 1061 |
| 523 | Ga0500562_067886 | 3300053108 | Bacteria | 961 |
| 524 | Ga0500569_333096 | 3300053109 | Bacteria | 507 |
| 525 | Ga0500572_014686 | 3300053111 | Bacteria | 1962 |
| 526 | Ga0500593_000730 | 3300053117 | Bacteria | 12447 |
| 527 | Ga0500594_0043436 | 3300053118 | Bacteria | 1239 |
| 528 | Ga0500595_038315 | 3300053119 | Bacteria | 1559 |
| 529 | Ga0500607_002971 | 3300053121 | Bacteria | 12883 |
| 530 | Ga0500628_164546 | 3300053129 | Bacteria | 627 |
| 531 | Ga0500655_008189 | 3300053133 | Bacteria | 1881 |
| 532 | Ga0500658_0000175 | 3300053134 | Bacteria | 30638 |
| 533 | Ga0500658_0000714 | 3300053134 | Bacteria | 13735 |
| 534 | Ga0500559_0052329 | 3300053136 | Bacteria | 1804 |
| 535 | Ga0500559_0567983 | 3300053136 | Bacteria | 516 |
| 536 | Ga0500577_0261951 | 3300053142 | Bacteria | 752 |
| 537 | Ga0500616_0009338 | 3300053153 | Bacteria | 5973 |
| 538 | Ga0500627_0000917 | 3300053158 | Bacteria | 7930 |
| 539 | Ga0500633_0171482 | 3300053160 | Bacteria | 814 |
| 540 | Ga0500634_0021265 | 3300053161 | Bacteria | 3515 |
| 541 | Ga0500638_012949 | 3300053162 | Bacteria | 3755 |
| 542 | Ga0500611_055466 | 3300053727 | Bacteria | 922 |
| 543 | Ga0500625_104933 | 3300053729 | Bacteria | 1175 |
| 544 | Ga0500596_009087 | 3300053735 | Bacteria | 1562 |
| 545 | Ga0501084_0312234 | 3300054114 | Unclassified | 1328 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_100334375 | Ga0070661_1003343751 | 94 |
| 2 | 3300005548 | Ga0070665_101540327 | Ga0070665_1015403272 | 94 |
| 3 | 3300006881 | Ga0068865_100851652 | Ga0068865_1008516522 | 94 |
| 4 | 3300009098 | Ga0105245_11294375 | Ga0105245_112943752 | 94 |
| 5 | 3300009101 | Ga0105247_10620496 | Ga0105247_106204962 | 94 |
| 6 | 3300017792 | Ga0163161_11048057 | Ga0163161_110480572 | 94 |
| 7 | 3300025920 | Ga0207649_10269747 | Ga0207649_102697472 | 94 |
| 8 | 3300025938 | Ga0207704_10976749 | Ga0207704_109767492 | 94 |
| 9 | 3300025972 | Ga0207668_12122405 | Ga0207668_121224052 | 94 |
| 10 | 3300026067 | Ga0207678_11000360 | Ga0207678_110003602 | 94 |
| 11 | 3300046663 | Ga0495635_0554672 | Ga0495635_0554672_369_674 | 94 |
| 12 | 3300046675 | Ga0495657_0409579 | Ga0495657_0409579_110_415 | 94 |
| 13 | 3300048903 | Ga0496100_1597943 | Ga0496100_1597943_96_386 | 94 |
| 14 | 3300048907 | Ga0496104_0655641 | Ga0496104_0655641_348_638 | 94 |
| 15 | 3300048908 | Ga0496105_0131644 | Ga0496105_0131644_220_510 | 94 |
| 16 | 3300048911 | Ga0496108_0030102 | Ga0496108_0030102_28_318 | 94 |
| 17 | 3300048912 | Ga0496109_0026336 | Ga0496109_0026336_2054_2344 | 94 |
| 18 | 3300048912 | Ga0496109_0894028 | Ga0496109_0894028_273_563 | 94 |
| 19 | 3300048913 | Ga0496110_1491880 | Ga0496110_1491880_37_327 | 94 |
| 20 | 3300053085 | Ga0495619_0842790 | Ga0495619_0842790_61_366 | 94 |
| 21 | iso_pu_bacteria | 2547132374 | 2548497070 | 95 |
| 22 | iso_pu_bacteria | 2643221596 | 2643992027 | 95 |
| 23 | iso_pu_bacteria | 2643221717 | 2644645945 | 95 |
| 24 | iso_pu_bacteria | 2738541337 | 2739053553 | 95 |
| 25 | 3300028800 | Ga0265338_10206698 | Ga0265338_102066982 | 96 |
| 26 | 3300031251 | Ga0265327_10109760 | Ga0265327_101097602 | 96 |
| 27 | iso_pu_bacteria | 2643221639 | 2644220369 | 96 |
| 28 | iso_pu_bacteria | 2643221646 | 2644259295 | 96 |
| 29 | 3300005347 | Ga0070668_100159177 | Ga0070668_1001591772 | 97 |
| 30 | 3300005457 | Ga0070662_100248382 | Ga0070662_1002483822 | 97 |
| 31 | 3300005616 | Ga0068852_102506279 | Ga0068852_1025062791 | 97 |
| 32 | 3300005719 | Ga0068861_100639513 | Ga0068861_1006395132 | 97 |
| 33 | 3300005843 | Ga0068860_101017286 | Ga0068860_1010172862 | 97 |
| 34 | 3300005844 | Ga0068862_100055309 | Ga0068862_1000553092 | 97 |
| 35 | 3300009174 | Ga0105241_10602117 | Ga0105241_106021172 | 97 |
| 36 | 3300009551 | Ga0105238_10179554 | Ga0105238_101795544 | 97 |
| 37 | 3300010375 | Ga0105239_12886804 | Ga0105239_128868041 | 97 |
| 38 | 3300025304 | Ga0209257_1000696 | Ga0209257_100069635 | 97 |
| 39 | 3300025911 | Ga0207654_10585369 | Ga0207654_105853691 | 97 |
| 40 | 3300025924 | Ga0207694_10217465 | Ga0207694_102174652 | 97 |
| 41 | 3300025972 | Ga0207668_10730291 | Ga0207668_107302911 | 97 |
| 42 | 3300026118 | Ga0207675_100507656 | Ga0207675_1005076562 | 97 |
| 43 | 3300026142 | Ga0207698_10243769 | Ga0207698_102437691 | 97 |
| 44 | 3300028380 | Ga0268265_10246282 | Ga0268265_102462822 | 97 |
| 45 | 3300028800 | Ga0265338_10473568 | Ga0265338_104735682 | 97 |
| 46 | 3300031238 | Ga0265332_10159502 | Ga0265332_101595022 | 97 |
| 47 | 3300031241 | Ga0265325_10002780 | Ga0265325_1000278012 | 97 |
| 48 | 3300031247 | Ga0265340_10095426 | Ga0265340_100954262 | 97 |
| 49 | 3300031247 | Ga0265340_10167958 | Ga0265340_101679582 | 97 |
| 50 | 3300031249 | Ga0265339_10014407 | Ga0265339_100144072 | 97 |
| 51 | 3300031344 | Ga0265316_10266511 | Ga0265316_102665112 | 97 |
| 52 | 3300031595 | Ga0265313_10174052 | Ga0265313_101740522 | 97 |
| 53 | 3300031711 | Ga0265314_10216242 | Ga0265314_102162422 | 97 |
| 54 | 3300031712 | Ga0265342_10548298 | Ga0265342_105482981 | 97 |
| 55 | 3300046616 | Ga0495668_0058980 | Ga0495668_0058980_1473_1766 | 97 |
| 56 | 3300046660 | Ga0495625_0307429 | Ga0495625_0307429_290_583 | 97 |
| 57 | 3300053119 | Ga0500595_038315 | Ga0500595_038315_307_600 | 97 |
| 58 | 3300005459 | Ga0068867_100593773 | Ga0068867_1005937732 | 98 |
| 59 | 3300005518 | Ga0070699_100920523 | Ga0070699_1009205231 | 98 |
| 60 | 3300005578 | Ga0068854_101622413 | Ga0068854_1016224132 | 98 |
| 61 | 3300005718 | Ga0068866_10194237 | Ga0068866_101942372 | 98 |
| 62 | 3300005843 | Ga0068860_100811418 | Ga0068860_1008114182 | 98 |
| 63 | 3300006195 | Ga0075366_10058913 | Ga0075366_100589133 | 98 |
| 64 | 3300006353 | Ga0075370_10035161 | Ga0075370_100351613 | 98 |
| 65 | 3300009148 | Ga0105243_10056084 | Ga0105243_100560843 | 98 |
| 66 | 3300009553 | Ga0105249_10158929 | Ga0105249_101589292 | 98 |
| 67 | 3300025899 | Ga0207642_10473313 | Ga0207642_104733131 | 98 |
| 68 | 3300025935 | Ga0207709_10074891 | Ga0207709_100748913 | 98 |
| 69 | 3300025935 | Ga0207709_11542699 | Ga0207709_115426991 | 98 |
| 70 | 3300025961 | Ga0207712_10850762 | Ga0207712_108507622 | 98 |
| 71 | 3300025981 | Ga0207640_11773676 | Ga0207640_117736762 | 98 |
| 72 | 3300026089 | Ga0207648_10175060 | Ga0207648_101750602 | 98 |
| 73 | 3300028381 | Ga0268264_10809332 | Ga0268264_108093321 | 98 |
| 74 | 3300031730 | Ga0307516_10027676 | Ga0307516_100276765 | 98 |
| 75 | 3300033180 | Ga0307510_10651308 | Ga0307510_106513081 | 98 |
| 76 | 3300039437 | Ga0436365_0305578 | Ga0436365_0305578_77_373 | 98 |
| 77 | 3300042876 | Ga0451577_0596048 | Ga0451577_0596048_605_901 | 98 |
| 78 | 3300044712 | Ga0453684_0633627 | Ga0453684_0633627_825_1121 | 98 |
| 79 | 3300046471 | Ga0495650_0118923 | Ga0495650_0118923_635_931 | 98 |
| 80 | 3300046535 | Ga0495586_0139164 | Ga0495586_0139164_837_1133 | 98 |
| 81 | 3300050491 | nmdc:mga00v17_74965_c1 | nmdc:mga00v17_74965_c1_1291_1587 | 98 |
| 82 | 3300050493 | nmdc:mga0k408_819797_c1 | nmdc:mga0k408_819797_c1_157_453 | 98 |
| 83 | 3300003322 | rootL2_10039438 | rootL2_100394387 | 99 |
| 84 | 3300003323 | rootH1_10015317 | rootH1_100153174 | 99 |
| 85 | 3300005327 | Ga0070658_10743830 | Ga0070658_107438301 | 99 |
| 86 | 3300005339 | Ga0070660_100064567 | Ga0070660_1000645675 | 99 |
| 87 | 3300005366 | Ga0070659_100475671 | Ga0070659_1004756711 | 99 |
| 88 | 3300005437 | Ga0070710_10701219 | Ga0070710_107012192 | 99 |
| 89 | 3300005455 | Ga0070663_100195845 | Ga0070663_1001958452 | 99 |
| 90 | 3300005458 | Ga0070681_10134153 | Ga0070681_101341533 | 99 |
| 91 | 3300005539 | Ga0068853_101318746 | Ga0068853_1013187461 | 99 |
| 92 | 3300005563 | Ga0068855_100134771 | Ga0068855_1001347715 | 99 |
| 93 | 3300005618 | Ga0068864_101678027 | Ga0068864_1016780272 | 99 |
| 94 | 3300007788 | Ga0099795_10152251 | Ga0099795_101522511 | 99 |
| 95 | 3300013100 | Ga0157373_10028560 | Ga0157373_100285603 | 99 |
| 96 | 3300013104 | Ga0157370_10287675 | Ga0157370_102876753 | 99 |
| 97 | 3300013307 | Ga0157372_10062461 | Ga0157372_100624614 | 99 |
| 98 | 3300013307 | Ga0157372_10732090 | Ga0157372_107320901 | 99 |
| 99 | 3300025909 | Ga0207705_10046851 | Ga0207705_100468513 | 99 |
| 100 | 3300025912 | Ga0207707_10361381 | Ga0207707_103613811 | 99 |
| 101 | 3300025917 | Ga0207660_10152883 | Ga0207660_101528834 | 99 |
| 102 | 3300025919 | Ga0207657_10005075 | Ga0207657_1000507511 | 99 |
| 103 | 3300025921 | Ga0207652_10471367 | Ga0207652_104713673 | 99 |
| 104 | 3300025932 | Ga0207690_10804073 | Ga0207690_108040731 | 99 |
| 105 | 3300025949 | Ga0207667_11907460 | Ga0207667_119074602 | 99 |
| 106 | 3300025981 | Ga0207640_10485588 | Ga0207640_104855882 | 99 |
| 107 | 3300026041 | Ga0207639_10615840 | Ga0207639_106158403 | 99 |
| 108 | 3300026116 | Ga0207674_10279311 | Ga0207674_102793112 | 99 |
| 109 | 3300026116 | Ga0207674_11207145 | Ga0207674_112071452 | 99 |
| 110 | 3300027876 | Ga0209974_10240608 | Ga0209974_102406081 | 99 |
| 111 | 3300031251 | Ga0265327_10006939 | Ga0265327_100069393 | 99 |
| 112 | 3300031548 | Ga0307408_100000111 | Ga0307408_10000011149 | 99 |
| 113 | 3300031731 | Ga0307405_10282877 | Ga0307405_102828772 | 99 |
| 114 | 3300031731 | Ga0307405_11305168 | Ga0307405_113051682 | 99 |
| 115 | 3300031901 | Ga0307406_10000046 | Ga0307406_1000004638 | 99 |
| 116 | 3300032004 | Ga0307414_10225092 | Ga0307414_102250922 | 99 |
| 117 | 3300032126 | Ga0307415_101766300 | Ga0307415_1017663001 | 99 |
| 118 | 3300035695 | Ga0373927_0013460 | Ga0373927_0013460_2165_2464 | 99 |
| 119 | 3300035725 | Ga0373947_0028423 | Ga0373947_0028423_1560_1859 | 99 |
| 120 | 3300037312 | Ga0395899_0533783 | Ga0395899_0533783_71_370 | 99 |
| 121 | 3300037418 | Ga0395900_0829048 | Ga0395900_0829048_169_468 | 99 |
| 122 | 3300038443 | Ga0395901_0048523 | Ga0395901_0048523_3553_3852 | 99 |
| 123 | 3300042876 | Ga0451577_1989491 | Ga0451577_1989491_15_314 | 99 |
| 124 | 3300044712 | Ga0453684_0114072 | Ga0453684_0114072_2039_2362 | 99 |
| 125 | 3300045051 | Ga0451576_0653259 | Ga0451576_0653259_673_996 | 99 |
| 126 | 3300046530 | Ga0495654_0001128 | Ga0495654_0001128_8321_8626 | 99 |
| 127 | 3300046542 | Ga0495597_0118478 | Ga0495597_0118478_10_315 | 99 |
| 128 | 3300048922 | Ga0496119_0268023 | Ga0496119_0268023_453_752 | 99 |
| 129 | 3300048928 | Ga0496125_0131435 | Ga0496125_0131435_168_467 | 99 |
| 130 | 3300048929 | Ga0496126_0066554 | Ga0496126_0066554_1628_1927 | 99 |
| 131 | 3300049568 | Ga0501031_0861108 | Ga0501031_0861108_148_501 | 99 |
| 132 | 3300049569 | Ga0501032_0045593 | Ga0501032_0045593_2614_2913 | 99 |
| 133 | 3300049569 | Ga0501032_0061612 | Ga0501032_0061612_209_562 | 99 |
| 134 | 3300049570 | Ga0501033_0035303 | Ga0501033_0035303_1593_1892 | 99 |
| 135 | 3300049570 | Ga0501033_0128631 | Ga0501033_0128631_937_1236 | 99 |
| 136 | 3300049570 | Ga0501033_0585519 | Ga0501033_0585519_276_575 | 99 |
| 137 | 3300049571 | Ga0501034_0289993 | Ga0501034_0289993_1042_1341 | 99 |
| 138 | 3300049571 | Ga0501034_0545287 | Ga0501034_0545287_509_862 | 99 |
| 139 | 3300049572 | Ga0501036_0164281 | Ga0501036_0164281_169_522 | 99 |
| 140 | 3300049572 | Ga0501036_1011246 | Ga0501036_1011246_87_386 | 99 |
| 141 | 3300049573 | Ga0501037_0049265 | Ga0501037_0049265_11_364 | 99 |
| 142 | 3300049573 | Ga0501037_0260523 | Ga0501037_0260523_185_484 | 99 |
| 143 | 3300049574 | Ga0501038_0157873 | Ga0501038_0157873_81_434 | 99 |
| 144 | 3300049575 | Ga0501039_0035541 | Ga0501039_0035541_1684_2037 | 99 |
| 145 | 3300049575 | Ga0501039_0154432 | Ga0501039_0154432_613_912 | 99 |
| 146 | 3300049579 | Ga0501043_0167158 | Ga0501043_0167158_806_1105 | 99 |
| 147 | 3300049579 | Ga0501043_0201970 | Ga0501043_0201970_190_543 | 99 |
| 148 | 3300049579 | Ga0501043_0360973 | Ga0501043_0360973_108_407 | 99 |
| 149 | 3300049580 | Ga0501046_0044381 | Ga0501046_0044381_3102_3455 | 99 |
| 150 | 3300049580 | Ga0501046_0121967 | Ga0501046_0121967_1625_1924 | 99 |
| 151 | 3300049581 | Ga0501047_0067648 | Ga0501047_0067648_1143_1442 | 99 |
| 152 | 3300049581 | Ga0501047_0119163 | Ga0501047_0119163_1984_2337 | 99 |
| 153 | 3300049584 | Ga0501068_0046616 | Ga0501068_0046616_713_1066 | 99 |
| 154 | 3300049586 | Ga0501070_0442895 | Ga0501070_0442895_531_830 | 99 |
| 155 | 3300049586 | Ga0501070_0548686 | Ga0501070_0548686_416_769 | 99 |
| 156 | 3300049587 | Ga0501071_0834618 | Ga0501071_0834618_254_607 | 99 |
| 157 | 3300049588 | Ga0501072_0182472 | Ga0501072_0182472_515_868 | 99 |
| 158 | 3300049590 | Ga0501074_0170532 | Ga0501074_0170532_860_1213 | 99 |
| 159 | 3300049663 | Ga0501223_116986 | Ga0501223_116986_103_402 | 99 |
| 160 | 3300049679 | Ga0501249_033051 | Ga0501249_033051_447_746 | 99 |
| 161 | 3300049741 | Ga0501079_0777182 | Ga0501079_0777182_382_735 | 99 |
| 162 | 3300049742 | Ga0501080_0081186 | Ga0501080_0081186_20_334 | 99 |
| 163 | 3300049822 | Ga0501035_0035688 | Ga0501035_0035688_604_903 | 99 |
| 164 | 3300049822 | Ga0501035_0153304 | Ga0501035_0153304_509_862 | 99 |
| 165 | 3300049823 | Ga0501044_0281700 | Ga0501044_0281700_524_823 | 99 |
| 166 | 3300049823 | Ga0501044_0380952 | Ga0501044_0380952_503_856 | 99 |
| 167 | 3300053096 | Ga0500641_0012007 | Ga0500641_0012007_1238_1546 | 99 |
| 168 | 3300053727 | Ga0500611_055466 | Ga0500611_055466_171_470 | 99 |
| 169 | 3300054114 | Ga0501084_0312234 | Ga0501084_0312234_927_1280 | 99 |
| 170 | iso_pu_bacteria | 2643221628 | 2644160354 | 99 |
| 171 | iso_pu_bacteria | 2945909444 | 2945910756 | 99 |
| 172 | iso_pu_bacteria | 2945945610 | 2945946639 | 99 |
| 173 | iso_pu_bacteria | 2945984333 | 2945987071 | 99 |
| 174 | 3300003781 | Ga0055536_1003522 | Ga0055536_10035225 | 100 |
| 175 | 3300025292 | Ga0209676_1000238 | Ga0209676_10002385 | 100 |
| 176 | 3300025294 | Ga0209025_1178192 | Ga0209025_11781921 | 100 |
| 177 | 3300045051 | Ga0451576_0020692 | Ga0451576_0020692_1750_2094 | 100 |
| 178 | 3300048929 | Ga0496126_0471940 | Ga0496126_0471940_92_394 | 100 |
| 179 | iso_pu_bacteria | 2513020051 | 2513229418 | 101 |
| 180 | iso_pu_bacteria | 2599185214 | 2599622735 | 101 |
| 181 | iso_pu_bacteria | 2599185226 | 2599671214 | 101 |
| 182 | iso_pu_bacteria | 2599185227 | 2599679749 | 101 |
| 183 | iso_pu_bacteria | 2599185229 | 2599691765 | 101 |
| 184 | iso_pu_bacteria | 2643221658 | 2644324917 | 101 |
| 185 | iso_pu_bacteria | 2643221672 | 2644396786 | 101 |
| 186 | iso_pu_bacteria | 2738541277 | 2738718635 | 101 |
| 187 | iso_pu_bacteria | 2738541307 | 2738884759 | 101 |
| 188 | iso_pu_bacteria | 2738543019 | 2739280653 | 101 |
| 189 | iso_pu_bacteria | 2818991446 | 2819599929 | 101 |
| 190 | iso_pu_bacteria | 2831265667 | 2831267196 | 101 |
| 191 | iso_pu_bacteria | 2838054893 | 2838056286 | 101 |
| 192 | iso_pu_bacteria | 2885198086 | 2885204774 | 101 |
| 193 | iso_pu_bacteria | 2885211737 | 2885218539 | 101 |
| 194 | iso_pu_bacteria | 2899924645 | 2899926667 | 101 |
| 195 | iso_pu_bacteria | 2904541872 | 2904548699 | 101 |
| 196 | iso_pu_bacteria | 2928037797 | 2928044247 | 101 |
| 197 | iso_pu_bacteria | 2928044640 | 2928048379 | 101 |
| 198 | iso_pu_bacteria | 2928051484 | 2928052345 | 101 |
| 199 | iso_pu_bacteria | 2928064002 | 2928064985 | 101 |
| 200 | iso_pu_bacteria | 2928070936 | 2928074532 | 101 |
| 201 | iso_pu_bacteria | 2929160207 | 2929164635 | 101 |
| 202 | 3300003187 | JGI25151J46595_10071347 | JGI25151J46595_100713472 | 103 |
| 203 | 3300003773 | Ga0055537_1000050 | Ga0055537_100005064 | 103 |
| 204 | 3300003784 | Ga0055534_1000035 | Ga0055534_100003592 | 103 |
| 205 | 3300003790 | Ga0055528_1000757 | Ga0055528_100075714 | 103 |
| 206 | 3300005548 | Ga0070665_102441872 | Ga0070665_1024418721 | 103 |
| 207 | 3300006038 | Ga0075365_10018891 | Ga0075365_100188914 | 103 |
| 208 | 3300006048 | Ga0075363_100115336 | Ga0075363_1001153362 | 103 |
| 209 | 3300006048 | Ga0075363_100223986 | Ga0075363_1002239862 | 103 |
| 210 | 3300006051 | Ga0075364_10058399 | Ga0075364_100583994 | 103 |
| 211 | 3300006051 | Ga0075364_10200772 | Ga0075364_102007721 | 103 |
| 212 | 3300006051 | Ga0075364_10261385 | Ga0075364_102613852 | 103 |
| 213 | 3300006058 | Ga0075432_10024994 | Ga0075432_100249942 | 103 |
| 214 | 3300006058 | Ga0075432_10045146 | Ga0075432_100451462 | 103 |
| 215 | 3300006177 | Ga0075362_10011478 | Ga0075362_100114783 | 103 |
| 216 | 3300006177 | Ga0075362_10292834 | Ga0075362_102928342 | 103 |
| 217 | 3300006178 | Ga0075367_10116927 | Ga0075367_101169272 | 103 |
| 218 | 3300006178 | Ga0075367_10379787 | Ga0075367_103797872 | 103 |
| 219 | 3300006178 | Ga0075367_10426374 | Ga0075367_104263742 | 103 |
| 220 | 3300006186 | Ga0075369_10251330 | Ga0075369_102513301 | 103 |
| 221 | 3300006195 | Ga0075366_10028085 | Ga0075366_100280853 | 103 |
| 222 | 3300006195 | Ga0075366_10032901 | Ga0075366_100329014 | 103 |
| 223 | 3300006195 | Ga0075366_10424011 | Ga0075366_104240112 | 103 |
| 224 | 3300006353 | Ga0075370_10000601 | Ga0075370_1000060111 | 103 |
| 225 | 3300006353 | Ga0075370_10001258 | Ga0075370_100012589 | 103 |
| 226 | 3300006353 | Ga0075370_10311726 | Ga0075370_103117262 | 103 |
| 227 | 3300006353 | Ga0075370_10322206 | Ga0075370_103222062 | 103 |
| 228 | 3300006948 | Ga0099826_10000615 | Ga0099826_100006155 | 103 |
| 229 | 3300009148 | Ga0105243_10280578 | Ga0105243_102805782 | 103 |
| 230 | 3300011119 | Ga0105246_10035346 | Ga0105246_100353463 | 103 |
| 231 | 3300013104 | Ga0157370_10005005 | Ga0157370_100050052 | 103 |
| 232 | 3300014497 | Ga0182008_10017215 | Ga0182008_100172153 | 103 |
| 233 | 3300015262 | Ga0182007_10116679 | Ga0182007_101166791 | 103 |
| 234 | 3300017792 | Ga0163161_10000171 | Ga0163161_1000017128 | 103 |
| 235 | 3300017792 | Ga0163161_10002666 | Ga0163161_100026666 | 103 |
| 236 | 3300025258 | Ga0209129_1008166 | Ga0209129_10081662 | 103 |
| 237 | 3300025263 | Ga0209565_1000115 | Ga0209565_100011594 | 103 |
| 238 | 3300025273 | Ga0209673_1001031 | Ga0209673_100103125 | 103 |
| 239 | 3300025291 | Ga0209675_1000110 | Ga0209675_100011094 | 103 |
| 240 | 3300025294 | Ga0209025_1000168 | Ga0209025_10001682 | 103 |
| 241 | 3300025294 | Ga0209025_1003706 | Ga0209025_100370618 | 103 |
| 242 | 3300025901 | Ga0207688_10162534 | Ga0207688_101625342 | 103 |
| 243 | 3300025935 | Ga0207709_10145151 | Ga0207709_101451513 | 103 |
| 244 | 3300025935 | Ga0207709_11026590 | Ga0207709_110265902 | 103 |
| 245 | 3300026089 | Ga0207648_10265234 | Ga0207648_102652342 | 103 |
| 246 | 3300027666 | Ga0209282_1000241 | Ga0209282_10002418 | 103 |
| 247 | 3300027907 | Ga0207428_10669822 | Ga0207428_106698222 | 103 |
| 248 | 3300028380 | Ga0268265_10061483 | Ga0268265_100614832 | 103 |
| 249 | 3300028794 | Ga0307515_10308100 | Ga0307515_103081002 | 103 |
| 250 | 3300031456 | Ga0307513_10406383 | Ga0307513_104063832 | 103 |
| 251 | 3300031548 | Ga0307408_100098212 | Ga0307408_1000982122 | 103 |
| 252 | 3300031616 | Ga0307508_10724830 | Ga0307508_107248301 | 103 |
| 253 | 3300031649 | Ga0307514_10007518 | Ga0307514_100075184 | 103 |
| 254 | 3300031824 | Ga0307413_10268216 | Ga0307413_102682162 | 103 |
| 255 | 3300031852 | Ga0307410_10227546 | Ga0307410_102275462 | 103 |
| 256 | 3300031852 | Ga0307410_10302126 | Ga0307410_103021262 | 103 |
| 257 | 3300031901 | Ga0307406_10105261 | Ga0307406_101052612 | 103 |
| 258 | 3300031903 | Ga0307407_10034959 | Ga0307407_100349594 | 103 |
| 259 | 3300031903 | Ga0307407_10101301 | Ga0307407_101013012 | 103 |
| 260 | 3300031903 | Ga0307407_10764988 | Ga0307407_107649882 | 103 |
| 261 | 3300031911 | Ga0307412_10001515 | Ga0307412_1000151515 | 103 |
| 262 | 3300031911 | Ga0307412_10056317 | Ga0307412_100563172 | 103 |
| 263 | 3300031911 | Ga0307412_10188608 | Ga0307412_101886082 | 103 |
| 264 | 3300031911 | Ga0307412_10513116 | Ga0307412_105131162 | 103 |
| 265 | 3300031995 | Ga0307409_101044993 | Ga0307409_1010449932 | 103 |
| 266 | 3300032004 | Ga0307414_10037744 | Ga0307414_100377442 | 103 |
| 267 | 3300032004 | Ga0307414_10067057 | Ga0307414_100670574 | 103 |
| 268 | 3300032005 | Ga0307411_10018921 | Ga0307411_100189214 | 103 |
| 269 | 3300032005 | Ga0307411_10031021 | Ga0307411_100310212 | 103 |
| 270 | 3300041411 | Ga0439466_0009501 | Ga0439466_0009501_50_361 | 103 |
| 271 | 3300041413 | Ga0439465_0001088 | Ga0439465_0001088_8379_8690 | 103 |
| 272 | 3300041498 | Ga0451841_0556179 | Ga0451841_0556179_193_504 | 103 |
| 273 | 3300041512 | Ga0451853_1766864 | Ga0451853_1766864_652_963 | 103 |
| 274 | 3300041997 | Ga0439431_0018070 | Ga0439431_0018070_938_1249 | 103 |
| 275 | 3300042002 | Ga0439442_005658 | Ga0439442_005658_183_494 | 103 |
| 276 | 3300042122 | Ga0450920_026301 | Ga0450920_026301_653_964 | 103 |
| 277 | 3300042125 | Ga0450923_000886 | Ga0450923_000886_1811_2122 | 103 |
| 278 | 3300042145 | Ga0450906_000564 | Ga0450906_000564_447_758 | 103 |
| 279 | 3300042147 | Ga0450910_052449 | Ga0450910_052449_184_495 | 103 |
| 280 | 3300042156 | Ga0439446_0008417 | Ga0439446_0008417_2351_2662 | 103 |
| 281 | 3300042184 | Ga0450908_083188 | Ga0450908_083188_86_397 | 103 |
| 282 | 3300042184 | Ga0450908_084531 | Ga0450908_084531_210_521 | 103 |
| 283 | 3300042435 | Ga0439434_0006121 | Ga0439434_0006121_1825_2136 | 103 |
| 284 | 3300042531 | Ga0450918_024734 | Ga0450918_024734_188_499 | 103 |
| 285 | 3300046530 | Ga0495654_0163631 | Ga0495654_0163631_229_540 | 103 |
| 286 | 3300046660 | Ga0495625_0000057 | Ga0495625_0000057_33219_33530 | 103 |
| 287 | 3300046674 | Ga0495588_0077355 | Ga0495588_0077355_1100_1411 | 103 |
| 288 | 3300050489 | nmdc:mga03683_10478_c1 | nmdc:mga03683_10478_c1_1052_1363 | 103 |
| 289 | 3300050489 | nmdc:mga03683_15295_c1 | nmdc:mga03683_15295_c1_527_838 | 103 |
| 290 | 3300050489 | nmdc:mga03683_191045_c1 | nmdc:mga03683_191045_c1_333_644 | 103 |
| 291 | 3300050490 | nmdc:mga03n38_39788_c1 | nmdc:mga03n38_39788_c1_887_1198 | 103 |
| 292 | 3300050490 | nmdc:mga03n38_6606_c1 | nmdc:mga03n38_6606_c1_1175_1486 | 103 |
| 293 | 3300050491 | nmdc:mga00v17_14956_c1 | nmdc:mga00v17_14956_c1_428_739 | 103 |
| 294 | 3300050491 | nmdc:mga00v17_200186_c1 | nmdc:mga00v17_200186_c1_711_1022 | 103 |
| 295 | 3300050491 | nmdc:mga00v17_227197_c1 | nmdc:mga00v17_227197_c1_279_590 | 103 |
| 296 | 3300050493 | nmdc:mga0k408_104471_c1 | nmdc:mga0k408_104471_c1_657_968 | 103 |
| 297 | 3300050493 | nmdc:mga0k408_106381_c1 | nmdc:mga0k408_106381_c1_892_1203 | 103 |
| 298 | 3300050493 | nmdc:mga0k408_237729_c1 | nmdc:mga0k408_237729_c1_152_463 | 103 |
| 299 | 3300050494 | nmdc:mga06z11_851166_c1 | nmdc:mga06z11_851166_c1_136_447 | 103 |
| 300 | 3300050496 | nmdc:mga07m45_135133_c1 | nmdc:mga07m45_135133_c1_419_730 | 103 |
| 301 | 3300050496 | nmdc:mga07m45_20054_c1 | nmdc:mga07m45_20054_c1_1611_1922 | 103 |
| 302 | 3300050496 | nmdc:mga07m45_59_c1 | nmdc:mga07m45_59_c1_31280_31591 | 103 |
| 303 | 3300050516 | nmdc:mga0sz30_223334_c1 | nmdc:mga0sz30_223334_c1_468_779 | 103 |
| 304 | 3300050516 | nmdc:mga0sz30_374998_c1 | nmdc:mga0sz30_374998_c1_314_625 | 103 |
| 305 | 3300005353 | Ga0070669_100226168 | Ga0070669_1002261681 | 104 |
| 306 | 3300006178 | Ga0075367_10166135 | Ga0075367_101661351 | 104 |
| 307 | 3300006237 | Ga0097621_101628139 | Ga0097621_1016281392 | 104 |
| 308 | 3300035120 | Ga0373957_0107613 | Ga0373957_0107613_439_753 | 104 |
| 309 | 3300046471 | Ga0495650_0028820 | Ga0495650_0028820_98_418 | 104 |
| 310 | 3300046681 | Ga0495647_0451251 | Ga0495647_0451251_55_369 | 104 |
| 311 | 3300046683 | Ga0495658_0391581 | Ga0495658_0391581_533_847 | 104 |
| 312 | 3300001989 | JGI24739J22299_10046416 | JGI24739J22299_100464162 | 105 |
| 313 | 3300002739 | JGI25158J39367_1024790 | JGI25158J39367_10247901 | 105 |
| 314 | 3300002773 | JGI25152J39213_1006255 | JGI25152J39213_10062555 | 105 |
| 315 | 3300002773 | JGI25152J39213_1011969 | JGI25152J39213_10119691 | 105 |
| 316 | 3300002774 | JGI25150J39212_1002176 | JGI25150J39212_10021762 | 105 |
| 317 | 3300002774 | JGI25150J39212_1032152 | JGI25150J39212_10321521 | 105 |
| 318 | 3300002987 | JGI25159J45721_1007273 | JGI25159J45721_10072732 | 105 |
| 319 | 3300002987 | JGI25159J45721_1013477 | JGI25159J45721_10134771 | 105 |
| 320 | 3300003187 | JGI25151J46595_10020167 | JGI25151J46595_100201674 | 105 |
| 321 | 3300003187 | JGI25151J46595_10035621 | JGI25151J46595_100356211 | 105 |
| 322 | 3300003187 | JGI25151J46595_10065077 | JGI25151J46595_100650772 | 105 |
| 323 | 3300003215 | JGI25153J46596_10029393 | JGI25153J46596_100293931 | 105 |
| 324 | 3300003215 | JGI25153J46596_10053786 | JGI25153J46596_100537861 | 105 |
| 325 | 3300003316 | rootH1_10002678 | rootH1_100026782 | 105 |
| 326 | 3300003354 | JGI25160J50197_1021864 | JGI25160J50197_10218641 | 105 |
| 327 | 3300003354 | JGI25160J50197_1025982 | JGI25160J50197_10259821 | 105 |
| 328 | 3300003374 | JGI25161J50226_1010282 | JGI25161J50226_10102822 | 105 |
| 329 | 3300003374 | JGI25161J50226_1010317 | JGI25161J50226_10103172 | 105 |
| 330 | 3300003578 | Ga0006562J51391_1061291 | Ga0006562J51391_10612912 | 105 |
| 331 | 3300003758 | Ga0055532_1021318 | Ga0055532_10213182 | 105 |
| 332 | 3300003760 | Ga0055527_1018798 | Ga0055527_10187982 | 105 |
| 333 | 3300003761 | Ga0055535_1000383 | Ga0055535_10003836 | 105 |
| 334 | 3300003762 | Ga0055542_1000268 | Ga0055542_100026838 | 105 |
| 335 | 3300003771 | Ga0055526_1025345 | Ga0055526_10253451 | 105 |
| 336 | 3300003771 | Ga0055526_1025601 | Ga0055526_10256011 | 105 |
| 337 | 3300003773 | Ga0055537_1010866 | Ga0055537_10108661 | 105 |
| 338 | 3300003773 | Ga0055537_1018605 | Ga0055537_10186051 | 105 |
| 339 | 3300003775 | Ga0055524_1020580 | Ga0055524_10205803 | 105 |
| 340 | 3300003775 | Ga0055524_1024856 | Ga0055524_10248561 | 105 |
| 341 | 3300003781 | Ga0055536_1002335 | Ga0055536_10023356 | 105 |
| 342 | 3300003781 | Ga0055536_1008920 | Ga0055536_10089205 | 105 |
| 343 | 3300003781 | Ga0055536_1069484 | Ga0055536_10694842 | 105 |
| 344 | 3300003784 | Ga0055534_1006337 | Ga0055534_10063372 | 105 |
| 345 | 3300003784 | Ga0055534_1010801 | Ga0055534_10108011 | 105 |
| 346 | 3300003784 | Ga0055534_1048637 | Ga0055534_10486371 | 105 |
| 347 | 3300003790 | Ga0055528_1023383 | Ga0055528_10233831 | 105 |
| 348 | 3300003790 | Ga0055528_1038614 | Ga0055528_10386141 | 105 |
| 349 | 3300003791 | Ga0055530_10000937 | Ga0055530_100009372 | 105 |
| 350 | 3300003791 | Ga0055530_10003756 | Ga0055530_100037569 | 105 |
| 351 | 3300003792 | Ga0055540_1000291 | Ga0055540_10002912 | 105 |
| 352 | 3300003792 | Ga0055540_1000814 | Ga0055540_100081410 | 105 |
| 353 | 3300003792 | Ga0055540_1004996 | Ga0055540_10049965 | 105 |
| 354 | 3300003792 | Ga0055540_1029104 | Ga0055540_10291041 | 105 |
| 355 | 3300003794 | Ga0055531_10006028 | Ga0055531_100060282 | 105 |
| 356 | 3300003794 | Ga0055531_10006383 | Ga0055531_100063831 | 105 |
| 357 | 3300003794 | Ga0055531_10008545 | Ga0055531_100085457 | 105 |
| 358 | 3300004625 | Ga0055543_1011525 | Ga0055543_10115251 | 105 |
| 359 | 3300005262 | Ga0065165_1026007 | Ga0065165_10260071 | 105 |
| 360 | 3300005262 | Ga0065165_1028085 | Ga0065165_10280851 | 105 |
| 361 | 3300005262 | Ga0065165_1085570 | Ga0065165_10855702 | 105 |
| 362 | 3300005339 | Ga0070660_100637177 | Ga0070660_1006371771 | 105 |
| 363 | 3300005344 | Ga0070661_100270392 | Ga0070661_1002703922 | 105 |
| 364 | 3300005366 | Ga0070659_100591677 | Ga0070659_1005916772 | 105 |
| 365 | 3300005455 | Ga0070663_100610906 | Ga0070663_1006109062 | 105 |
| 366 | 3300005457 | Ga0070662_100036915 | Ga0070662_1000369152 | 105 |
| 367 | 3300005457 | Ga0070662_100871880 | Ga0070662_1008718802 | 105 |
| 368 | 3300005539 | Ga0068853_100009092 | Ga0068853_1000090922 | 105 |
| 369 | 3300005539 | Ga0068853_100214045 | Ga0068853_1002140452 | 105 |
| 370 | 3300005539 | Ga0068853_100598617 | Ga0068853_1005986172 | 105 |
| 371 | 3300005563 | Ga0068855_100029070 | Ga0068855_1000290702 | 105 |
| 372 | 3300005577 | Ga0068857_100624133 | Ga0068857_1006241331 | 105 |
| 373 | 3300005577 | Ga0068857_101146257 | Ga0068857_1011462572 | 105 |
| 374 | 3300005616 | Ga0068852_100552804 | Ga0068852_1005528042 | 105 |
| 375 | 3300005834 | Ga0068851_10043222 | Ga0068851_100432223 | 105 |
| 376 | 3300006048 | Ga0075363_100538491 | Ga0075363_1005384911 | 105 |
| 377 | 3300006058 | Ga0075432_10105803 | Ga0075432_101058032 | 105 |
| 378 | 3300006178 | Ga0075367_10109254 | Ga0075367_101092542 | 105 |
| 379 | 3300006186 | Ga0075369_10144447 | Ga0075369_101444472 | 105 |
| 380 | 3300006195 | Ga0075366_10946485 | Ga0075366_109464851 | 105 |
| 381 | 3300006353 | Ga0075370_10040493 | Ga0075370_100404932 | 105 |
| 382 | 3300006353 | Ga0075370_10193653 | Ga0075370_101936532 | 105 |
| 383 | 3300006353 | Ga0075370_10453762 | Ga0075370_104537622 | 105 |
| 384 | 3300006358 | Ga0068871_100243986 | Ga0068871_1002439862 | 105 |
| 385 | 3300006881 | Ga0068865_100745263 | Ga0068865_1007452632 | 105 |
| 386 | 3300009036 | Ga0105244_10000502 | Ga0105244_100005024 | 105 |
| 387 | 3300009036 | Ga0105244_10150938 | Ga0105244_101509382 | 105 |
| 388 | 3300009036 | Ga0105244_10280259 | Ga0105244_102802591 | 105 |
| 389 | 3300009093 | Ga0105240_10088285 | Ga0105240_100882855 | 105 |
| 390 | 3300009093 | Ga0105240_10362498 | Ga0105240_103624982 | 105 |
| 391 | 3300009148 | Ga0105243_10000269 | Ga0105243_100002692 | 105 |
| 392 | 3300009148 | Ga0105243_10176220 | Ga0105243_101762202 | 105 |
| 393 | 3300009545 | Ga0105237_10009449 | Ga0105237_1000944913 | 105 |
| 394 | 3300009545 | Ga0105237_10232810 | Ga0105237_102328102 | 105 |
| 395 | 3300009551 | Ga0105238_10080569 | Ga0105238_100805692 | 105 |
| 396 | 3300009551 | Ga0105238_10632251 | Ga0105238_106322512 | 105 |
| 397 | 3300010375 | Ga0105239_10212322 | Ga0105239_102123223 | 105 |
| 398 | 3300010375 | Ga0105239_10515135 | Ga0105239_105151352 | 105 |
| 399 | 3300011119 | Ga0105246_10138712 | Ga0105246_101387122 | 105 |
| 400 | 3300011119 | Ga0105246_10282131 | Ga0105246_102821312 | 105 |
| 401 | 3300013100 | Ga0157373_10059295 | Ga0157373_100592954 | 105 |
| 402 | 3300013102 | Ga0157371_10109095 | Ga0157371_101090951 | 105 |
| 403 | 3300013104 | Ga0157370_10355247 | Ga0157370_103552472 | 105 |
| 404 | 3300013104 | Ga0157370_10457504 | Ga0157370_104575042 | 105 |
| 405 | 3300013104 | Ga0157370_10636244 | Ga0157370_106362442 | 105 |
| 406 | 3300013105 | Ga0157369_10149859 | Ga0157369_101498592 | 105 |
| 407 | 3300013105 | Ga0157369_11010979 | Ga0157369_110109792 | 105 |
| 408 | 3300013297 | Ga0157378_10901045 | Ga0157378_109010452 | 105 |
| 409 | 3300013306 | Ga0163162_11319215 | Ga0163162_113192151 | 105 |
| 410 | 3300013307 | Ga0157372_10487233 | Ga0157372_104872332 | 105 |
| 411 | 3300014497 | Ga0182008_10002006 | Ga0182008_1000200614 | 105 |
| 412 | 3300014969 | Ga0157376_10141776 | Ga0157376_101417762 | 105 |
| 413 | 3300015261 | Ga0182006_1001117 | Ga0182006_100111712 | 105 |
| 414 | 3300015262 | Ga0182007_10000238 | Ga0182007_1000023826 | 105 |
| 415 | 3300015265 | Ga0182005_1135616 | Ga0182005_11356161 | 105 |
| 416 | 3300017792 | Ga0163161_10023346 | Ga0163161_100233464 | 105 |
| 417 | 3300025208 | Ga0209436_103530 | Ga0209436_1035303 | 105 |
| 418 | 3300025208 | Ga0209436_103818 | Ga0209436_1038183 | 105 |
| 419 | 3300025228 | Ga0209672_101080 | Ga0209672_1010807 | 105 |
| 420 | 3300025229 | Ga0209147_102032 | Ga0209147_1020321 | 105 |
| 421 | 3300025242 | Ga0209258_100009 | Ga0209258_100009203 | 105 |
| 422 | 3300025245 | Ga0207425_1000266 | Ga0207425_100026611 | 105 |
| 423 | 3300025245 | Ga0207425_1001945 | Ga0207425_10019454 | 105 |
| 424 | 3300025253 | Ga0209677_117992 | Ga0209677_1179921 | 105 |
| 425 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007203 | 105 |
| 426 | 3300025258 | Ga0209129_1000013 | Ga0209129_1000013443 | 105 |
| 427 | 3300025258 | Ga0209129_1008309 | Ga0209129_10083093 | 105 |
| 428 | 3300025263 | Ga0209565_1000228 | Ga0209565_100022839 | 105 |
| 429 | 3300025263 | Ga0209565_1008439 | Ga0209565_10084392 | 105 |
| 430 | 3300025263 | Ga0209565_1083729 | Ga0209565_10837291 | 105 |
| 431 | 3300025273 | Ga0209673_1000309 | Ga0209673_100030970 | 105 |
| 432 | 3300025273 | Ga0209673_1000329 | Ga0209673_100032975 | 105 |
| 433 | 3300025284 | Ga0209130_1000284 | Ga0209130_100028428 | 105 |
| 434 | 3300025284 | Ga0209130_1000429 | Ga0209130_100042919 | 105 |
| 435 | 3300025284 | Ga0209130_1001662 | Ga0209130_100166216 | 105 |
| 436 | 3300025291 | Ga0209675_1000238 | Ga0209675_100023851 | 105 |
| 437 | 3300025291 | Ga0209675_1000791 | Ga0209675_10007912 | 105 |
| 438 | 3300025291 | Ga0209675_1041351 | Ga0209675_10413512 | 105 |
| 439 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004302 | 105 |
| 440 | 3300025292 | Ga0209676_1000162 | Ga0209676_100016255 | 105 |
| 441 | 3300025292 | Ga0209676_1000206 | Ga0209676_100020622 | 105 |
| 442 | 3300025292 | Ga0209676_1003498 | Ga0209676_10034982 | 105 |
| 443 | 3300025292 | Ga0209676_1022796 | Ga0209676_10227964 | 105 |
| 444 | 3300025294 | Ga0209025_1000393 | Ga0209025_100039331 | 105 |
| 445 | 3300025294 | Ga0209025_1002851 | Ga0209025_10028512 | 105 |
| 446 | 3300025294 | Ga0209025_1015601 | Ga0209025_10156012 | 105 |
| 447 | 3300025295 | Ga0209564_1000222 | Ga0209564_1000222111 | 105 |
| 448 | 3300025295 | Ga0209564_1001526 | Ga0209564_10015263 | 105 |
| 449 | 3300025297 | Ga0209758_1000134 | Ga0209758_1000134153 | 105 |
| 450 | 3300025297 | Ga0209758_1007869 | Ga0209758_10078698 | 105 |
| 451 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002812 | 105 |
| 452 | 3300025298 | Ga0209050_1000512 | Ga0209050_100051247 | 105 |
| 453 | 3300025298 | Ga0209050_1025843 | Ga0209050_10258432 | 105 |
| 454 | 3300025299 | Ga0209256_1000060 | Ga0209256_1000060220 | 105 |
| 455 | 3300025299 | Ga0209256_1000472 | Ga0209256_100047245 | 105 |
| 456 | 3300025302 | Ga0207426_1000095 | Ga0207426_1000095152 | 105 |
| 457 | 3300025302 | Ga0207426_1000100 | Ga0207426_1000100220 | 105 |
| 458 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002580 | 105 |
| 459 | 3300025303 | Ga0209051_1000274 | Ga0209051_100027487 | 105 |
| 460 | 3300025303 | Ga0209051_1000311 | Ga0209051_100031130 | 105 |
| 461 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002721 | 105 |
| 462 | 3300025304 | Ga0209257_1000286 | Ga0209257_100028699 | 105 |
| 463 | 3300025304 | Ga0209257_1000432 | Ga0209257_100043266 | 105 |
| 464 | 3300025304 | Ga0209257_1001946 | Ga0209257_10019461 | 105 |
| 465 | 3300025304 | Ga0209257_1006446 | Ga0209257_10064462 | 105 |
| 466 | 3300025321 | Ga0207656_10026291 | Ga0207656_100262912 | 105 |
| 467 | 3300025728 | Ga0207655_1002609 | Ga0207655_100260912 | 105 |
| 468 | 3300025907 | Ga0207645_10215473 | Ga0207645_102154732 | 105 |
| 469 | 3300025913 | Ga0207695_10404860 | Ga0207695_104048602 | 105 |
| 470 | 3300025914 | Ga0207671_10070892 | Ga0207671_100708921 | 105 |
| 471 | 3300025919 | Ga0207657_11223442 | Ga0207657_112234422 | 105 |
| 472 | 3300025920 | Ga0207649_10247054 | Ga0207649_102470542 | 105 |
| 473 | 3300025924 | Ga0207694_10972761 | Ga0207694_109727612 | 105 |
| 474 | 3300025932 | Ga0207690_10413709 | Ga0207690_104137092 | 105 |
| 475 | 3300025933 | Ga0207706_10052866 | Ga0207706_100528664 | 105 |
| 476 | 3300025933 | Ga0207706_10356878 | Ga0207706_103568782 | 105 |
| 477 | 3300025935 | Ga0207709_10002872 | Ga0207709_100028722 | 105 |
| 478 | 3300025935 | Ga0207709_10018779 | Ga0207709_100187794 | 105 |
| 479 | 3300025938 | Ga0207704_11604895 | Ga0207704_116048952 | 105 |
| 480 | 3300025945 | Ga0207679_10049055 | Ga0207679_100490554 | 105 |
| 481 | 3300025981 | Ga0207640_10595088 | Ga0207640_105950881 | 105 |
| 482 | 3300025981 | Ga0207640_10781193 | Ga0207640_107811932 | 105 |
| 483 | 3300025986 | Ga0207658_10189876 | Ga0207658_101898762 | 105 |
| 484 | 3300026041 | Ga0207639_10194065 | Ga0207639_101940652 | 105 |
| 485 | 3300026041 | Ga0207639_10378987 | Ga0207639_103789872 | 105 |
| 486 | 3300026041 | Ga0207639_10503950 | Ga0207639_105039502 | 105 |
| 487 | 3300026078 | Ga0207702_10305204 | Ga0207702_103052042 | 105 |
| 488 | 3300026116 | Ga0207674_10041465 | Ga0207674_100414656 | 105 |
| 489 | 3300026116 | Ga0207674_10630261 | Ga0207674_106302611 | 105 |
| 490 | 3300026142 | Ga0207698_10054948 | Ga0207698_100549482 | 105 |
| 491 | 3300031731 | Ga0307405_10917916 | Ga0307405_109179162 | 105 |
| 492 | 3300046453 | Ga0495627_003670 | Ga0495627_003670_693_1010 | 105 |
| 493 | 3300046512 | Ga0495610_0140803 | Ga0495610_0140803_367_684 | 105 |
| 494 | 3300046515 | Ga0495620_0022543 | Ga0495620_0022543_776_1093 | 105 |
| 495 | 3300046518 | Ga0495631_0000468 | Ga0495631_0000468_25609_25926 | 105 |
| 496 | 3300046520 | Ga0495637_0012963 | Ga0495637_0012963_537_854 | 105 |
| 497 | 3300046520 | Ga0495637_0133008 | Ga0495637_0133008_283_600 | 105 |
| 498 | 3300046530 | Ga0495654_0066994 | Ga0495654_0066994_804_1121 | 105 |
| 499 | 3300046530 | Ga0495654_0087835 | Ga0495654_0087835_862_1179 | 105 |
| 500 | 3300046539 | Ga0495621_0008758 | Ga0495621_0008758_1595_1912 | 105 |
| 501 | 3300046557 | Ga0495622_0298980 | Ga0495622_0298980_189_506 | 105 |
| 502 | 3300046616 | Ga0495668_0070257 | Ga0495668_0070257_847_1164 | 105 |
| 503 | 3300046616 | Ga0495668_0248802 | Ga0495668_0248802_463_780 | 105 |
| 504 | 3300046660 | Ga0495625_0020334 | Ga0495625_0020334_4121_4438 | 105 |
| 505 | 3300046664 | Ga0495659_0152391 | Ga0495659_0152391_105_422 | 105 |
| 506 | 3300046674 | Ga0495588_0027837 | Ga0495588_0027837_1453_1770 | 105 |
| 507 | 3300046674 | Ga0495588_0087450 | Ga0495588_0087450_427_744 | 105 |
| 508 | 3300046683 | Ga0495658_0327178 | Ga0495658_0327178_218_535 | 105 |
| 509 | 3300046691 | Ga0495670_0075240 | Ga0495670_0075240_1001_1318 | 105 |
| 510 | 3300046691 | Ga0495670_0128233 | Ga0495670_0128233_414_731 | 105 |
| 511 | 3300046692 | Ga0495671_0027188 | Ga0495671_0027188_373_690 | 105 |
| 512 | 3300046810 | Ga0495660_0048944 | Ga0495660_0048944_926_1243 | 105 |
| 513 | 3300047321 | Ga0495676_0240763 | Ga0495676_0240763_230_547 | 105 |
| 514 | 3300048903 | Ga0496100_0262177 | Ga0496100_0262177_187_504 | 105 |
| 515 | 3300048904 | Ga0496101_0016285 | Ga0496101_0016285_2577_2894 | 105 |
| 516 | 3300048905 | Ga0496102_0295686 | Ga0496102_0295686_582_899 | 105 |
| 517 | 3300048906 | Ga0496103_0311677 | Ga0496103_0311677_486_803 | 105 |
| 518 | 3300048910 | Ga0496107_0267176 | Ga0496107_0267176_143_460 | 105 |
| 519 | 3300048919 | Ga0496116_0012920 | Ga0496116_0012920_5582_5899 | 105 |
| 520 | 3300048919 | Ga0496116_0232557 | Ga0496116_0232557_473_790 | 105 |
| 521 | 3300048919 | Ga0496116_0263168 | Ga0496116_0263168_292_609 | 105 |
| 522 | 3300048920 | Ga0496117_0032396 | Ga0496117_0032396_1028_1345 | 105 |
| 523 | 3300048920 | Ga0496117_0082322 | Ga0496117_0082322_1153_1470 | 105 |
| 524 | 3300048920 | Ga0496117_0123556 | Ga0496117_0123556_1049_1366 | 105 |
| 525 | 3300048920 | Ga0496117_0254563 | Ga0496117_0254563_208_525 | 105 |
| 526 | 3300048921 | Ga0496118_0014242 | Ga0496118_0014242_6072_6389 | 105 |
| 527 | 3300048921 | Ga0496118_0036830 | Ga0496118_0036830_351_668 | 105 |
| 528 | 3300048921 | Ga0496118_0259751 | Ga0496118_0259751_256_573 | 105 |
| 529 | 3300048922 | Ga0496119_0398323 | Ga0496119_0398323_65_382 | 105 |
| 530 | 3300048924 | Ga0496121_0056163 | Ga0496121_0056163_1075_1392 | 105 |
| 531 | 3300048924 | Ga0496121_0101316 | Ga0496121_0101316_513_830 | 105 |
| 532 | 3300048924 | Ga0496121_0841438 | Ga0496121_0841438_197_514 | 105 |
| 533 | 3300048924 | Ga0496121_0841459 | Ga0496121_0841459_197_514 | 105 |
| 534 | 3300048925 | Ga0496122_0047474 | Ga0496122_0047474_89_406 | 105 |
| 535 | 3300048925 | Ga0496122_0083887 | Ga0496122_0083887_267_584 | 105 |
| 536 | 3300048925 | Ga0496122_0181293 | Ga0496122_0181293_704_1021 | 105 |
| 537 | 3300048925 | Ga0496122_0428536 | Ga0496122_0428536_324_641 | 105 |
| 538 | 3300048926 | Ga0496123_0070830 | Ga0496123_0070830_543_860 | 105 |
| 539 | 3300048926 | Ga0496123_0113658 | Ga0496123_0113658_318_635 | 105 |
| 540 | 3300048927 | Ga0496124_0024885 | Ga0496124_0024885_144_461 | 105 |
| 541 | 3300048927 | Ga0496124_0199831 | Ga0496124_0199831_389_706 | 105 |
| 542 | 3300048927 | Ga0496124_0304846 | Ga0496124_0304846_103_420 | 105 |
| 543 | 3300048927 | Ga0496124_0321306 | Ga0496124_0321306_576_893 | 105 |
| 544 | 3300048928 | Ga0496125_0061047 | Ga0496125_0061047_2008_2325 | 105 |
| 545 | 3300048928 | Ga0496125_0095570 | Ga0496125_0095570_923_1240 | 105 |
| 546 | 3300048928 | Ga0496125_0331254 | Ga0496125_0331254_545_892 | 105 |
| 547 | 3300048928 | Ga0496125_0378398 | Ga0496125_0378398_142_459 | 105 |
| 548 | 3300049459 | Ga0495678_040121 | Ga0495678_040121_910_1227 | 105 |
| 549 | 3300050490 | nmdc:mga03n38_385179_c1 | nmdc:mga03n38_385179_c1_371_688 | 105 |
| 550 | 3300050491 | nmdc:mga00v17_928230_c1 | nmdc:mga00v17_928230_c1_85_402 | 105 |
| 551 | 3300050494 | nmdc:mga06z11_583989_c1 | nmdc:mga06z11_583989_c1_42_359 | 105 |
| 552 | 3300050496 | nmdc:mga07m45_270225_c1 | nmdc:mga07m45_270225_c1_220_537 | 105 |
| 553 | 3300050496 | nmdc:mga07m45_52852_c1 | nmdc:mga07m45_52852_c1_1087_1404 | 105 |
| 554 | 3300050496 | nmdc:mga07m45_710412_c1 | nmdc:mga07m45_710412_c1_26_343 | 105 |
| 555 | 3300050516 | nmdc:mga0sz30_284964_c1 | nmdc:mga0sz30_284964_c1_180_497 | 105 |
| 556 | 3300053079 | Ga0500610_0000858 | Ga0500610_0000858_422_739 | 105 |
| 557 | 3300053094 | Ga0500566_0164658 | Ga0500566_0164658_127_444 | 105 |
| 558 | 3300053107 | Ga0500560_083818 | Ga0500560_083818_523_840 | 105 |
| 559 | 3300053108 | Ga0500562_067886 | Ga0500562_067886_443_760 | 105 |
| 560 | 3300053109 | Ga0500569_333096 | Ga0500569_333096_176_493 | 105 |
| 561 | 3300053111 | Ga0500572_014686 | Ga0500572_014686_1056_1373 | 105 |
| 562 | 3300053117 | Ga0500593_000730 | Ga0500593_000730_3078_3395 | 105 |
| 563 | 3300053118 | Ga0500594_0043436 | Ga0500594_0043436_748_1065 | 105 |
| 564 | 3300053121 | Ga0500607_002971 | Ga0500607_002971_927_1244 | 105 |
| 565 | 3300053129 | Ga0500628_164546 | Ga0500628_164546_187_504 | 105 |
| 566 | 3300053133 | Ga0500655_008189 | Ga0500655_008189_185_502 | 105 |
| 567 | 3300053134 | Ga0500658_0000175 | Ga0500658_0000175_14865_15182 | 105 |
| 568 | 3300053134 | Ga0500658_0000714 | Ga0500658_0000714_13039_13356 | 105 |
| 569 | 3300053136 | Ga0500559_0052329 | Ga0500559_0052329_436_753 | 105 |
| 570 | 3300053136 | Ga0500559_0567983 | Ga0500559_0567983_179_496 | 105 |
| 571 | 3300053142 | Ga0500577_0261951 | Ga0500577_0261951_186_503 | 105 |
| 572 | 3300053153 | Ga0500616_0009338 | Ga0500616_0009338_531_848 | 105 |
| 573 | 3300053158 | Ga0500627_0000917 | Ga0500627_0000917_1488_1805 | 105 |
| 574 | 3300053160 | Ga0500633_0171482 | Ga0500633_0171482_161_478 | 105 |
| 575 | 3300053161 | Ga0500634_0021265 | Ga0500634_0021265_663_980 | 105 |
| 576 | 3300053162 | Ga0500638_012949 | Ga0500638_012949_2908_3225 | 105 |
| 577 | 3300053729 | Ga0500625_104933 | Ga0500625_104933_577_894 | 105 |
| 578 | 3300053735 | Ga0500596_009087 | Ga0500596_009087_543_860 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fb0-assembly1.cif.gz_A-2 | crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase | 0.9673 | 2 | 91 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9588 | 2 | 94 |
| 3mcs-assembly1.cif.gz_A | crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution | 0.9537 | 2 | 88 |
| 2omo-assembly2.cif.gz_C | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9499 | 2 | 93 |
| 2gff-assembly1.cif.gz_A | crystal structure of yersinia pestis lsrg | 0.9481 | 1 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BG18_205_343_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9584 | 2 | 91 | 3.30.70.100 |
| af_A3KQL1_329_418_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9538 | 4 | 93 | 3.30.70.100 |
| 3mcsA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9528 | 2 | 88 | 3.30.70.100 |
| af_Q96P71_296_384_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9493 | 3 | 89 | 3.30.70.100 |
| 4dpoB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9453 | 2 | 94 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7XWW2-F1-model_v4 | Uncharacterized protein | 0.9848 | 1 | 97 |
|
| AF-A0A2V8C7Q6-F1-model_v4 | ABM domain-containing protein | 0.9843 | 2 | 93 |
GO:0003824
|
| AF-A0A5B2YYZ4-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9766 | 2 | 91 |
GO:0004497
|
| AF-A0A2A6EBY6-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9764 | 2 | 91 |
GO:0004497
|
| AF-A0A3E0HX61-F1-model_v4 | Quinol monooxygenase YgiN | 0.976 | 2 | 91 |
GO:0004497
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar