F465636

General Info

Members Datasets Scaffolds Average Seq Length
577 407 452 326

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_15225|Ga0400484_15225_15130_16302
Length 390
Sequence MQISVTRSYTDTCLFSPILRRYVIYKAELYELETLSGAIYQFCNRVIGLVRWNQQYGTGSMKIRNQHVLVTGADGFIGSHLTEMLVLRGARVRALSYYNSFNSWGWLDDMDCRSEIEVVSGDIRDAFFCRSLTQDIDTIFHLAALIAIPYSYQAPQSYFETNVNGTLNICQAALDNDCQRFLQTSTSEVYGTARYVPIDEKHPLQAQSPYSASKIGADAVAMSFFHSFDLPLTVARPFNTFGPRQSARAVIPTIITQISNGRERIDLGDTRPTRDFTYVLDTCHALIALAESDQAVGEIVNIGSNHEISIHDLAKKIAGMMGRPITLNTTSERLRPKNSEVFRLWCDNTKYKRLTGKTMTYSFREALEQTVTWFTKTDHLNHYKAEIYNV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231018 Pseudomonas sp. GM60 Isolate Nodule
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
12 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
13 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
14 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
15 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
16 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
17 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
18 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
19 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
20 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
21 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
22 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
23 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
24 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
25 2718217882 Rhizobium sp. N741 Isolate Nodule
26 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
27 2718218009 Rhizobium sp. N561 Isolate Nodule
28 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
29 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
30 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
31 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
32 2718218363 Rhizobium sp. N113 Isolate Nodule
33 2718218365 Rhizobium sp. N731 Isolate Nodule
34 2718218366 Rhizobium sp. N621 Isolate Nodule
35 2721755514 Rhizobium sp. N6212 Isolate Nodule
36 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
37 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
38 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
39 2721755810 Rhizobium sp. N871 Isolate Nodule
40 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
41 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
42 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
43 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
44 2728369365 Rhizobium sp. N1341 Isolate Nodule
45 2728369397 Rhizobium sp. N1314 Isolate Nodule
46 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
47 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
48 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
49 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
50 2791355263 Rhizobium chutanense C5 Isolate Nodule
51 2791355264 Rhizobium sp. S9 Isolate Nodule
52 2791355266 Rhizobium sp. L43 Isolate Nodule
53 2791355267 Rhizobium sp. L18 Isolate Nodule
54 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
55 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
56 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
57 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
58 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
59 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
60 2838048938 Rhizobium pisi 27/80 Isolate Nodule
61 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
62 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
63 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
64 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
65 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
66 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
67 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
68 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
69 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
70 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
71 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
72 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
73 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
74 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
75 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
76 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
77 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
78 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
79 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
80 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
81 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
82 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
83 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
84 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
85 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
86 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
87 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
88 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
89 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
90 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
91 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
92 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
93 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
94 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
95 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
96 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
97 2933599457 Rhizobium phaseoli M3 Isolate Nodule
98 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
99 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
100 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
101 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
102 2936381700 Rhizobium chutanense C16 Isolate Unclassified
103 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
104 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
105 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
106 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
107 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
108 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
109 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
110 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
111 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
112 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
115 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
116 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
117 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
118 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
119 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
121 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
122 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
123 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
124 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
125 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
126 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
127 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
128 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
129 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
130 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
131 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
132 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
135 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
136 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
139 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
140 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
141 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
142 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
143 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
147 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
148 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
149 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
150 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
151 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
152 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
156 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
157 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
160 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
161 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
162 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
163 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
164 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
165 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
166 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
167 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
168 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
169 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
175 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
176 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
177 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
178 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
179 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
180 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
181 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
184 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
185 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
190 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
191 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
192 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
193 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
196 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
197 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
198 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
199 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
200 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
201 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
202 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
203 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
204 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
205 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
211 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
212 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
213 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
218 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
261 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
262 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
263 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
267 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
268 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
269 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
270 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
271 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
274 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
296 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
297 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
298 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
299 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
300 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
301 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
302 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
303 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
304 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
305 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
316 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
322 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
323 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
324 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
325 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
356 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
359 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
376 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
389 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
390 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
391 8005382845 Rhizobium sp. R634 Isolate Nodule
392 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
393 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
394 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
395 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
396 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
397 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
398 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
399 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
400 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
401 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
402 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
403 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
404 8024501048 Rhizobium sp. H4 Isolate Nodule
405 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
406 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
407 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.78
Metatranscriptomes 1.39
Isolates 21.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.53
Nodule 15.94
Rhizoplane 2.6
Rhizosphere 58.41
Stem 0
Stem Tuber 0
Unclassified 13.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1408983 2162886007 Bacteria 12900
2 SwRhRL2b_contig_1550039 2162886007 Bacteria 4271
3 JGI24736J21556_1001139 3300001904 Bacteria 4864
4 JGI24737J22298_10044463 3300001990 Bacteria 1358
5 JGI25154J39366_1000003 3300002738 Bacteria 397627
6 JGI25153J46596_10001948 3300003215 Bacteria 12241
7 rootH2_10019643 3300003320 Bacteria 21373
8 rootH2_10023205 3300003320 Bacteria 24803
9 rootH2_10063417 3300003320 Unclassified 1968
10 rootH2_10093703 3300003320 Unclassified 1561
11 rootH2_10116275 3300003320 Bacteria 5782
12 rootL2_10003685 3300003322 Bacteria 8388
13 rootL2_10025009 3300003322 Bacteria 11820
14 rootL2_10050278 3300003322 Bacteria 7807
15 rootL2_10181287 3300003322 Bacteria 1210
16 rootH1_10000940 3300003323 Bacteria 88997
17 rootH1_10003366 3300003316 Bacteria 5707
18 rootH1_10003366 3300003323 Bacteria 132108
19 rootH1_10004759 3300003323 Bacteria 40082
20 rootH1_10011718 3300003323 Bacteria 12705
21 rootH1_10142684 3300003323 Bacteria 3576
22 rootH1_10258632 3300003323 Bacteria 4900
23 rootH1_10302263 3300003323 Bacteria 2446
24 Ga0007417J51691_1042512 3300003544 Unclassified 3120
25 Ga0007410J51695_1039273 3300003574 Bacteria 2000
26 Ga0007409J51694_1026885 3300003575 Bacteria 9295
27 Ga0007416J51690_1025485 3300003577 Unclassified 4976
28 Ga0032354_1036793 3300003693 Bacteria 6633
29 Ga0055526_1005874 3300003771 Bacteria 6880
30 Ga0055528_1002535 3300003790 Bacteria 9708
31 Ga0055530_10000142 3300003791 Bacteria 64055
32 Ga0055540_1000111 3300003792 Bacteria 88263
33 Ga0055540_1003348 3300003792 Bacteria 7787
34 Ga0055531_10000013 3300003794 Bacteria 187583
35 Ga0055531_10002952 3300003794 Bacteria 11059
36 Ga0065165_1000016 3300005262 Bacteria 286248
37 Ga0065165_1002007 3300005262 Bacteria 19058
38 Ga0065714_10065553 3300005288 Bacteria 9443
39 Ga0065704_10070458 3300005289 Bacteria 23980
40 Ga0065704_10117396 3300005289 Bacteria 1834
41 Ga0065704_10119986 3300005289 Bacteria 1790
42 Ga0065707_10000594 3300005295 Bacteria 18091
43 Ga0065707_10082767 3300005295 Bacteria 12251
44 Ga0070690_100011372 3300005330 Bacteria 5203
45 Ga0070670_100010202 3300005331 Bacteria 8016
46 Ga0070670_100411379 3300005331 Bacteria 1195
47 Ga0068869_100210463 3300005334 Unclassified 1537
48 Ga0068868_100099292 3300005338 Bacteria 2355
49 Ga0070660_100254268 3300005339 Unclassified 1433
50 Ga0070668_100112717 3300005347 Bacteria 2166
51 Ga0070669_100069967 3300005353 Bacteria 2593
52 Ga0070688_100049673 3300005365 Bacteria 2611
53 Ga0070659_100297882 3300005366 Bacteria 1344
54 Ga0070709_10024123 3300005434 Bacteria 3578
55 Ga0070714_100000665 3300005435 Bacteria 24338
56 Ga0070711_100019444 3300005439 Bacteria 4357
57 Ga0070694_100001597 3300005444 Bacteria 13308
58 Ga0070708_100060325 3300005445 Bacteria 3385
59 Ga0070663_100344193 3300005455 Bacteria 1205
60 Ga0070662_100085977 3300005457 Bacteria 2351
61 Ga0070662_100097751 3300005457 Bacteria 2216
62 Ga0070681_10084075 3300005458 Bacteria 3135
63 Ga0068867_100112441 3300005459 Bacteria 2094
64 Ga0068867_100129979 3300005459 Bacteria 1956
65 Ga0070706_100007168 3300005467 Bacteria 10482
66 Ga0070706_100067854 3300005467 Bacteria 3298
67 Ga0070706_100241633 3300005467 Bacteria 1686
68 Ga0070707_100018733 3300005468 Bacteria 6517
69 Ga0070698_100008387 3300005471 Bacteria 11170
70 Ga0070698_100142868 3300005471 Bacteria 2344
71 Ga0070679_100056355 3300005530 Bacteria 3916
72 Ga0070684_100251227 3300005535 Unclassified 1616
73 Ga0070697_100039587 3300005536 Bacteria 3812
74 Ga0068853_100005105 3300005539 Bacteria 10253
75 Ga0070665_100223345 3300005548 Bacteria 1884
76 Ga0070704_100341280 3300005549 Bacteria 1261
77 Ga0068855_100004293 3300005563 Bacteria 17420
78 Ga0068855_100016263 3300005563 Bacteria 8948
79 Ga0068855_100243567 3300005563 Bacteria 2008
80 Ga0070664_100158575 3300005564 Unclassified 2001
81 Ga0068857_100040198 3300005577 Bacteria 4147
82 Ga0068857_100195057 3300005577 Bacteria 1845
83 Ga0068857_100207456 3300005577 Bacteria 1787
84 Ga0068856_100012328 3300005614 Bacteria 8278
85 Ga0070702_100053799 3300005615 Bacteria 2314
86 Ga0068852_100055331 3300005616 Bacteria 3424
87 Ga0068852_100374665 3300005616 Bacteria 1395
88 Ga0068859_100243541 3300005617 Bacteria 1888
89 Ga0068859_100310251 3300005617 Bacteria 1671
90 Ga0068859_100358051 3300005617 Bacteria 1554
91 Ga0068864_100045858 3300005618 Bacteria 3750
92 Ga0068861_100010685 3300005719 Bacteria 6377
93 Ga0068870_10104669 3300005840 Bacteria 1606
94 Ga0068860_100012399 3300005843 Bacteria 8398
95 Ga0068860_100401031 3300005843 Bacteria 1357
96 Ga0068862_100080863 3300005844 Bacteria 2818
97 Ga0070717_10166293 3300006028 Bacteria 1916
98 Ga0075363_100048783 3300006048 Bacteria 2253
99 Ga0075363_100057558 3300006048 Bacteria 2086
100 Ga0075362_10003869 3300006177 Bacteria 5317
101 Ga0075367_10045034 3300006178 Bacteria 2588
102 Ga0075369_10014358 3300006186 Bacteria 3163
103 Ga0075366_10000739 3300006195 Bacteria 15529
104 Ga0097621_100207943 3300006237 Bacteria 1701
105 Ga0075370_10002050 3300006353 Bacteria 9157
106 Ga0075430_100056701 3300006846 Bacteria 3295
107 Ga0075431_100000068 3300006847 Bacteria 60176
108 Ga0075433_10178831 3300006852 Bacteria 1887
109 Ga0075434_100025579 3300006871 Bacteria 5775
110 Ga0075429_100000282 3300006880 Bacteria 35849
111 Ga0075436_100004923 3300006914 Bacteria 9176
112 Ga0097620_100243546 3300006931 Bacteria 1888
113 Ga0097620_100310249 3300006931 Bacteria 1671
114 Ga0097620_100358035 3300006931 Bacteria 1554
115 Ga0075435_100057833 3300007076 Bacteria 3138
116 Ga0105251_10000751 3300009011 Bacteria 29613
117 Ga0105250_10000064 3300009092 Bacteria 100417
118 Ga0105240_10000198 3300009093 Bacteria 122388
119 Ga0105240_10001853 3300009093 Bacteria 35378
120 Ga0105240_10013476 3300009093 Archaea 11230
121 Ga0105240_10019201 3300009093 Bacteria 9137
122 Ga0111539_10001205 3300009094 Bacteria 34437
123 Ga0105245_10454641 3300009098 Bacteria 1290
124 Ga0114129_10174060 3300009147 Unclassified 2932
125 Ga0114129_10188127 3300009147 Unclassified 2805
126 Ga0105243_10148926 3300009148 Bacteria 2005
127 Ga0105241_10000137 3300009174 Bacteria 52153
128 Ga0105241_10005687 3300009174 Bacteria 9202
129 Ga0105248_10131991 3300009177 Bacteria 2818
130 Ga0105237_10000554 3300009545 Bacteria 52328
131 Ga0105237_10000781 3300009545 Bacteria 43601
132 Ga0105237_10003050 3300009545 Bacteria 20205
133 Ga0105237_10006169 3300009545 Bacteria 13388
134 Ga0105237_10029703 3300009545 Bacteria 5554
135 Ga0105238_10008871 3300009551 Bacteria 10061
136 Ga0105238_10017259 3300009551 Bacteria 7332
137 Ga0105238_10125683 3300009551 Unclassified 2543
138 Ga0123342_1003337 3300009766 Bacteria 25833
139 Ga0105239_10000298 3300010375 Bacteria 73328
140 Ga0105239_10001227 3300010375 Bacteria 34941
141 Ga0105239_10005875 3300010375 Bacteria 14303
142 Ga0105239_10008489 3300010375 Bacteria 11680
143 Ga0105239_10010597 3300010375 Bacteria 10308
144 Ga0105239_10022204 3300010375 Bacteria 6994
145 Ga0105239_10257443 3300010375 Unclassified 1961
146 Ga0105239_10763700 3300010375 Bacteria 1107
147 Ga0157371_10051531 3300013102 Bacteria 2924
148 Ga0157369_10000493 3300013105 Bacteria 52265
149 Ga0157378_10019196 3300013297 Bacteria 6008
150 Ga0157378_10032839 3300013297 Bacteria 4588
151 Ga0163162_10001192 3300013306 Bacteria 24279
152 Ga0163162_10122910 3300013306 Bacteria 2701
153 Ga0163162_10140552 3300013306 Bacteria 2528
154 Ga0163162_10228026 3300013306 Unclassified 1993
155 Ga0157372_10002326 3300013307 Bacteria 20596
156 Ga0157372_10029040 3300013307 Bacteria 6034
157 Ga0157372_10180082 3300013307 Bacteria 2446
158 Ga0157372_10181845 3300013307 Bacteria 2434
159 Ga0157372_10199309 3300013307 Bacteria 2319
160 Ga0157375_10098294 3300013308 Bacteria 3003
161 Ga0157375_10446015 3300013308 Unclassified 1460
162 Ga0163163_10000009 3300014325 Bacteria 268331
163 Ga0163163_10000095 3300014325 Bacteria 93905
164 Ga0163163_10362228 3300014325 Bacteria 1506
165 Ga0157380_10000932 3300014326 Bacteria 18464
166 Ga0157380_10410141 3300014326 Bacteria 1288
167 Ga0182008_10028908 3300014497 Unclassified 2802
168 Ga0157379_10243660 3300014968 Bacteria 1631
169 Ga0182007_10006173 3300015262 Bacteria 5171
170 Ga0163161_10000515 3300017792 Bacteria 31522
171 Ga0163161_10000642 3300017792 Bacteria 27902
172 Ga0206353_10285791 3300020082 Bacteria 1744
173 Ga0224572_1000121 3300024225 Bacteria 6320
174 Ga0209646_1000004 3300025246 Bacteria 786587
175 Ga0209026_1000192 3300025250 Bacteria 88221
176 Ga0209129_1004827 3300025258 Bacteria 5074
177 Ga0209673_1001115 3300025273 Bacteria 29920
178 Ga0209673_1015094 3300025273 Bacteria 2953
179 Ga0209673_1036211 3300025273 Bacteria 1468
180 Ga0209676_1008360 3300025292 Bacteria 4627
181 Ga0209564_1000008 3300025295 Bacteria 953227
182 Ga0209564_1003789 3300025295 Bacteria 9830
183 Ga0209758_1000912 3300025297 Bacteria 40017
184 Ga0209050_1000014 3300025298 Bacteria 774327
185 Ga0207426_1000930 3300025302 Bacteria 29211
186 Ga0207426_1044180 3300025302 Bacteria 1363
187 Ga0209051_1000084 3300025303 Bacteria 190324
188 Ga0209257_1000019 3300025304 Bacteria 774261
189 Ga0209257_1003695 3300025304 Bacteria 12730
190 Ga0209257_1009326 3300025304 Bacteria 5292
191 Ga0209257_1012045 3300025304 Bacteria 4062
192 Ga0207696_1000128 3300025711 Bacteria 134490
193 Ga0207713_1000769 3300025735 Bacteria 29621
194 Ga0207647_10000065 3300025904 Bacteria 82293
195 Ga0207654_10002083 3300025911 Bacteria 10241
196 Ga0207707_10136949 3300025912 Bacteria 2141
197 Ga0207695_10000346 3300025913 Bacteria 107028
198 Ga0207695_10002348 3300025913 Bacteria 28111
199 Ga0207695_10023054 3300025913 Bacteria 7047
200 Ga0207695_10071145 3300025913 Bacteria 3553
201 Ga0207695_10151886 3300025913 Bacteria 2254
202 Ga0207671_10002368 3300025914 Bacteria 20262
203 Ga0207671_10003677 3300025914 Bacteria 15118
204 Ga0207671_10009301 3300025914 Bacteria 8227
205 Ga0207671_10010854 3300025914 Bacteria 7473
206 Ga0207693_10047486 3300025915 Bacteria 3373
207 Ga0207663_10036021 3300025916 Bacteria 2974
208 Ga0207657_10189099 3300025919 Bacteria 1662
209 Ga0207657_10241527 3300025919 Unclassified 1442
210 Ga0207646_10386958 3300025922 Bacteria 1263
211 Ga0207694_10207634 3300025924 Bacteria 1595
212 Ga0207694_10210649 3300025924 Bacteria 1583
213 Ga0207650_10138238 3300025925 Bacteria 1913
214 Ga0207650_10282286 3300025925 Bacteria 1352
215 Ga0207687_10066427 3300025927 Bacteria 2563
216 Ga0207690_10239231 3300025932 Bacteria 1398
217 Ga0207706_10112139 3300025933 Bacteria 2399
218 Ga0207709_10084108 3300025935 Bacteria 2059
219 Ga0207670_10183404 3300025936 Unclassified 1578
220 Ga0207711_10021829 3300025941 Bacteria 5347
221 Ga0207689_10222602 3300025942 Unclassified 1559
222 Ga0207679_10254936 3300025945 Unclassified 1493
223 Ga0207667_10006247 3300025949 Bacteria 14458
224 Ga0207667_10008112 3300025949 Bacteria 12514
225 Ga0207667_10030722 3300025949 Bacteria 5806
226 Ga0207667_10535409 3300025949 Bacteria 1186
227 Ga0207651_10082783 3300025960 Bacteria 2318
228 Ga0207668_10166857 3300025972 Bacteria 1722
229 Ga0207677_10152781 3300026023 Bacteria 1783
230 Ga0207703_10118649 3300026035 Bacteria 2268
231 Ga0207678_10059159 3300026067 Bacteria 3297
232 Ga0207678_10181405 3300026067 Bacteria 1798
233 Ga0207708_10088217 3300026075 Bacteria 2389
234 Ga0207702_10240263 3300026078 Bacteria 1697
235 Ga0207702_10342472 3300026078 Bacteria 1428
236 Ga0207676_10362434 3300026095 Bacteria 1344
237 Ga0207674_10236565 3300026116 Unclassified 1774
238 Ga0207674_10256848 3300026116 Bacteria 1694
239 Ga0207675_100065045 3300026118 Bacteria 3408
240 Ga0207698_10040977 3300026142 Bacteria 3447
241 Ga0207698_10151254 3300026142 Bacteria 2015
242 Ga0209981_1013369 3300027378 Bacteria 1141
243 Ga0209971_1000773 3300027682 Bacteria 8249
244 Ga0209974_10000675 3300027876 Bacteria 11584
245 Ga0268265_10033098 3300028380 Bacteria 3755
246 Ga0268264_10015234 3300028381 Bacteria 6308
247 Ga0265334_10043455 3300028573 Bacteria 1748
248 Ga0265318_10029778 3300028577 Bacteria 2127
249 Ga0265323_10001069 3300028653 Bacteria 14189
250 Ga0307511_10000063 3300030521 Bacteria 91169
251 Ga0265330_10007211 3300031235 Bacteria 5441
252 Ga0265332_10018367 3300031238 Unclassified 3085
253 Ga0265332_10058574 3300031238 Bacteria 1648
254 Ga0265320_10016854 3300031240 Bacteria 4077
255 Ga0265329_10033235 3300031242 Bacteria 1668
256 Ga0265340_10002393 3300031247 Bacteria 10667
257 Ga0265339_10007250 3300031249 Bacteria 7184
258 Ga0265339_10122166 3300031249 Bacteria 1337
259 Ga0265331_10055712 3300031250 Bacteria 1879
260 Ga0265327_10001563 3300031251 Bacteria 28087
261 Ga0265327_10013020 3300031251 Bacteria 5558
262 Ga0265327_10025480 3300031251 Bacteria 3447
263 Ga0265327_10065614 3300031251 Unclassified 1835
264 Ga0265316_10011830 3300031344 Bacteria 7849
265 Ga0265316_10023131 3300031344 Bacteria 5225
266 Ga0265316_10105500 3300031344 Bacteria 2138
267 Ga0307408_100000040 3300031548 Bacteria 175456
268 Ga0307408_100000330 3300031548 Bacteria 45434
269 Ga0307408_100002008 3300031548 Bacteria 14692
270 Ga0307408_100006042 3300031548 Bacteria 8055
271 Ga0307408_100029022 3300031548 Bacteria 3829
272 Ga0307408_100136926 3300031548 Bacteria 1917
273 Ga0265313_10109343 3300031595 Bacteria 1217
274 Ga0265314_10002337 3300031711 Bacteria 19598
275 Ga0265314_10149096 3300031711 Bacteria 1436
276 Ga0265342_10000052 3300031712 Bacteria 123865
277 Ga0265342_10000541 3300031712 Bacteria 40244
278 Ga0265342_10079624 3300031712 Bacteria 1894
279 Ga0307516_10011905 3300031730 Bacteria 9413
280 Ga0307516_10072136 3300031730 Bacteria 3313
281 Ga0307405_10039298 3300031731 Bacteria 2859
282 Ga0307413_10002470 3300031824 Bacteria 7525
283 Ga0307410_10020191 3300031852 Bacteria 4070
284 Ga0307406_10009729 3300031901 Bacteria 5404
285 Ga0307407_10080821 3300031903 Bacteria 1965
286 Ga0307412_10015839 3300031911 Bacteria 4478
287 Ga0307412_10044372 3300031911 Bacteria 2900
288 Ga0307409_100002685 3300031995 Bacteria 9374
289 Ga0307414_10003386 3300032004 Bacteria 8516
290 Ga0307414_10053032 3300032004 Bacteria 2826
291 Ga0307415_100028512 3300032126 Bacteria 3554
292 Ga0307510_10017380 3300033180 Bacteria 8484
293 Ga0373961_0026900 3300035241 Bacteria 1575
294 Ga0395899_0000246 3300037312 Bacteria 72297
295 Ga0395899_0000613 3300037312 Bacteria 37148
296 Ga0395899_0000963 3300037312 Bacteria 26721
297 Ga0395900_0000435 3300037418 Bacteria 60001
298 Ga0395900_0000540 3300037418 Bacteria 52884
299 Ga0395900_0006688 3300037418 Bacteria 11978
300 Ga0395900_0014043 3300037418 Bacteria 8178
301 Ga0395898_0008561 3300037466 Bacteria 10799
302 Ga0395905_0001728 3300037471 Bacteria 25571
303 Ga0395905_0006231 3300037471 Bacteria 12043
304 Ga0395905_0007452 3300037471 Bacteria 10883
305 Ga0395905_0017913 3300037471 Bacteria 6728
306 Ga0395905_0284941 3300037471 Bacteria 1539
307 Ga0436364_0741378 3300037853 Bacteria 8356
308 Ga0395901_0000082 3300038443 Bacteria 130230
309 Ga0395901_0000599 3300038443 Bacteria 42012
310 Ga0395901_0003312 3300038443 Bacteria 16230
311 Ga0395901_0019273 3300038443 Bacteria 6974
312 Ga0400484_15225 3300038725 Bacteria 16987
313 Ga0400484_21715 3300038725 Bacteria 3434
314 Ga0400490_10479 3300038726 Bacteria 5319
315 Ga0400483_031157 3300039062 Bacteria 17255
316 Ga0400483_038110 3300039062 Bacteria 5683
317 Ga0400483_039039 3300039062 Bacteria 6435
318 Ga0400483_116214 3300039062 Bacteria 2569
319 Ga0400483_219096 3300039062 Bacteria 11561
320 Ga0400483_238768 3300039062 Bacteria 23085
321 Ga0400483_288870 3300039062 Unclassified 3376
322 Ga0436361_0540516 3300039447 Bacteria 8725
323 Ga0436362_1299585 3300039453 Bacteria 1057
324 Ga0451845_0408387 3300041501 Bacteria 3995
325 Ga0451847_0830035 3300041503 Bacteria 1761
326 Ga0451851_0572074 3300041507 Bacteria 5073
327 Ga0439451_000029 3300042009 Bacteria 31111
328 Ga0439463_006258 3300042016 Bacteria 2951
329 Ga0439463_008131 3300042016 Bacteria 2587
330 Ga0450906_000038 3300042145 Bacteria 21445
331 Ga0451577_0000852 3300042876 Bacteria 45450
332 Ga0451577_0010409 3300042876 Bacteria 8895
333 Ga0466972_0014473 3300044658 Bacteria 3951
334 Ga0453683_0028779 3300044673 Bacteria 3516
335 Ga0453683_0034084 3300044673 Unclassified 3210
336 Ga0453683_0074614 3300044673 Bacteria 2124
337 Ga0466965_0048475 3300044683 Bacteria 2105
338 Ga0466966_0001048 3300044684 Bacteria 17655
339 Ga0453684_0000264 3300044712 Bacteria 225672
340 Ga0453684_0002092 3300044712 Bacteria 50519
341 Ga0453684_0017978 3300044712 Bacteria 10891
342 Ga0453684_0058351 3300044712 Bacteria 4986
343 Ga0453684_0076625 3300044712 Bacteria 4197
344 Ga0453684_0105591 3300044712 Bacteria 3435
345 Ga0453684_0208240 3300044712 Bacteria 2275
346 Ga0453684_0250958 3300044712 Bacteria 2032
347 Ga0453684_0297881 3300044712 Bacteria 1834
348 Ga0466970_0015010 3300044765 Bacteria 3983
349 Ga0451576_0000229 3300045051 Bacteria 136407
350 Ga0451576_0000691 3300045051 Bacteria 68432
351 Ga0451576_0002540 3300045051 Bacteria 27010
352 Ga0451576_0014619 3300045051 Bacteria 8724
353 Ga0451576_0275292 3300045051 Unclassified 1760
354 Ga0466967_0485504 3300045976 Bacteria 1211
355 Ga0495590_0000338 3300046457 Bacteria 24377
356 Ga0495651_0084099 3300046462 Bacteria 2398
357 Ga0495584_0002958 3300046491 Bacteria 9450
358 Ga0495585_0015743 3300046492 Bacteria 4391
359 Ga0495585_0052827 3300046492 Bacteria 2249
360 Ga0495583_0000460 3300046506 Bacteria 60178
361 Ga0495606_0002199 3300046507 Bacteria 23384
362 Ga0495637_0000574 3300046520 Bacteria 26147
363 Ga0495644_0007634 3300046523 Bacteria 4170
364 Ga0495642_0000058 3300046528 Bacteria 66850
365 Ga0495654_0000711 3300046530 Bacteria 26011
366 Ga0495597_0000822 3300046542 Bacteria 24434
367 Ga0495625_0001324 3300046660 Bacteria 30795
368 Ga0495625_0003740 3300046660 Bacteria 14805
369 Ga0495661_0012810 3300046665 Bacteria 5656
370 Ga0495669_0002968 3300046684 Bacteria 6969
371 Ga0495649_0000913 3300046694 Bacteria 23330
372 Ga0495672_0105785 3300047320 Bacteria 1518
373 Ga0495686_0106462 3300047472 Bacteria 1686
374 Ga0495686_0118833 3300047472 Bacteria 1578
375 Ga0495626_0001439 3300048091 Bacteria 18932
376 Ga0496108_0184105 3300048911 Bacteria 1809
377 Ga0496110_0000755 3300048913 Bacteria 22400
378 Ga0496111_0043005 3300048914 Bacteria 3246
379 Ga0496114_0175790 3300048917 Bacteria 1868
380 Ga0496114_0356348 3300048917 Bacteria 1294
381 Ga0496115_0242130 3300048918 Bacteria 1486
382 Ga0496116_0019311 3300048919 Bacteria 5220
383 Ga0496116_0025121 3300048919 Bacteria 4387
384 Ga0496117_0001860 3300048920 Bacteria 28482
385 Ga0496118_0001427 3300048921 Bacteria 35987
386 Ga0496119_0021895 3300048922 Bacteria 4598
387 Ga0496120_0010214 3300048923 Bacteria 6573
388 Ga0496121_0002976 3300048924 Bacteria 24661
389 Ga0496121_0143333 3300048924 Unclassified 1769
390 Ga0496122_0000014 3300048925 Bacteria 491410
391 Ga0496122_0000021 3300048925 Bacteria 391363
392 Ga0496122_0002040 3300048925 Bacteria 29985
393 Ga0496122_0012631 3300048925 Bacteria 8376
394 Ga0496123_0000382 3300048926 Bacteria 83286
395 Ga0496123_0001660 3300048926 Bacteria 29864
396 Ga0496123_0003828 3300048926 Bacteria 16415
397 Ga0496123_0005958 3300048926 Bacteria 12004
398 Ga0496124_0007489 3300048927 Bacteria 11590
399 Ga0496124_0024142 3300048927 Bacteria 5534
400 Ga0496125_0004710 3300048928 Bacteria 15547
401 Ga0496126_0000019 3300048929 Bacteria 564723
402 Ga0496126_0002235 3300048929 Bacteria 26772
403 Ga0495678_006899 3300049459 Bacteria 5961
404 Ga0501034_0003487 3300049571 Bacteria 17879
405 Ga0501067_0057845 3300049583 Unclassified 2147
406 Ga0501073_0029754 3300049589 Bacteria 3903
407 Ga0501074_0021176 3300049590 Bacteria 4723
408 Ga0501074_0249001 3300049590 Bacteria 1264
409 Ga0501077_0011677 3300049593 Bacteria 5490
410 Ga0501236_002184 3300049670 Bacteria 2238
411 Ga0501247_001609 3300049677 Bacteria 2227
412 Ga0501079_0029981 3300049741 Bacteria 4179
413 Ga0501241_000132 3300049758 Bacteria 16459
414 Ga0501241_000308 3300049758 Bacteria 10678
415 Ga0501264_001786 3300049761 Bacteria 2158
416 Ga0501035_0003553 3300049822 Bacteria 14891
417 Ga0501044_0278789 3300049823 Bacteria 1606
418 nmdc:mga03683_21069_c1 3300050489 Bacteria 2508
419 nmdc:mga03n38_37782_c1 3300050490 Bacteria 2085
420 nmdc:mga0yw44_90771_c1 3300050492 Bacteria 1930
421 nmdc:mga0k408_1459_c1 3300050493 Bacteria 12755
422 nmdc:mga0k408_6251_c1 3300050493 Bacteria 6354
423 nmdc:mga0k408_68735_c1 3300050493 Bacteria 2067
424 nmdc:mga0k408_800_c1 3300050493 Bacteria 17312
425 nmdc:mga06z11_1646_c1 3300050494 Bacteria 8370
426 nmdc:mga06z11_68033_c1 3300050494 Bacteria 1876
427 nmdc:mga07m45_159105_c1 3300050496 Bacteria 1311
428 nmdc:mga07m45_36467_c1 3300050496 Bacteria 2739
429 nmdc:mga05p37_415639_c1 3300050507 Bacteria 1566
430 nmdc:mga05p37_475694_c1 3300050507 Bacteria 1440
431 nmdc:mga05p37_51760_c1 3300050507 Bacteria 5049
432 nmdc:mga09592_2771_c1 3300050508 Bacteria 14185
433 nmdc:mga0qj67_227704_c1 3300050509 Bacteria 1513
434 nmdc:mga06r32_2535_c1 3300050510 Bacteria 16339
435 nmdc:mga0rr50_477806_c1 3300050513 Bacteria 1058
436 nmdc:mga08x19_10432_c1 3300050514 Bacteria 5578
437 nmdc:mga0a205_93796_c1 3300050515 Bacteria 2900
438 nmdc:mga0sz30_97977_c1 3300050516 Bacteria 1279
439 Ga0500644_0000069 3300053088 Bacteria 61316
440 Ga0500646_0005200 3300053090 Bacteria 3295
441 Ga0500646_0005387 3300053090 Bacteria 3237
442 Ga0500646_0017932 3300053090 Bacteria 1861
443 Ga0500583_0058025 3300053092 Bacteria 1819
444 Ga0500658_0032181 3300053134 Bacteria 2056
445 Ga0500568_0010204 3300053139 Bacteria 4411
446 Ga0500604_0000448 3300053151 Bacteria 11347
447 Ga0500616_0030999 3300053153 Bacteria 2933
448 Ga0500622_0000199 3300053156 Bacteria 63518
449 Ga0501084_0021201 3300054114 Bacteria 5419
450 Ga0587082_000790 3300059504 Bacteria 2932
451 Ga0587088_010191 3300059508 Bacteria 1371
452 Ga0501082_0013318 3300060353 Bacteria 7071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0014473 Ga0466972_0014473_3005_3907 261
2 3300009093 Ga0105240_10001853 Ga0105240_100018537 273
3 3300009551 Ga0105238_10017259 Ga0105238_100172596 273
4 3300013105 Ga0157369_10000493 Ga0157369_1000049332 273
5 3300013307 Ga0157372_10002326 Ga0157372_100023266 273
6 3300035241 Ga0373961_0026900 Ga0373961_0026900_15_1091 278
7 3300005434 Ga0070709_10024123 Ga0070709_100241232 286
8 3300005439 Ga0070711_100019444 Ga0070711_1000194443 286
9 3300006028 Ga0070717_10166293 Ga0070717_101662931 286
10 3300025915 Ga0207693_10047486 Ga0207693_100474863 286
11 3300025916 Ga0207663_10036021 Ga0207663_100360212 286
12 3300005445 Ga0070708_100060325 Ga0070708_1000603253 294
13 3300039453 Ga0436362_1299585 Ga0436362_1299585_14_916 296
14 3300048918 Ga0496115_0242130 Ga0496115_0242130_26_943 299
15 3300003323 rootH1_10142684 rootH1_101426843 301
16 3300027682 Ga0209971_1000773 Ga0209971_10007737 302
17 3300027876 Ga0209974_10000675 Ga0209974_100006754 302
18 3300005331 Ga0070670_100411379 Ga0070670_1004113791 305
19 3300005347 Ga0070668_100112717 Ga0070668_1001127173 305
20 3300005353 Ga0070669_100069967 Ga0070669_1000699672 305
21 3300005617 Ga0068859_100358051 Ga0068859_1003580512 305
22 3300005719 Ga0068861_100010685 Ga0068861_1000106853 305
23 3300005843 Ga0068860_100012399 Ga0068860_1000123993 305
24 3300005844 Ga0068862_100080863 Ga0068862_1000808632 305
25 3300006931 Ga0097620_100358035 Ga0097620_1003580352 305
26 3300025925 Ga0207650_10282286 Ga0207650_102822861 305
27 3300025972 Ga0207668_10166857 Ga0207668_101668571 305
28 3300026118 Ga0207675_100065045 Ga0207675_1000650452 305
29 3300028380 Ga0268265_10033098 Ga0268265_100330982 305
30 3300028381 Ga0268264_10015234 Ga0268264_100152343 305
31 3300025936 Ga0207670_10183404 Ga0207670_101834041 306
32 3300005564 Ga0070664_100158575 Ga0070664_1001585751 308
33 3300025945 Ga0207679_10254936 Ga0207679_102549361 308
34 3300046684 Ga0495669_0002968 Ga0495669_0002968_5581_6573 309
35 3300005615 Ga0070702_100053799 Ga0070702_1000537992 311
36 3300005840 Ga0068870_10104669 Ga0068870_101046691 311
37 3300009098 Ga0105245_10454641 Ga0105245_104546412 311
38 3300013102 Ga0157371_10051531 Ga0157371_100515313 311
39 3300013307 Ga0157372_10180082 Ga0157372_101800822 311
40 3300014326 Ga0157380_10410141 Ga0157380_104101412 311
41 3300025927 Ga0207687_10066427 Ga0207687_100664271 311
42 3300026067 Ga0207678_10059159 Ga0207678_100591593 311
43 3300026075 Ga0207708_10088217 Ga0207708_100882172 311
44 3300026095 Ga0207676_10362434 Ga0207676_103624342 311
45 3300048925 Ga0496122_0000014 Ga0496122_0000014_433112_434092 311
46 3300048926 Ga0496123_0005958 Ga0496123_0005958_9111_10091 311
47 3300048929 Ga0496126_0000019 Ga0496126_0000019_433112_434092 311
48 3300049593 Ga0501077_0011677 Ga0501077_0011677_204_1154 311
49 3300005467 Ga0070706_100007168 Ga0070706_1000071688 312
50 3300005471 Ga0070698_100142868 Ga0070698_1001428681 312
51 3300031251 Ga0265327_10013020 Ga0265327_100130206 315
52 3300039062 Ga0400483_288870 Ga0400483_288870_1771_2766 316
53 3300009147 Ga0114129_10174060 Ga0114129_101740603 317
54 3300050507 nmdc:mga05p37_415639_c1 nmdc:mga05p37_415639_c1_70_1047 317
55 3300005444 Ga0070694_100001597 Ga0070694_10000159710 318
56 3300044765 Ga0466970_0015010 Ga0466970_0015010_1166_2161 318
57 3300005295 Ga0065707_10000594 Ga0065707_100005941 320
58 3300005330 Ga0070690_100011372 Ga0070690_1000113723 320
59 3300005435 Ga0070714_100000665 Ga0070714_10000066518 320
60 3300005536 Ga0070697_100039587 Ga0070697_1000395873 320
61 3300005549 Ga0070704_100341280 Ga0070704_1003412801 320
62 3300009094 Ga0111539_10001205 Ga0111539_1000120518 320
63 3300014497 Ga0182008_10028908 Ga0182008_100289082 320
64 3300015262 Ga0182007_10006173 Ga0182007_100061733 320
65 3300031730 Ga0307516_10072136 Ga0307516_100721362 320
66 3300045976 Ga0466967_0485504 Ga0466967_0485504_121_1107 320
67 iso_pu_bacteria 2936361878 2936365832 320
68 3300005459 Ga0068867_100129979 Ga0068867_1001299792 321
69 3300005617 Ga0068859_100243541 Ga0068859_1002435412 321
70 3300005618 Ga0068864_100045858 Ga0068864_1000458583 321
71 3300005843 Ga0068860_100401031 Ga0068860_1004010312 321
72 3300006931 Ga0097620_100243546 Ga0097620_1002435462 321
73 3300009545 Ga0105237_10000554 Ga0105237_1000055418 321
74 3300010375 Ga0105239_10763700 Ga0105239_107637001 321
75 3300025914 Ga0207671_10009301 Ga0207671_100093014 321
76 3300026035 Ga0207703_10118649 Ga0207703_101186492 321
77 3300031235 Ga0265330_10007211 Ga0265330_100072115 321
78 3300031238 Ga0265332_10018367 Ga0265332_100183673 321
79 3300031249 Ga0265339_10007250 Ga0265339_100072502 321
80 3300031344 Ga0265316_10023131 Ga0265316_100231312 321
81 3300031712 Ga0265342_10000052 Ga0265342_10000052100 321
82 3300048919 Ga0496116_0025121 Ga0496116_0025121_3024_4004 321
83 3300049590 Ga0501074_0249001 Ga0501074_0249001_135_1115 321
84 3300049741 Ga0501079_0029981 Ga0501079_0029981_1462_2442 321
85 3300054114 Ga0501084_0021201 Ga0501084_0021201_1292_2272 321
86 3300060353 Ga0501082_0013318 Ga0501082_0013318_4539_5519 321
87 iso_pu_bacteria 2600255286 2601640433 321
88 iso_pu_bacteria 2808606376 2808923653 321
89 iso_pu_bacteria 2808606380 2808945583 321
90 iso_pu_bacteria 8007371054 8007372807 321
91 iso_pu_bacteria 8007375930 8007378590 321
92 3300003323 rootH1_10011718 rootH1_100117189 322
93 3300005331 Ga0070670_100010202 Ga0070670_1000102022 322
94 3300005530 Ga0070679_100056355 Ga0070679_1000563553 322
95 3300005539 Ga0068853_100005105 Ga0068853_1000051059 322
96 3300005577 Ga0068857_100040198 Ga0068857_1000401982 322
97 3300006847 Ga0075431_100000068 Ga0075431_10000006839 322
98 3300006852 Ga0075433_10178831 Ga0075433_101788312 322
99 3300006871 Ga0075434_100025579 Ga0075434_1000255796 322
100 3300009147 Ga0114129_10188127 Ga0114129_101881273 322
101 3300020082 Ga0206353_10285791 Ga0206353_102857912 322
102 3300025919 Ga0207657_10189099 Ga0207657_101890992 322
103 3300025922 Ga0207646_10386958 Ga0207646_103869582 322
104 3300025925 Ga0207650_10138238 Ga0207650_101382382 322
105 3300025949 Ga0207667_10030722 Ga0207667_100307222 322
106 3300025960 Ga0207651_10082783 Ga0207651_100827832 322
107 3300026142 Ga0207698_10151254 Ga0207698_101512542 322
108 3300027378 Ga0209981_1013369 Ga0209981_10133691 322
109 3300031548 Ga0307408_100136926 Ga0307408_1001369263 322
110 3300031731 Ga0307405_10039298 Ga0307405_100392982 322
111 3300031824 Ga0307413_10002470 Ga0307413_100024702 322
112 3300031852 Ga0307410_10020191 Ga0307410_100201914 322
113 3300031901 Ga0307406_10009729 Ga0307406_100097295 322
114 3300031903 Ga0307407_10080821 Ga0307407_100808213 322
115 3300031911 Ga0307412_10015839 Ga0307412_100158394 322
116 3300031995 Ga0307409_100002685 Ga0307409_1000026853 322
117 3300032126 Ga0307415_100028512 Ga0307415_1000285124 322
118 3300049589 Ga0501073_0029754 Ga0501073_0029754_494_1483 322
119 3300049590 Ga0501074_0021176 Ga0501074_0021176_3492_4481 322
120 3300050507 nmdc:mga05p37_51760_c1 nmdc:mga05p37_51760_c1_2634_3626 322
121 3300050510 nmdc:mga06r32_2535_c1 nmdc:mga06r32_2535_c1_6978_7970 322
122 3300050515 nmdc:mga0a205_93796_c1 nmdc:mga0a205_93796_c1_206_1183 322
123 iso_pu_bacteria 2509276021 2509388385 322
124 iso_pu_bacteria 2510065019 2510131446 322
125 iso_pu_bacteria 2510461076 2510897799 322
126 iso_pu_bacteria 2511231018 2511339359 322
127 iso_pu_bacteria 2513237084 2513570666 322
128 iso_pu_bacteria 2513237093 2513632180 322
129 iso_pu_bacteria 2513237103 2513713337 322
130 iso_pu_bacteria 2513237162 2514021027 322
131 iso_pu_bacteria 2515075009 2515110407 322
132 iso_pu_bacteria 2515154114 2515642864 322
133 iso_pu_bacteria 2515154116 2515659614 322
134 iso_pu_bacteria 2516653077 2517039096 322
135 iso_pu_bacteria 2585427633 2585992882 322
136 iso_pu_bacteria 2599185289 2599887576 322
137 iso_pu_bacteria 2599185291 2599899945 322
138 iso_pu_bacteria 2599185302 2599941845 322
139 iso_pu_bacteria 2599185304 2599952635 322
140 iso_pu_bacteria 2599185305 2599960522 322
141 iso_pu_bacteria 2599185315 2600017438 322
142 iso_pu_bacteria 2599185321 2600052261 322
143 iso_pu_bacteria 2667528170 2671090237 322
144 iso_pu_bacteria 2675903515 2678262556 322
145 iso_pu_bacteria 2718217882 2719179601 322
146 iso_pu_bacteria 2718217997 2719663953 322
147 iso_pu_bacteria 2718218009 2719730271 322
148 iso_pu_bacteria 2718218199 2720490372 322
149 iso_pu_bacteria 2718218232 2720611741 322
150 iso_pu_bacteria 2718218235 2720629998 322
151 iso_pu_bacteria 2718218269 2720773693 322
152 iso_pu_bacteria 2718218363 2721145694 322
153 iso_pu_bacteria 2718218365 2721157210 322
154 iso_pu_bacteria 2718218366 2721162573 322
155 iso_pu_bacteria 2721755514 2722838743 322
156 iso_pu_bacteria 2721755556 2723025371 322
157 iso_pu_bacteria 2721755684 2723558954 322
158 iso_pu_bacteria 2721755685 2723565519 322
159 iso_pu_bacteria 2721755810 2724043027 322
160 iso_pu_bacteria 2721755819 2724088300 322
161 iso_pu_bacteria 2721755822 2724102784 322
162 iso_pu_bacteria 2721755823 2724108684 322
163 iso_pu_bacteria 2728369352 2730106307 322
164 iso_pu_bacteria 2728369365 2730162838 322
165 iso_pu_bacteria 2728369397 2730296842 322
166 iso_pu_bacteria 2738541294 2738809663 322
167 iso_pu_bacteria 2738541309 2738897023 322
168 iso_pu_bacteria 2744054620 2745008898 322
169 iso_pu_bacteria 2791355259 2793315399 322
170 iso_pu_bacteria 2791355263 2793341773 322
171 iso_pu_bacteria 2791355264 2793350774 322
172 iso_pu_bacteria 2791355266 2793362743 322
173 iso_pu_bacteria 2791355267 2793364704 322
174 iso_pu_bacteria 2802429605 2805931540 322
175 iso_pu_bacteria 2802429606 2805932339 322
176 iso_pu_bacteria 2838016132 2838020321 322
177 iso_pu_bacteria 2838042994 2838044388 322
178 iso_pu_bacteria 2838048938 2838051469 322
179 iso_pu_bacteria 2838068647 2838073663 322
180 iso_pu_bacteria 2838680041 2838680613 322
181 iso_pu_bacteria 2838694306 2838695354 322
182 iso_pu_bacteria 2838707686 2838708730 322
183 iso_pu_bacteria 2841864319 2841866782 322
184 iso_pu_bacteria 2842077413 2842080035 322
185 iso_pu_bacteria 2842110456 2842112235 322
186 iso_pu_bacteria 2842118031 2842120654 322
187 iso_pu_bacteria 2842205361 2842206920 322
188 iso_pu_bacteria 2842217011 2842218763 322
189 iso_pu_bacteria 2842237096 2842238142 322
190 iso_pu_bacteria 2842264693 2842267412 322
191 iso_pu_bacteria 2842278818 2842280387 322
192 iso_pu_bacteria 2842291075 2842293695 322
193 iso_pu_bacteria 2842341865 2842343046 322
194 iso_pu_bacteria 2842363717 2842367231 322
195 iso_pu_bacteria 2842370503 2842371076 322
196 iso_pu_bacteria 2842377471 2842380092 322
197 iso_pu_bacteria 2842384541 2842387163 322
198 iso_pu_bacteria 2842422224 2842427111 322
199 iso_pu_bacteria 2842428310 2842431336 322
200 iso_pu_bacteria 2842434925 2842437671 322
201 iso_pu_bacteria 2842441272 2842444486 322
202 iso_pu_bacteria 2842462802 2842465686 322
203 iso_pu_bacteria 2842469257 2842472496 322
204 iso_pu_bacteria 2842489311 2842492429 322
205 iso_pu_bacteria 2884811622 2884813800 322
206 iso_pu_bacteria 2884836552 2884839757 322
207 iso_pu_bacteria 2884852848 2884856432 322
208 iso_pu_bacteria 2894510363 2894510803 322
209 iso_pu_bacteria 2896154374 2896158798 322
210 iso_pu_bacteria 2913036834 2913038536 322
211 iso_pu_bacteria 2933586486 2933587564 322
212 iso_pu_bacteria 2933599457 2933604091 322
213 iso_pu_bacteria 2935894831 2935895877 322
214 iso_pu_bacteria 2936367885 2936368897 322
215 iso_pu_bacteria 2936375103 2936377023 322
216 iso_pu_bacteria 2936381700 2936383780 322
217 iso_pu_bacteria 2989392574 2989393123 322
218 iso_pu_bacteria 3005445848 3005451814 322
219 iso_pu_bacteria 8005282627 8005283611 322
220 iso_pu_bacteria 8005289223 8005291054 322
221 iso_pu_bacteria 8005376324 8005377405 322
222 iso_pu_bacteria 8005382845 8005387263 322
223 iso_pu_bacteria 8005430974 8005432962 322
224 iso_pu_bacteria 8005460587 8005461046 322
225 iso_pu_bacteria 8005497431 8005498695 322
226 iso_pu_bacteria 8005556819 8005560668 322
227 iso_pu_bacteria 8005619151 8005619890 322
228 iso_pu_bacteria 8005626139 8005628455 322
229 iso_pu_bacteria 8005668836 8005670106 322
230 iso_pu_bacteria 8005688590 8005690299 322
231 iso_pu_bacteria 8018127388 8018133153 322
232 iso_pu_bacteria 8018163183 8018167862 322
233 iso_pu_bacteria 8024501048 8024501567 322
234 iso_pu_bacteria 8054503363 8054505728 322
235 iso_pu_bacteria 8056375014 8056375661 322
236 iso_pu_bacteria 8056382006 8056385977 322
237 3300003790 Ga0055528_1002535 Ga0055528_10025357 323
238 3300003792 Ga0055540_1000111 Ga0055540_100011134 323
239 3300003792 Ga0055540_1003348 Ga0055540_10033487 323
240 3300003794 Ga0055531_10002952 Ga0055531_100029522 323
241 3300005295 Ga0065707_10082767 Ga0065707_100827672 323
242 3300005365 Ga0070688_100049673 Ga0070688_1000496732 323
243 3300005366 Ga0070659_100297882 Ga0070659_1002978822 323
244 3300006048 Ga0075363_100048783 Ga0075363_1000487831 323
245 3300006914 Ga0075436_100004923 Ga0075436_1000049232 323
246 3300009766 Ga0123342_1003337 Ga0123342_10033378 323
247 3300014325 Ga0163163_10000009 Ga0163163_10000009278 323
248 3300025273 Ga0209673_1001115 Ga0209673_100111519 323
249 3300025292 Ga0209676_1008360 Ga0209676_10083603 323
250 3300025303 Ga0209051_1000084 Ga0209051_1000084100 323
251 3300025304 Ga0209257_1003695 Ga0209257_10036954 323
252 3300025304 Ga0209257_1009326 Ga0209257_10093265 323
253 3300025932 Ga0207690_10239231 Ga0207690_102392312 323
254 3300026078 Ga0207702_10240263 Ga0207702_102402632 323
255 3300028573 Ga0265334_10043455 Ga0265334_100434551 323
256 3300028577 Ga0265318_10029778 Ga0265318_100297782 323
257 3300031238 Ga0265332_10058574 Ga0265332_100585741 323
258 3300031240 Ga0265320_10016854 Ga0265320_100168545 323
259 3300031242 Ga0265329_10033235 Ga0265329_100332352 323
260 3300031250 Ga0265331_10055712 Ga0265331_100557121 323
261 3300031344 Ga0265316_10105500 Ga0265316_101055002 323
262 3300031711 Ga0265314_10149096 Ga0265314_101490961 323
263 3300031712 Ga0265342_10079624 Ga0265342_100796241 323
264 3300032004 Ga0307414_10053032 Ga0307414_100530322 323
265 3300037471 Ga0395905_0284941 Ga0395905_0284941_203_1189 323
266 3300038726 Ga0400490_10479 Ga0400490_10479_758_1735 323
267 3300041501 Ga0451845_0408387 Ga0451845_0408387_2906_3886 323
268 3300041503 Ga0451847_0830035 Ga0451847_0830035_651_1631 323
269 3300041507 Ga0451851_0572074 Ga0451851_0572074_3921_4901 323
270 3300044712 Ga0453684_0017978 Ga0453684_0017978_4788_5774 323
271 3300045051 Ga0451576_0002540 Ga0451576_0002540_4112_5113 323
272 3300046492 Ga0495585_0052827 Ga0495585_0052827_80_1060 323
273 3300046660 Ga0495625_0001324 Ga0495625_0001324_6619_7602 323
274 3300046660 Ga0495625_0003740 Ga0495625_0003740_5136_6116 323
275 3300047472 Ga0495686_0118833 Ga0495686_0118833_33_1013 323
276 3300048917 Ga0496114_0356348 Ga0496114_0356348_157_1137 323
277 3300048919 Ga0496116_0019311 Ga0496116_0019311_2438_3433 323
278 3300049571 Ga0501034_0003487 Ga0501034_0003487_6080_7072 323
279 3300050496 nmdc:mga07m45_159105_c1 nmdc:mga07m45_159105_c1_41_1021 323
280 3300053090 Ga0500646_0005200 Ga0500646_0005200_871_1851 323
281 3300053134 Ga0500658_0032181 Ga0500658_0032181_60_1040 323
282 iso_pu_bacteria 2846037992 2846038047 323
283 iso_pu_bacteria 2929177148 2929178078 323
284 iso_pu_bacteria 2929239360 2929244006 323
285 iso_pu_bacteria 2945977869 2945980439 323
286 iso_pu_bacteria 2946013367 2946013700 323
287 3300005288 Ga0065714_10065553 Ga0065714_100655531 324
288 3300005289 Ga0065704_10119986 Ga0065704_101199861 324
289 3300005467 Ga0070706_100241633 Ga0070706_1002416332 324
290 3300005563 Ga0068855_100016263 Ga0068855_1000162639 324
291 3300005614 Ga0068856_100012328 Ga0068856_1000123282 324
292 3300013297 Ga0157378_10032839 Ga0157378_100328394 324
293 3300013306 Ga0163162_10228026 Ga0163162_102280263 324
294 3300025302 Ga0207426_1044180 Ga0207426_10441802 324
295 3300025913 Ga0207695_10002348 Ga0207695_1000234812 324
296 3300025924 Ga0207694_10210649 Ga0207694_102106492 324
297 3300025949 Ga0207667_10006247 Ga0207667_1000624714 324
298 3300025949 Ga0207667_10535409 Ga0207667_105354091 324
299 3300026078 Ga0207702_10342472 Ga0207702_103424722 324
300 3300039062 Ga0400483_031157 Ga0400483_031157_13350_14354 324
301 3300039062 Ga0400483_219096 Ga0400483_219096_2081_3085 324
302 3300042009 Ga0439451_000029 Ga0439451_000029_22077_23054 324
303 3300042016 Ga0439463_008131 Ga0439463_008131_1137_2114 324
304 3300042145 Ga0450906_000038 Ga0450906_000038_1555_2532 324
305 3300003320 rootH2_10023205 rootH2_1002320518 325
306 3300005338 Ga0068868_100099292 Ga0068868_1000992922 325
307 3300005455 Ga0070663_100344193 Ga0070663_1003441931 325
308 3300005467 Ga0070706_100067854 Ga0070706_1000678541 325
309 3300005468 Ga0070707_100018733 Ga0070707_1000187333 325
310 3300005471 Ga0070698_100008387 Ga0070698_1000083878 325
311 3300005563 Ga0068855_100004293 Ga0068855_10000429314 325
312 3300005617 Ga0068859_100310251 Ga0068859_1003102512 325
313 3300006186 Ga0075369_10014358 Ga0075369_100143582 325
314 3300006931 Ga0097620_100310249 Ga0097620_1003102492 325
315 3300009177 Ga0105248_10131991 Ga0105248_101319913 325
316 3300013308 Ga0157375_10098294 Ga0157375_100982942 325
317 3300014968 Ga0157379_10243660 Ga0157379_102436602 325
318 3300024225 Ga0224572_1000121 Ga0224572_10001213 325
319 3300025304 Ga0209257_1012045 Ga0209257_10120454 325
320 3300025913 Ga0207695_10151886 Ga0207695_101518862 325
321 3300025941 Ga0207711_10021829 Ga0207711_100218295 325
322 3300025949 Ga0207667_10008112 Ga0207667_100081127 325
323 3300026023 Ga0207677_10152781 Ga0207677_101527811 325
324 3300030521 Ga0307511_10000063 Ga0307511_1000006329 325
325 3300031247 Ga0265340_10002393 Ga0265340_1000239310 325
326 3300031249 Ga0265339_10122166 Ga0265339_101221662 325
327 3300031712 Ga0265342_10000541 Ga0265342_100005414 325
328 3300037853 Ga0436364_0741378 Ga0436364_0741378_853_1848 325
329 3300038443 Ga0395901_0000599 Ga0395901_0000599_31314_32315 325
330 3300039062 Ga0400483_116214 Ga0400483_116214_1091_2068 325
331 3300039062 Ga0400483_238768 Ga0400483_238768_13729_14709 325
332 3300042876 Ga0451577_0010409 Ga0451577_0010409_5677_6657 325
333 3300044673 Ga0453683_0034084 Ga0453683_0034084_591_1586 325
334 3300044712 Ga0453684_0000264 Ga0453684_0000264_7988_8968 325
335 3300044712 Ga0453684_0105591 Ga0453684_0105591_2080_3060 325
336 3300044712 Ga0453684_0250958 Ga0453684_0250958_337_1317 325
337 3300044712 Ga0453684_0297881 Ga0453684_0297881_111_1106 325
338 3300045051 Ga0451576_0000229 Ga0451576_0000229_80766_81761 325
339 3300045051 Ga0451576_0000691 Ga0451576_0000691_59437_60417 325
340 3300048911 Ga0496108_0184105 Ga0496108_0184105_641_1636 325
341 3300048917 Ga0496114_0175790 Ga0496114_0175790_300_1295 325
342 3300050516 nmdc:mga0sz30_97977_c1 nmdc:mga0sz30_97977_c1_87_1079 325
343 3300053090 Ga0500646_0005387 Ga0500646_0005387_508_1500 325
344 3300053092 Ga0500583_0058025 Ga0500583_0058025_512_1504 325
345 3300053139 Ga0500568_0010204 Ga0500568_0010204_2538_3530 325
346 3300053151 Ga0500604_0000448 Ga0500604_0000448_6193_7185 325
347 2162886007 SwRhRL2b_contig_1408983 SwRhRL2b_0038.00000280 326
348 2162886007 SwRhRL2b_contig_1550039 SwRhRL2b_0059.00003610 326
349 3300001904 JGI24736J21556_1001139 JGI24736J21556_10011393 326
350 3300001990 JGI24737J22298_10044463 JGI24737J22298_100444632 326
351 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003174 326
352 3300003215 JGI25153J46596_10001948 JGI25153J46596_1000194810 326
353 3300003320 rootH2_10019643 rootH2_100196435 326
354 3300003320 rootH2_10063417 rootH2_100634172 326
355 3300003320 rootH2_10093703 rootH2_100937031 326
356 3300003320 rootH2_10116275 rootH2_101162757 326
357 3300003322 rootL2_10003685 rootL2_100036858 326
358 3300003322 rootL2_10025009 rootL2_1002500910 326
359 3300003322 rootL2_10050278 rootL2_100502783 326
360 3300003322 rootL2_10181287 rootL2_101812871 326
361 3300003323 rootH1_10000940 rootH1_1000094068 326
362 3300003323 rootH1_10003366 rootH1_100033666 326
363 3300003323 rootH1_10004759 rootH1_100047593 326
364 3300003323 rootH1_10258632 rootH1_102586322 326
365 3300003323 rootH1_10302263 rootH1_103022632 326
366 3300003544 Ga0007417J51691_1042512 Ga0007417J51691_10425122 326
367 3300003574 Ga0007410J51695_1039273 Ga0007410J51695_10392732 326
368 3300003575 Ga0007409J51694_1026885 Ga0007409J51694_10268853 326
369 3300003577 Ga0007416J51690_1025485 Ga0007416J51690_10254852 326
370 3300003693 Ga0032354_1036793 Ga0032354_10367932 326
371 3300003771 Ga0055526_1005874 Ga0055526_10058745 326
372 3300003791 Ga0055530_10000142 Ga0055530_1000014224 326
373 3300003794 Ga0055531_10000013 Ga0055531_1000001338 326
374 3300005262 Ga0065165_1000016 Ga0065165_100001693 326
375 3300005262 Ga0065165_1002007 Ga0065165_100200712 326
376 3300005289 Ga0065704_10070458 Ga0065704_1007045814 326
377 3300005289 Ga0065704_10117396 Ga0065704_101173962 326
378 3300005334 Ga0068869_100210463 Ga0068869_1002104632 326
379 3300005339 Ga0070660_100254268 Ga0070660_1002542682 326
380 3300005457 Ga0070662_100085977 Ga0070662_1000859772 326
381 3300005457 Ga0070662_100097751 Ga0070662_1000977513 326
382 3300005458 Ga0070681_10084075 Ga0070681_100840752 326
383 3300005459 Ga0068867_100112441 Ga0068867_1001124412 326
384 3300005535 Ga0070684_100251227 Ga0070684_1002512272 326
385 3300005548 Ga0070665_100223345 Ga0070665_1002233452 326
386 3300005563 Ga0068855_100243567 Ga0068855_1002435672 326
387 3300005577 Ga0068857_100195057 Ga0068857_1001950572 326
388 3300005577 Ga0068857_100207456 Ga0068857_1002074562 326
389 3300005616 Ga0068852_100055331 Ga0068852_1000553313 326
390 3300005616 Ga0068852_100374665 Ga0068852_1003746652 326
391 3300006048 Ga0075363_100057558 Ga0075363_1000575582 326
392 3300006177 Ga0075362_10003869 Ga0075362_100038693 326
393 3300006178 Ga0075367_10045034 Ga0075367_100450343 326
394 3300006195 Ga0075366_10000739 Ga0075366_100007399 326
395 3300006237 Ga0097621_100207943 Ga0097621_1002079432 326
396 3300006353 Ga0075370_10002050 Ga0075370_100020502 326
397 3300006846 Ga0075430_100056701 Ga0075430_1000567012 326
398 3300006880 Ga0075429_100000282 Ga0075429_1000002825 326
399 3300007076 Ga0075435_100057833 Ga0075435_1000578333 326
400 3300009011 Ga0105251_10000751 Ga0105251_1000075127 326
401 3300009092 Ga0105250_10000064 Ga0105250_1000006429 326
402 3300009093 Ga0105240_10000198 Ga0105240_1000019887 326
403 3300009093 Ga0105240_10013476 Ga0105240_1001347611 326
404 3300009093 Ga0105240_10019201 Ga0105240_100192016 326
405 3300009148 Ga0105243_10148926 Ga0105243_101489262 326
406 3300009174 Ga0105241_10000137 Ga0105241_1000013712 326
407 3300009174 Ga0105241_10005687 Ga0105241_100056876 326
408 3300009545 Ga0105237_10000781 Ga0105237_1000078114 326
409 3300009545 Ga0105237_10003050 Ga0105237_1000305015 326
410 3300009545 Ga0105237_10006169 Ga0105237_100061693 326
411 3300009545 Ga0105237_10029703 Ga0105237_100297033 326
412 3300009551 Ga0105238_10008871 Ga0105238_1000887112 326
413 3300009551 Ga0105238_10125683 Ga0105238_101256833 326
414 3300010375 Ga0105239_10000298 Ga0105239_100002987 326
415 3300010375 Ga0105239_10001227 Ga0105239_100012273 326
416 3300010375 Ga0105239_10005875 Ga0105239_100058755 326
417 3300010375 Ga0105239_10008489 Ga0105239_100084894 326
418 3300010375 Ga0105239_10010597 Ga0105239_100105977 326
419 3300010375 Ga0105239_10022204 Ga0105239_100222042 326
420 3300010375 Ga0105239_10257443 Ga0105239_102574432 326
421 3300013297 Ga0157378_10019196 Ga0157378_100191963 326
422 3300013306 Ga0163162_10001192 Ga0163162_1000119211 326
423 3300013306 Ga0163162_10122910 Ga0163162_101229102 326
424 3300013306 Ga0163162_10140552 Ga0163162_101405522 326
425 3300013307 Ga0157372_10029040 Ga0157372_100290402 326
426 3300013307 Ga0157372_10181845 Ga0157372_101818452 326
427 3300013307 Ga0157372_10199309 Ga0157372_101993092 326
428 3300013308 Ga0157375_10446015 Ga0157375_104460151 326
429 3300014325 Ga0163163_10000095 Ga0163163_1000009578 326
430 3300014325 Ga0163163_10362228 Ga0163163_103622281 326
431 3300014326 Ga0157380_10000932 Ga0157380_100009322 326
432 3300017792 Ga0163161_10000515 Ga0163161_1000051510 326
433 3300017792 Ga0163161_10000642 Ga0163161_1000064216 326
434 3300025246 Ga0209646_1000004 Ga0209646_1000004165 326
435 3300025250 Ga0209026_1000192 Ga0209026_100019266 326
436 3300025258 Ga0209129_1004827 Ga0209129_10048272 326
437 3300025273 Ga0209673_1015094 Ga0209673_10150943 326
438 3300025273 Ga0209673_1036211 Ga0209673_10362112 326
439 3300025295 Ga0209564_1000008 Ga0209564_1000008451 326
440 3300025295 Ga0209564_1003789 Ga0209564_10037894 326
441 3300025297 Ga0209758_1000912 Ga0209758_100091227 326
442 3300025298 Ga0209050_1000014 Ga0209050_1000014126 326
443 3300025302 Ga0207426_1000930 Ga0207426_100093014 326
444 3300025304 Ga0209257_1000019 Ga0209257_1000019566 326
445 3300025711 Ga0207696_1000128 Ga0207696_100012865 326
446 3300025735 Ga0207713_1000769 Ga0207713_10007694 326
447 3300025904 Ga0207647_10000065 Ga0207647_1000006543 326
448 3300025911 Ga0207654_10002083 Ga0207654_100020834 326
449 3300025912 Ga0207707_10136949 Ga0207707_101369492 326
450 3300025913 Ga0207695_10000346 Ga0207695_1000034685 326
451 3300025913 Ga0207695_10023054 Ga0207695_100230543 326
452 3300025913 Ga0207695_10071145 Ga0207695_100711454 326
453 3300025914 Ga0207671_10002368 Ga0207671_100023687 326
454 3300025914 Ga0207671_10003677 Ga0207671_1000367714 326
455 3300025914 Ga0207671_10010854 Ga0207671_100108546 326
456 3300025919 Ga0207657_10241527 Ga0207657_102415272 326
457 3300025924 Ga0207694_10207634 Ga0207694_102076343 326
458 3300025933 Ga0207706_10112139 Ga0207706_101121392 326
459 3300025935 Ga0207709_10084108 Ga0207709_100841082 326
460 3300025942 Ga0207689_10222602 Ga0207689_102226021 326
461 3300026067 Ga0207678_10181405 Ga0207678_101814051 326
462 3300026116 Ga0207674_10236565 Ga0207674_102365652 326
463 3300026116 Ga0207674_10256848 Ga0207674_102568482 326
464 3300026142 Ga0207698_10040977 Ga0207698_100409773 326
465 3300028653 Ga0265323_10001069 Ga0265323_100010697 326
466 3300031251 Ga0265327_10001563 Ga0265327_100015634 326
467 3300031251 Ga0265327_10025480 Ga0265327_100254804 326
468 3300031251 Ga0265327_10065614 Ga0265327_100656142 326
469 3300031344 Ga0265316_10011830 Ga0265316_100118302 326
470 3300031548 Ga0307408_100000040 Ga0307408_100000040122 326
471 3300031548 Ga0307408_100000330 Ga0307408_10000033035 326
472 3300031548 Ga0307408_100002008 Ga0307408_1000020085 326
473 3300031548 Ga0307408_100006042 Ga0307408_1000060428 326
474 3300031548 Ga0307408_100029022 Ga0307408_1000290224 326
475 3300031595 Ga0265313_10109343 Ga0265313_101093431 326
476 3300031711 Ga0265314_10002337 Ga0265314_1000233711 326
477 3300031730 Ga0307516_10011905 Ga0307516_100119059 326
478 3300031911 Ga0307412_10044372 Ga0307412_100443722 326
479 3300032004 Ga0307414_10003386 Ga0307414_100033866 326
480 3300033180 Ga0307510_10017380 Ga0307510_1001738010 326
481 3300037312 Ga0395899_0000246 Ga0395899_0000246_5515_6498 326
482 3300037312 Ga0395899_0000613 Ga0395899_0000613_6213_7193 326
483 3300037312 Ga0395899_0000963 Ga0395899_0000963_4644_5627 326
484 3300037418 Ga0395900_0000435 Ga0395900_0000435_9364_10344 326
485 3300037418 Ga0395900_0000540 Ga0395900_0000540_11774_12763 326
486 3300037418 Ga0395900_0006688 Ga0395900_0006688_6911_7894 326
487 3300037418 Ga0395900_0014043 Ga0395900_0014043_1373_2353 326
488 3300037466 Ga0395898_0008561 Ga0395898_0008561_4666_5649 326
489 3300037471 Ga0395905_0001728 Ga0395905_0001728_1998_2981 326
490 3300037471 Ga0395905_0006231 Ga0395905_0006231_1075_2073 326
491 3300037471 Ga0395905_0007452 Ga0395905_0007452_4626_5609 326
492 3300037471 Ga0395905_0017913 Ga0395905_0017913_5312_6292 326
493 3300038443 Ga0395901_0000082 Ga0395901_0000082_33750_34739 326
494 3300038443 Ga0395901_0003312 Ga0395901_0003312_10582_11565 326
495 3300038443 Ga0395901_0019273 Ga0395901_0019273_4809_5789 326
496 3300038725 Ga0400484_15225 Ga0400484_15225_15130_16302 326
497 3300038725 Ga0400484_21715 Ga0400484_21715_10_1002 326
498 3300039062 Ga0400483_038110 Ga0400483_038110_4463_5455 326
499 3300039062 Ga0400483_039039 Ga0400483_039039_2883_3878 326
500 3300039447 Ga0436361_0540516 Ga0436361_0540516_849_1841 326
501 3300042016 Ga0439463_006258 Ga0439463_006258_1802_2782 326
502 3300042876 Ga0451577_0000852 Ga0451577_0000852_21411_22391 326
503 3300044673 Ga0453683_0028779 Ga0453683_0028779_1828_2820 326
504 3300044673 Ga0453683_0074614 Ga0453683_0074614_1040_2038 326
505 3300044683 Ga0466965_0048475 Ga0466965_0048475_212_1195 326
506 3300044684 Ga0466966_0001048 Ga0466966_0001048_761_1744 326
507 3300044712 Ga0453684_0002092 Ga0453684_0002092_23138_24118 326
508 3300044712 Ga0453684_0058351 Ga0453684_0058351_499_1497 326
509 3300044712 Ga0453684_0076625 Ga0453684_0076625_2191_3171 326
510 3300044712 Ga0453684_0208240 Ga0453684_0208240_264_1262 326
511 3300045051 Ga0451576_0014619 Ga0451576_0014619_6693_7691 326
512 3300045051 Ga0451576_0275292 Ga0451576_0275292_101_1093 326
513 3300046457 Ga0495590_0000338 Ga0495590_0000338_2644_3624 326
514 3300046462 Ga0495651_0084099 Ga0495651_0084099_273_1271 326
515 3300046491 Ga0495584_0002958 Ga0495584_0002958_1603_2583 326
516 3300046492 Ga0495585_0015743 Ga0495585_0015743_1932_2921 326
517 3300046506 Ga0495583_0000460 Ga0495583_0000460_57067_58050 326
518 3300046507 Ga0495606_0002199 Ga0495606_0002199_1468_2448 326
519 3300046520 Ga0495637_0000574 Ga0495637_0000574_22374_23354 326
520 3300046523 Ga0495644_0007634 Ga0495644_0007634_228_1217 326
521 3300046528 Ga0495642_0000058 Ga0495642_0000058_31093_32082 326
522 3300046530 Ga0495654_0000711 Ga0495654_0000711_22396_23376 326
523 3300046542 Ga0495597_0000822 Ga0495597_0000822_2640_3620 326
524 3300046665 Ga0495661_0012810 Ga0495661_0012810_1375_2355 326
525 3300046694 Ga0495649_0000913 Ga0495649_0000913_20736_21716 326
526 3300047320 Ga0495672_0105785 Ga0495672_0105785_148_1128 326
527 3300047472 Ga0495686_0106462 Ga0495686_0106462_321_1301 326
528 3300048091 Ga0495626_0001439 Ga0495626_0001439_14873_15862 326
529 3300048913 Ga0496110_0000755 Ga0496110_0000755_938_1927 326
530 3300048914 Ga0496111_0043005 Ga0496111_0043005_173_1162 326
531 3300048920 Ga0496117_0001860 Ga0496117_0001860_14608_15588 326
532 3300048921 Ga0496118_0001427 Ga0496118_0001427_21855_22835 326
533 3300048922 Ga0496119_0021895 Ga0496119_0021895_3132_4112 326
534 3300048923 Ga0496120_0010214 Ga0496120_0010214_5179_6159 326
535 3300048924 Ga0496121_0002976 Ga0496121_0002976_12992_13972 326
536 3300048924 Ga0496121_0143333 Ga0496121_0143333_772_1752 326
537 3300048925 Ga0496122_0000021 Ga0496122_0000021_91264_92244 326
538 3300048925 Ga0496122_0002040 Ga0496122_0002040_26863_27843 326
539 3300048925 Ga0496122_0012631 Ga0496122_0012631_1117_2097 326
540 3300048926 Ga0496123_0000382 Ga0496123_0000382_37382_38362 326
541 3300048926 Ga0496123_0001660 Ga0496123_0001660_2047_3027 326
542 3300048926 Ga0496123_0003828 Ga0496123_0003828_10477_11457 326
543 3300048927 Ga0496124_0007489 Ga0496124_0007489_1928_2908 326
544 3300048927 Ga0496124_0024142 Ga0496124_0024142_3853_4833 326
545 3300048928 Ga0496125_0004710 Ga0496125_0004710_3828_4808 326
546 3300048929 Ga0496126_0002235 Ga0496126_0002235_13361_14341 326
547 3300049459 Ga0495678_006899 Ga0495678_006899_1352_2332 326
548 3300049583 Ga0501067_0057845 Ga0501067_0057845_833_1831 326
549 3300049670 Ga0501236_002184 Ga0501236_002184_91_1089 326
550 3300049677 Ga0501247_001609 Ga0501247_001609_639_1637 326
551 3300049758 Ga0501241_000132 Ga0501241_000132_7992_8990 326
552 3300049758 Ga0501241_000308 Ga0501241_000308_6621_7619 326
553 3300049761 Ga0501264_001786 Ga0501264_001786_1150_2148 326
554 3300049822 Ga0501035_0003553 Ga0501035_0003553_2337_3326 326
555 3300049823 Ga0501044_0278789 Ga0501044_0278789_160_1197 326
556 3300050489 nmdc:mga03683_21069_c1 nmdc:mga03683_21069_c1_1285_2265 326
557 3300050490 nmdc:mga03n38_37782_c1 nmdc:mga03n38_37782_c1_1002_1982 326
558 3300050492 nmdc:mga0yw44_90771_c1 nmdc:mga0yw44_90771_c1_581_1570 326
559 3300050493 nmdc:mga0k408_1459_c1 nmdc:mga0k408_1459_c1_6241_7239 326
560 3300050493 nmdc:mga0k408_6251_c1 nmdc:mga0k408_6251_c1_3241_4221 326
561 3300050493 nmdc:mga0k408_68735_c1 nmdc:mga0k408_68735_c1_998_1978 326
562 3300050493 nmdc:mga0k408_800_c1 nmdc:mga0k408_800_c1_33_1013 326
563 3300050494 nmdc:mga06z11_1646_c1 nmdc:mga06z11_1646_c1_2313_3293 326
564 3300050494 nmdc:mga06z11_68033_c1 nmdc:mga06z11_68033_c1_748_1728 326
565 3300050496 nmdc:mga07m45_36467_c1 nmdc:mga07m45_36467_c1_117_1097 326
566 3300050507 nmdc:mga05p37_475694_c1 nmdc:mga05p37_475694_c1_306_1286 326
567 3300050508 nmdc:mga09592_2771_c1 nmdc:mga09592_2771_c1_12106_13086 326
568 3300050509 nmdc:mga0qj67_227704_c1 nmdc:mga0qj67_227704_c1_426_1406 326
569 3300050513 nmdc:mga0rr50_477806_c1 nmdc:mga0rr50_477806_c1_26_1027 326
570 3300050514 nmdc:mga08x19_10432_c1 nmdc:mga08x19_10432_c1_1069_2064 326
571 3300053088 Ga0500644_0000069 Ga0500644_0000069_49000_49998 326
572 3300053090 Ga0500646_0017932 Ga0500646_0017932_598_1596 326
573 3300053153 Ga0500616_0030999 Ga0500616_0030999_1405_2406 326
574 3300053156 Ga0500622_0000199 Ga0500622_0000199_27137_28135 326
575 3300059504 Ga0587082_000790 Ga0587082_000790_1613_2602 326
576 3300059508 Ga0587088_010191 Ga0587088_010191_172_1161 326
577 iso_pu_bacteria 2977971508 2977978354 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

68

303

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

69

370

0.92

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

69

299

0.86

PF07993

NAD_binding_4

Male sterility protein

70

260

0.85

PF00106

adh_short

short chain dehydrogenase

66

229

0.81

PF04321

RmlD_sub_bind

RmlD substrate binding domain

66

376

0.77

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

68

340

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpk-assembly1.cif.gz_D crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9323 1 312
2pk3-assembly1.cif.gz_B crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase 0.9308 2 312
6q94-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9278 1 312
4lw8-assembly1.cif.gz_B crystal structure of a putative epimerase from burkholderia cenocepacia j2315 0.9275 2 311
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9259 2 310
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 2 238 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9262 2 296 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 2 296 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9189 2 238 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9144 2 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A849GSL6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.991 66 326
AF-A0A5D0UHD6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9882 2 326 GO:0016831
AF-A0A849GSL6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9834 66 326
AF-A0A5D0UHD6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9822 2 326 GO:0016831
AF-A0A496U4I3-F1-model_v4 NAD-dependent dehydratase 0.9807 2 316

Feature Viewer

pLDDT pTM Quality
96.75 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map