F465065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 312 | 551 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10369211|Ga0114129_103692112 |
| Length | 281 |
| Sequence | MQRAQTLARAARRQRDRELENWIHEFGDLWTFFNTTPTGMLSPMIDLYFSPTPNGLKLKLFFEESGLPHRVLPVRLSQGEQFKPEFLAISPNNKIPALVDHAPADGGEPLAMFESGAMLLYLAQKIGRFLPHGPRAMGELMQWLFWQVGGLGPMAGQNGHFTAHAPEKLPYAIERYTRETNRLYGVLDRRLAGRDYIVGSDYSIADMACYPWIVPHRSHGQDLQQFPHLARWFARIAARPATQRAYVGVQDAYAPSAQALSDEARRALFGQTSATSGSPSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 7 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 13 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 14 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 15 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 16 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 17 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 18 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 168 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 183 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 187 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 188 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 194 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 302 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 307 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 308 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.15 |
| Metatranscriptomes | 0.35 |
| Isolates | 3.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 0.17 |
| Rhizoplane | 8.57 |
| Rhizosphere | 77.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1006124 | 3300001915 | Bacteria | 2449 |
| 2 | JGI24735J21928_10068943 | 3300002067 | Bacteria | 1014 |
| 3 | JGI24735J21928_10073514 | 3300002067 | Bacteria | 979 |
| 4 | JGI25153J46596_10051962 | 3300003215 | Bacteria | 1170 |
| 5 | rootH2_10040930 | 3300003320 | Bacteria | 9788 |
| 6 | JGI25160J50197_1000208 | 3300003354 | Bacteria | 48426 |
| 7 | Ga0006562J51391_1117239 | 3300003578 | Bacteria | 4133 |
| 8 | Ga0055535_1000480 | 3300003761 | Bacteria | 36096 |
| 9 | Ga0055542_1000498 | 3300003762 | Bacteria | 36096 |
| 10 | Ga0065165_1000119 | 3300005262 | Bacteria | 134464 |
| 11 | Ga0065714_10064584 | 3300005288 | Bacteria | 32069 |
| 12 | Ga0070676_10052441 | 3300005328 | Bacteria | 2398 |
| 13 | Ga0070676_10090935 | 3300005328 | Bacteria | 1869 |
| 14 | Ga0070683_100436854 | 3300005329 | Bacteria | 1249 |
| 15 | Ga0070683_100520267 | 3300005329 | Bacteria | 1137 |
| 16 | Ga0070670_100449375 | 3300005331 | Bacteria | 1142 |
| 17 | Ga0068869_100056780 | 3300005334 | Bacteria | 2856 |
| 18 | Ga0068869_100081067 | 3300005334 | Bacteria | 2423 |
| 19 | Ga0068869_100129853 | 3300005334 | Bacteria | 1936 |
| 20 | Ga0070666_10089653 | 3300005335 | Bacteria | 2111 |
| 21 | Ga0070682_100499447 | 3300005337 | Bacteria | 942 |
| 22 | Ga0068868_100105906 | 3300005338 | Bacteria | 2281 |
| 23 | Ga0070660_100162258 | 3300005339 | Bacteria | 1801 |
| 24 | Ga0070689_100066378 | 3300005340 | Bacteria | 2811 |
| 25 | Ga0070668_100014694 | 3300005347 | Bacteria | 5851 |
| 26 | Ga0070668_100066227 | 3300005347 | Bacteria | 2803 |
| 27 | Ga0070668_100075258 | 3300005347 | Bacteria | 2636 |
| 28 | Ga0070668_100290784 | 3300005347 | Bacteria | 1368 |
| 29 | Ga0070669_100002673 | 3300005353 | Bacteria | 12838 |
| 30 | Ga0070669_100063099 | 3300005353 | Bacteria | 2726 |
| 31 | Ga0070669_100063183 | 3300005353 | Bacteria | 2725 |
| 32 | Ga0070675_100063084 | 3300005354 | Bacteria | 3063 |
| 33 | Ga0070671_100150090 | 3300005355 | Bacteria | 1968 |
| 34 | Ga0070673_100085091 | 3300005364 | Bacteria | 2573 |
| 35 | Ga0070667_100087564 | 3300005367 | Bacteria | 2673 |
| 36 | Ga0070667_100148812 | 3300005367 | Bacteria | 2055 |
| 37 | Ga0070709_10294781 | 3300005434 | Bacteria | 1183 |
| 38 | Ga0070700_100047517 | 3300005441 | Bacteria | 2656 |
| 39 | Ga0070663_100015745 | 3300005455 | Bacteria | 4891 |
| 40 | Ga0070663_100047590 | 3300005455 | Bacteria | 3038 |
| 41 | Ga0070663_100102577 | 3300005455 | Bacteria | 2137 |
| 42 | Ga0070663_100114402 | 3300005455 | Bacteria | 2031 |
| 43 | Ga0070663_100120811 | 3300005455 | Bacteria | 1979 |
| 44 | Ga0070663_100317809 | 3300005455 | Bacteria | 1251 |
| 45 | Ga0070678_100183402 | 3300005456 | Bacteria | 1715 |
| 46 | Ga0070662_100048167 | 3300005457 | Bacteria | 3069 |
| 47 | Ga0070662_100057900 | 3300005457 | Bacteria | 2817 |
| 48 | Ga0070681_10040601 | 3300005458 | Bacteria | 4661 |
| 49 | Ga0068867_100000977 | 3300005459 | Bacteria | 19533 |
| 50 | Ga0070698_100229368 | 3300005471 | Bacteria | 1790 |
| 51 | Ga0070698_100312159 | 3300005471 | Bacteria | 1503 |
| 52 | Ga0068853_100011346 | 3300005539 | Bacteria | 7237 |
| 53 | Ga0068853_100012222 | 3300005539 | Bacteria | 6981 |
| 54 | Ga0068853_100083468 | 3300005539 | Bacteria | 2799 |
| 55 | Ga0070672_100004832 | 3300005543 | Bacteria | 8856 |
| 56 | Ga0070672_100093733 | 3300005543 | Bacteria | 2426 |
| 57 | Ga0070672_100286340 | 3300005543 | Bacteria | 1394 |
| 58 | Ga0070696_100034236 | 3300005546 | Bacteria | 3494 |
| 59 | Ga0070665_100012782 | 3300005548 | Bacteria | 8458 |
| 60 | Ga0070665_100235937 | 3300005548 | Bacteria | 1829 |
| 61 | Ga0070665_100259614 | 3300005548 | Bacteria | 1739 |
| 62 | Ga0070665_100286650 | 3300005548 | Bacteria | 1649 |
| 63 | Ga0070665_100806840 | 3300005548 | Bacteria | 951 |
| 64 | Ga0068855_100006688 | 3300005563 | Bacteria | 13999 |
| 65 | Ga0068855_100036599 | 3300005563 | Bacteria | 5840 |
| 66 | Ga0068855_100048401 | 3300005563 | Bacteria | 5017 |
| 67 | Ga0068855_100232030 | 3300005563 | Bacteria | 2066 |
| 68 | Ga0068855_100393111 | 3300005563 | Bacteria | 1521 |
| 69 | Ga0068857_100001325 | 3300005577 | Bacteria | 19451 |
| 70 | Ga0068857_100018771 | 3300005577 | Bacteria | 6067 |
| 71 | Ga0068857_100055534 | 3300005577 | Bacteria | 3515 |
| 72 | Ga0068854_100005095 | 3300005578 | Bacteria | 8278 |
| 73 | Ga0068854_100037766 | 3300005578 | Bacteria | 3391 |
| 74 | Ga0068856_100079863 | 3300005614 | Bacteria | 3244 |
| 75 | Ga0068852_100141840 | 3300005616 | Bacteria | 2224 |
| 76 | Ga0068852_100211265 | 3300005616 | Bacteria | 1841 |
| 77 | Ga0068852_100226744 | 3300005616 | Bacteria | 1779 |
| 78 | Ga0068852_100297830 | 3300005616 | Bacteria | 1560 |
| 79 | Ga0068859_100000070 | 3300005617 | Bacteria | 94311 |
| 80 | Ga0068859_101021260 | 3300005617 | Bacteria | 908 |
| 81 | Ga0068861_100015016 | 3300005719 | Bacteria | 5448 |
| 82 | Ga0068851_10001014 | 3300005834 | Bacteria | 12181 |
| 83 | Ga0068851_10026033 | 3300005834 | Bacteria | 2872 |
| 84 | Ga0068870_10021051 | 3300005840 | Bacteria | 3185 |
| 85 | Ga0068863_100005629 | 3300005841 | Bacteria | 12309 |
| 86 | Ga0068863_100222800 | 3300005841 | Bacteria | 1818 |
| 87 | Ga0068858_100095249 | 3300005842 | Bacteria | 2773 |
| 88 | Ga0068860_100287451 | 3300005843 | Bacteria | 1608 |
| 89 | Ga0068860_100327298 | 3300005843 | Bacteria | 1505 |
| 90 | Ga0068862_100000041 | 3300005844 | Bacteria | 166801 |
| 91 | Ga0068862_100000722 | 3300005844 | Bacteria | 33471 |
| 92 | Ga0068862_100001530 | 3300005844 | Bacteria | 21160 |
| 93 | Ga0081455_10051486 | 3300005937 | Bacteria | 3532 |
| 94 | Ga0081540_1010382 | 3300005983 | Bacteria | 6313 |
| 95 | Ga0070717_10065536 | 3300006028 | Bacteria | 3020 |
| 96 | Ga0075366_10083227 | 3300006195 | Bacteria | 1912 |
| 97 | Ga0075366_10301756 | 3300006195 | Bacteria | 980 |
| 98 | Ga0097621_100048825 | 3300006237 | Bacteria | 3436 |
| 99 | Ga0097621_100133458 | 3300006237 | Bacteria | 2115 |
| 100 | Ga0068871_100266435 | 3300006358 | Bacteria | 1496 |
| 101 | Ga0068871_100373900 | 3300006358 | Bacteria | 1265 |
| 102 | Ga0068871_100629097 | 3300006358 | Bacteria | 978 |
| 103 | Ga0075428_100007767 | 3300006844 | Bacteria | 11888 |
| 104 | Ga0075430_100000458 | 3300006846 | Bacteria | 30423 |
| 105 | Ga0075430_100011525 | 3300006846 | Bacteria | 7514 |
| 106 | Ga0075430_100013283 | 3300006846 | Bacteria | 7020 |
| 107 | Ga0075431_100000243 | 3300006847 | Bacteria | 41087 |
| 108 | Ga0075431_100000267 | 3300006847 | Bacteria | 40345 |
| 109 | Ga0075431_100003216 | 3300006847 | Bacteria | 15805 |
| 110 | Ga0075431_100008297 | 3300006847 | Bacteria | 10388 |
| 111 | Ga0075429_100000445 | 3300006880 | Bacteria | 30747 |
| 112 | Ga0075429_100001924 | 3300006880 | Bacteria | 17218 |
| 113 | Ga0075429_100085573 | 3300006880 | Bacteria | 2748 |
| 114 | Ga0075429_100341034 | 3300006880 | Bacteria | 1312 |
| 115 | Ga0068865_100005556 | 3300006881 | Bacteria | 7646 |
| 116 | Ga0068865_100008801 | 3300006881 | Bacteria | 6242 |
| 117 | Ga0068865_100245651 | 3300006881 | Bacteria | 1410 |
| 118 | Ga0097620_100000070 | 3300006931 | Bacteria | 94311 |
| 119 | Ga0097620_101021339 | 3300006931 | Bacteria | 908 |
| 120 | Ga0105240_10001295 | 3300009093 | Bacteria | 43234 |
| 121 | Ga0105240_10016935 | 3300009093 | Bacteria | 9851 |
| 122 | Ga0105240_10050609 | 3300009093 | Bacteria | 5236 |
| 123 | Ga0105240_10073268 | 3300009093 | Bacteria | 4229 |
| 124 | Ga0111539_10000989 | 3300009094 | Bacteria | 37233 |
| 125 | Ga0111539_10041545 | 3300009094 | Bacteria | 5528 |
| 126 | Ga0105247_10048258 | 3300009101 | Bacteria | 2615 |
| 127 | Ga0105247_10074639 | 3300009101 | Bacteria | 2127 |
| 128 | Ga0114129_10001320 | 3300009147 | Bacteria | 33176 |
| 129 | Ga0114129_10029160 | 3300009147 | Bacteria | 7818 |
| 130 | Ga0114129_10279423 | 3300009147 | Bacteria | 2231 |
| 131 | Ga0114129_10369211 | 3300009147 | Bacteria | 1897 |
| 132 | Ga0114129_10528959 | 3300009147 | Bacteria | 1536 |
| 133 | Ga0105243_10002995 | 3300009148 | Bacteria | 13953 |
| 134 | Ga0105248_10248344 | 3300009177 | Bacteria | 2003 |
| 135 | Ga0105237_10000058 | 3300009545 | Bacteria | 146943 |
| 136 | Ga0105237_10127701 | 3300009545 | Bacteria | 2537 |
| 137 | Ga0105238_10169745 | 3300009551 | Bacteria | 2157 |
| 138 | Ga0105238_10417804 | 3300009551 | Bacteria | 1335 |
| 139 | Ga0105238_10661953 | 3300009551 | Bacteria | 1055 |
| 140 | Ga0105249_10000015 | 3300009553 | Bacteria | 282138 |
| 141 | Ga0105249_10028396 | 3300009553 | Bacteria | 5049 |
| 142 | Ga0105032_101076 | 3300009979 | Bacteria | 2541 |
| 143 | Ga0105239_10001092 | 3300010375 | Bacteria | 37501 |
| 144 | Ga0105239_10041475 | 3300010375 | Bacteria | 5044 |
| 145 | Ga0105239_10054456 | 3300010375 | Bacteria | 4388 |
| 146 | Ga0105239_10169198 | 3300010375 | Bacteria | 2443 |
| 147 | Ga0105239_10238031 | 3300010375 | Bacteria | 2043 |
| 148 | Ga0105246_10081279 | 3300011119 | Bacteria | 2309 |
| 149 | Ga0105246_10518216 | 3300011119 | Bacteria | 1016 |
| 150 | Ga0157320_1004295 | 3300012481 | Bacteria | 904 |
| 151 | Ga0157369_10044126 | 3300013105 | Bacteria | 4855 |
| 152 | Ga0157374_10014689 | 3300013296 | Bacteria | 6855 |
| 153 | Ga0157372_10104556 | 3300013307 | Bacteria | 3237 |
| 154 | Ga0163163_10004056 | 3300014325 | Bacteria | 12490 |
| 155 | Ga0163163_10297383 | 3300014325 | Bacteria | 1666 |
| 156 | Ga0157377_10000098 | 3300014745 | Bacteria | 62330 |
| 157 | Ga0157376_10193719 | 3300014969 | Bacteria | 1865 |
| 158 | Ga0157376_10930007 | 3300014969 | Bacteria | 889 |
| 159 | Ga0213872_10001251 | 3300021361 | Bacteria | 17114 |
| 160 | Ga0213872_10015243 | 3300021361 | Bacteria | 3577 |
| 161 | Ga0213872_10084699 | 3300021361 | Bacteria | 1421 |
| 162 | Ga0213872_10146883 | 3300021361 | Bacteria | 1032 |
| 163 | Ga0209672_101407 | 3300025228 | Bacteria | 8788 |
| 164 | Ga0209258_100447 | 3300025242 | Bacteria | 45725 |
| 165 | Ga0209148_1000438 | 3300025254 | Bacteria | 45725 |
| 166 | Ga0209455_1019625 | 3300025272 | Bacteria | 1360 |
| 167 | Ga0209130_1003726 | 3300025284 | Bacteria | 6242 |
| 168 | Ga0209676_1008257 | 3300025292 | Bacteria | 4679 |
| 169 | Ga0209758_1000698 | 3300025297 | Bacteria | 49793 |
| 170 | Ga0207426_1000215 | 3300025302 | Bacteria | 136757 |
| 171 | Ga0207656_10003294 | 3300025321 | Bacteria | 5534 |
| 172 | Ga0207710_10049082 | 3300025900 | Bacteria | 1890 |
| 173 | Ga0207647_10001327 | 3300025904 | Bacteria | 18998 |
| 174 | Ga0207645_10059917 | 3300025907 | Bacteria | 2431 |
| 175 | Ga0207645_10077640 | 3300025907 | Bacteria | 2128 |
| 176 | Ga0207643_10058623 | 3300025908 | Bacteria | 2195 |
| 177 | Ga0207695_10000520 | 3300025913 | Bacteria | 81547 |
| 178 | Ga0207695_10001752 | 3300025913 | Bacteria | 34438 |
| 179 | Ga0207695_10014966 | 3300025913 | Bacteria | 9157 |
| 180 | Ga0207695_10022447 | 3300025913 | Bacteria | 7161 |
| 181 | Ga0207695_10042746 | 3300025913 | Bacteria | 4835 |
| 182 | Ga0207695_10065145 | 3300025913 | Bacteria | 3747 |
| 183 | Ga0207671_10000026 | 3300025914 | Bacteria | 268845 |
| 184 | Ga0207671_10119440 | 3300025914 | Bacteria | 2014 |
| 185 | Ga0207657_10157735 | 3300025919 | Bacteria | 1845 |
| 186 | Ga0207694_10601416 | 3300025924 | Bacteria | 925 |
| 187 | Ga0207650_10347345 | 3300025925 | Bacteria | 1220 |
| 188 | Ga0207706_10041975 | 3300025933 | Bacteria | 4053 |
| 189 | Ga0207709_10002802 | 3300025935 | Bacteria | 10733 |
| 190 | Ga0207670_10043258 | 3300025936 | Bacteria | 2973 |
| 191 | Ga0207704_10131654 | 3300025938 | Bacteria | 1733 |
| 192 | Ga0207704_10187110 | 3300025938 | Bacteria | 1502 |
| 193 | Ga0207691_10013421 | 3300025940 | Bacteria | 7842 |
| 194 | Ga0207691_10021154 | 3300025940 | Bacteria | 6148 |
| 195 | Ga0207711_10105941 | 3300025941 | Bacteria | 2494 |
| 196 | Ga0207689_10112761 | 3300025942 | Bacteria | 2235 |
| 197 | Ga0207667_10008300 | 3300025949 | Bacteria | 12355 |
| 198 | Ga0207667_10011300 | 3300025949 | Bacteria | 10384 |
| 199 | Ga0207667_10013017 | 3300025949 | Bacteria | 9549 |
| 200 | Ga0207651_10017327 | 3300025960 | Bacteria | 4254 |
| 201 | Ga0207651_10220801 | 3300025960 | Bacteria | 1532 |
| 202 | Ga0207712_10000023 | 3300025961 | Bacteria | 282081 |
| 203 | Ga0207668_10005232 | 3300025972 | Bacteria | 7634 |
| 204 | Ga0207668_10146898 | 3300025972 | Bacteria | 1820 |
| 205 | Ga0207668_10311238 | 3300025972 | Bacteria | 1303 |
| 206 | Ga0207640_10000632 | 3300025981 | Bacteria | 20641 |
| 207 | Ga0207640_10024208 | 3300025981 | Bacteria | 3661 |
| 208 | Ga0207640_10387960 | 3300025981 | Bacteria | 1134 |
| 209 | Ga0207658_10187008 | 3300025986 | Bacteria | 1719 |
| 210 | Ga0207658_10409212 | 3300025986 | Bacteria | 1194 |
| 211 | Ga0207677_10177490 | 3300026023 | Bacteria | 1672 |
| 212 | Ga0207703_10065769 | 3300026035 | Bacteria | 2980 |
| 213 | Ga0207639_10001101 | 3300026041 | Bacteria | 18339 |
| 214 | Ga0207639_10011796 | 3300026041 | Bacteria | 6077 |
| 215 | Ga0207639_10026252 | 3300026041 | Bacteria | 4232 |
| 216 | Ga0207639_10791946 | 3300026041 | Bacteria | 883 |
| 217 | Ga0207678_10015043 | 3300026067 | Bacteria | 6808 |
| 218 | Ga0207678_10016702 | 3300026067 | Bacteria | 6446 |
| 219 | Ga0207678_10061661 | 3300026067 | Bacteria | 3225 |
| 220 | Ga0207678_10089132 | 3300026067 | Bacteria | 2637 |
| 221 | Ga0207678_10128531 | 3300026067 | Bacteria | 2161 |
| 222 | Ga0207678_10210964 | 3300026067 | Bacteria | 1661 |
| 223 | Ga0207708_10034108 | 3300026075 | Bacteria | 3870 |
| 224 | Ga0207641_10004331 | 3300026088 | Bacteria | 12321 |
| 225 | Ga0207641_10306198 | 3300026088 | Bacteria | 1502 |
| 226 | Ga0207648_10000614 | 3300026089 | Bacteria | 39971 |
| 227 | Ga0207648_10077651 | 3300026089 | Bacteria | 2895 |
| 228 | Ga0207676_10402276 | 3300026095 | Bacteria | 1280 |
| 229 | Ga0207674_10000219 | 3300026116 | Bacteria | 71283 |
| 230 | Ga0207674_10038049 | 3300026116 | Bacteria | 4999 |
| 231 | Ga0207674_10053694 | 3300026116 | Bacteria | 4106 |
| 232 | Ga0207675_100000779 | 3300026118 | Bacteria | 31810 |
| 233 | Ga0207683_10006329 | 3300026121 | Bacteria | 10139 |
| 234 | Ga0207698_10037228 | 3300026142 | Bacteria | 3581 |
| 235 | Ga0207698_10829463 | 3300026142 | Bacteria | 928 |
| 236 | Ga0209982_1006591 | 3300027552 | Bacteria | 1691 |
| 237 | Ga0209983_1005918 | 3300027665 | Bacteria | 2524 |
| 238 | Ga0209971_1021303 | 3300027682 | Bacteria | 1542 |
| 239 | Ga0209974_10038082 | 3300027876 | Bacteria | 1598 |
| 240 | Ga0207428_10002156 | 3300027907 | Bacteria | 19753 |
| 241 | Ga0207428_10127428 | 3300027907 | Bacteria | 1949 |
| 242 | Ga0268266_10051840 | 3300028379 | Bacteria | 3523 |
| 243 | Ga0268266_10123388 | 3300028379 | Bacteria | 2308 |
| 244 | Ga0268266_10161255 | 3300028379 | Bacteria | 2029 |
| 245 | Ga0268265_10000137 | 3300028380 | Bacteria | 93389 |
| 246 | Ga0268265_10000164 | 3300028380 | Bacteria | 80747 |
| 247 | Ga0268265_10000547 | 3300028380 | Bacteria | 38290 |
| 248 | Ga0268265_10296873 | 3300028380 | Bacteria | 1453 |
| 249 | Ga0268264_10000512 | 3300028381 | Bacteria | 49877 |
| 250 | Ga0268264_10459757 | 3300028381 | Bacteria | 1235 |
| 251 | Ga0265326_10029055 | 3300028558 | Bacteria | 1575 |
| 252 | Ga0265334_10013502 | 3300028573 | Bacteria | 3417 |
| 253 | Ga0307515_10124638 | 3300028794 | Bacteria | 2889 |
| 254 | Ga0265771_1000454 | 3300031010 | Bacteria | 1501 |
| 255 | Ga0265328_10014265 | 3300031239 | Bacteria | 3131 |
| 256 | Ga0265325_10227146 | 3300031241 | Bacteria | 852 |
| 257 | Ga0265340_10012538 | 3300031247 | Bacteria | 4475 |
| 258 | Ga0265327_10065703 | 3300031251 | Bacteria | 1833 |
| 259 | Ga0265316_10225457 | 3300031344 | Bacteria | 1382 |
| 260 | Ga0307513_10035922 | 3300031456 | Bacteria | 5539 |
| 261 | Ga0307509_10281710 | 3300031507 | Bacteria | 1423 |
| 262 | Ga0307408_100066320 | 3300031548 | Bacteria | 2651 |
| 263 | Ga0307408_100401281 | 3300031548 | Bacteria | 1177 |
| 264 | Ga0265313_10001342 | 3300031595 | Bacteria | 23180 |
| 265 | Ga0265313_10081976 | 3300031595 | Bacteria | 1463 |
| 266 | Ga0265314_10024772 | 3300031711 | Bacteria | 4541 |
| 267 | Ga0265314_10034063 | 3300031711 | Bacteria | 3726 |
| 268 | Ga0265314_10151443 | 3300031711 | Bacteria | 1422 |
| 269 | Ga0265342_10243142 | 3300031712 | Bacteria | 963 |
| 270 | Ga0316576_10063059 | 3300031727 | Bacteria | 2720 |
| 271 | Ga0316578_10179961 | 3300031728 | Bacteria | 1274 |
| 272 | Ga0307405_10613631 | 3300031731 | Bacteria | 889 |
| 273 | Ga0307413_10304380 | 3300031824 | Bacteria | 1210 |
| 274 | Ga0307406_10000297 | 3300031901 | Bacteria | 29339 |
| 275 | Ga0307412_10102449 | 3300031911 | Bacteria | 2027 |
| 276 | Ga0307409_100558808 | 3300031995 | Bacteria | 1125 |
| 277 | Ga0307416_100275560 | 3300032002 | Bacteria | 1655 |
| 278 | Ga0307416_100396638 | 3300032002 | Bacteria | 1416 |
| 279 | Ga0307414_10011862 | 3300032004 | Bacteria | 5132 |
| 280 | Ga0307411_10022689 | 3300032005 | Bacteria | 3701 |
| 281 | Ga0307507_10043872 | 3300033179 | Bacteria | 4430 |
| 282 | Ga0307507_10067439 | 3300033179 | Bacteria | 3272 |
| 283 | Ga0373944_0117281 | 3300035089 | Bacteria | 914 |
| 284 | Ga0316584_0218883 | 3300036712 | Bacteria | 1400 |
| 285 | Ga0316584_0259224 | 3300036712 | Bacteria | 1268 |
| 286 | Ga0395905_0220376 | 3300037471 | Bacteria | 1775 |
| 287 | Ga0436364_0011659 | 3300037853 | Bacteria | 94648 |
| 288 | Ga0237819_02473 | 3300038705 | Bacteria | 3701 |
| 289 | Ga0400483_011190 | 3300039062 | Bacteria | 182340 |
| 290 | Ga0400483_093214 | 3300039062 | Bacteria | 200340 |
| 291 | Ga0400483_215675 | 3300039062 | Bacteria | 181282 |
| 292 | Ga0400483_219863 | 3300039062 | Bacteria | 173210 |
| 293 | Ga0436361_0075622 | 3300039447 | Bacteria | 1227 |
| 294 | Ga0436361_0117668 | 3300039447 | Bacteria | 1074 |
| 295 | Ga0436361_0319126 | 3300039447 | Bacteria | 20837 |
| 296 | Ga0436361_0728505 | 3300039447 | Bacteria | 4966 |
| 297 | Ga0436361_1162608 | 3300039447 | Bacteria | 10383 |
| 298 | Ga0436362_0223885 | 3300039453 | Bacteria | 871 |
| 299 | Ga0439436_0003694 | 3300041404 | Bacteria | 4666 |
| 300 | Ga0439436_0007932 | 3300041404 | Bacteria | 3261 |
| 301 | Ga0439436_0018212 | 3300041404 | Bacteria | 2100 |
| 302 | Ga0439439_0000798 | 3300041406 | Bacteria | 5724 |
| 303 | Ga0451789_0963123 | 3300041443 | Bacteria | 981 |
| 304 | Ga0451855_0860111 | 3300041511 | Bacteria | 944 |
| 305 | Ga0451853_3855578 | 3300041512 | Bacteria | 1805 |
| 306 | Ga0439432_012052 | 3300042006 | Bacteria | 2968 |
| 307 | Ga0439432_018258 | 3300042006 | Bacteria | 2345 |
| 308 | Ga0439449_0004237 | 3300042007 | Bacteria | 5543 |
| 309 | Ga0439449_0023528 | 3300042007 | Bacteria | 2303 |
| 310 | Ga0439452_038264 | 3300042010 | Bacteria | 1140 |
| 311 | Ga0439462_0033408 | 3300042015 | Bacteria | 1364 |
| 312 | Ga0439462_0050636 | 3300042015 | Bacteria | 1116 |
| 313 | Ga0466972_0021849 | 3300044658 | Bacteria | 3188 |
| 314 | Ga0466965_0004446 | 3300044683 | Bacteria | 6235 |
| 315 | Ga0466965_0010823 | 3300044683 | Bacteria | 4267 |
| 316 | Ga0466966_0011388 | 3300044684 | Bacteria | 5899 |
| 317 | Ga0466961_0000285 | 3300044693 | Bacteria | 33498 |
| 318 | Ga0466961_0016695 | 3300044693 | Bacteria | 4720 |
| 319 | Ga0466964_0346105 | 3300044706 | Bacteria | 762 |
| 320 | Ga0453684_0001075 | 3300044712 | Bacteria | 86968 |
| 321 | Ga0466957_0102690 | 3300044842 | Bacteria | 1804 |
| 322 | Ga0466960_0041675 | 3300044901 | Bacteria | 2176 |
| 323 | Ga0466959_0003330 | 3300045049 | Bacteria | 10495 |
| 324 | Ga0466959_0078857 | 3300045049 | Bacteria | 2375 |
| 325 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 326 | Ga0466958_0133741 | 3300045836 | Bacteria | 1558 |
| 327 | Ga0466967_0795182 | 3300045976 | Bacteria | 939 |
| 328 | Ga0495590_0038893 | 3300046457 | Bacteria | 1659 |
| 329 | Ga0495641_0107650 | 3300046461 | Bacteria | 1244 |
| 330 | Ga0495580_0008442 | 3300046472 | Bacteria | 8194 |
| 331 | Ga0495605_0086601 | 3300046474 | Bacteria | 1457 |
| 332 | Ga0495605_0096692 | 3300046474 | Bacteria | 1362 |
| 333 | Ga0495594_0187165 | 3300046499 | Bacteria | 1179 |
| 334 | Ga0495583_0007674 | 3300046506 | Bacteria | 6724 |
| 335 | Ga0495606_0000859 | 3300046507 | Bacteria | 45541 |
| 336 | Ga0495616_0069696 | 3300046513 | Bacteria | 1704 |
| 337 | Ga0495648_0003754 | 3300046524 | Bacteria | 13221 |
| 338 | Ga0495648_0091954 | 3300046524 | Bacteria | 1695 |
| 339 | Ga0495666_0141598 | 3300046526 | Bacteria | 1121 |
| 340 | Ga0495622_0070668 | 3300046557 | Bacteria | 1611 |
| 341 | Ga0495634_0348646 | 3300046642 | Bacteria | 887 |
| 342 | Ga0495669_0020406 | 3300046684 | Bacteria | 2868 |
| 343 | Ga0495649_0170941 | 3300046694 | Bacteria | 1137 |
| 344 | Ga0495600_0129549 | 3300046809 | Bacteria | 1641 |
| 345 | Ga0495674_0017846 | 3300047319 | Bacteria | 6608 |
| 346 | Ga0495674_0035618 | 3300047319 | Bacteria | 4488 |
| 347 | Ga0495672_0015871 | 3300047320 | Bacteria | 5099 |
| 348 | Ga0495672_0065825 | 3300047320 | Bacteria | 2070 |
| 349 | Ga0495676_0166764 | 3300047321 | Bacteria | 1553 |
| 350 | Ga0495683_0001829 | 3300047323 | Bacteria | 13372 |
| 351 | Ga0495683_0048498 | 3300047323 | Bacteria | 2129 |
| 352 | Ga0495675_0195634 | 3300047444 | Bacteria | 1233 |
| 353 | Ga0495673_0005404 | 3300047469 | Bacteria | 7733 |
| 354 | Ga0495626_0058031 | 3300048091 | Bacteria | 1770 |
| 355 | Ga0496100_0019100 | 3300048903 | Bacteria | 4081 |
| 356 | Ga0496100_0023537 | 3300048903 | Bacteria | 3743 |
| 357 | Ga0496100_0159035 | 3300048903 | Bacteria | 1618 |
| 358 | Ga0496100_0176487 | 3300048903 | Bacteria | 1543 |
| 359 | Ga0496101_0001443 | 3300048904 | Bacteria | 14188 |
| 360 | Ga0496101_0016189 | 3300048904 | Bacteria | 5033 |
| 361 | Ga0496101_0031944 | 3300048904 | Bacteria | 3704 |
| 362 | Ga0496101_0102884 | 3300048904 | Bacteria | 2140 |
| 363 | Ga0496101_0258968 | 3300048904 | Bacteria | 1356 |
| 364 | Ga0496102_0001539 | 3300048905 | Bacteria | 20355 |
| 365 | Ga0496102_0608027 | 3300048905 | Bacteria | 1016 |
| 366 | Ga0496103_0000371 | 3300048906 | Bacteria | 40307 |
| 367 | Ga0496104_0000303 | 3300048907 | Bacteria | 43795 |
| 368 | Ga0496104_0000713 | 3300048907 | Bacteria | 28574 |
| 369 | Ga0496104_0009732 | 3300048907 | Bacteria | 8568 |
| 370 | Ga0496104_0013391 | 3300048907 | Bacteria | 7391 |
| 371 | Ga0496104_0027609 | 3300048907 | Bacteria | 5255 |
| 372 | Ga0496104_0065720 | 3300048907 | Bacteria | 3442 |
| 373 | Ga0496105_0000554 | 3300048908 | Bacteria | 24707 |
| 374 | Ga0496105_0000693 | 3300048908 | Bacteria | 22693 |
| 375 | Ga0496105_0001496 | 3300048908 | Bacteria | 16513 |
| 376 | Ga0496105_0002549 | 3300048908 | Bacteria | 13221 |
| 377 | Ga0496105_0018364 | 3300048908 | Bacteria | 5618 |
| 378 | Ga0496105_0070818 | 3300048908 | Bacteria | 2882 |
| 379 | Ga0496106_0046413 | 3300048909 | Bacteria | 3266 |
| 380 | Ga0496106_0376745 | 3300048909 | Bacteria | 1140 |
| 381 | Ga0496107_0021284 | 3300048910 | Bacteria | 4584 |
| 382 | Ga0496107_0361471 | 3300048910 | Bacteria | 1080 |
| 383 | Ga0496108_0011366 | 3300048911 | Bacteria | 7235 |
| 384 | Ga0496108_0719938 | 3300048911 | Bacteria | 865 |
| 385 | Ga0496109_0001233 | 3300048912 | Bacteria | 21242 |
| 386 | Ga0496110_0027242 | 3300048913 | Bacteria | 4898 |
| 387 | Ga0496110_0067115 | 3300048913 | Bacteria | 3173 |
| 388 | Ga0496110_0398166 | 3300048913 | Bacteria | 1255 |
| 389 | Ga0496111_0000819 | 3300048914 | Bacteria | 16705 |
| 390 | Ga0496111_0088629 | 3300048914 | Bacteria | 2266 |
| 391 | Ga0496112_0002425 | 3300048915 | Bacteria | 15010 |
| 392 | Ga0496112_0028185 | 3300048915 | Bacteria | 5418 |
| 393 | Ga0496112_0237324 | 3300048915 | Bacteria | 1777 |
| 394 | Ga0496112_0405711 | 3300048915 | Bacteria | 1302 |
| 395 | Ga0496113_0000636 | 3300048916 | Bacteria | 17648 |
| 396 | Ga0496113_0006616 | 3300048916 | Bacteria | 7371 |
| 397 | Ga0496113_0042470 | 3300048916 | Bacteria | 3360 |
| 398 | Ga0496114_0117756 | 3300048917 | Bacteria | 2282 |
| 399 | Ga0496115_0019682 | 3300048918 | Bacteria | 5197 |
| 400 | Ga0496115_0027822 | 3300048918 | Bacteria | 4426 |
| 401 | Ga0496115_0038542 | 3300048918 | Bacteria | 3792 |
| 402 | Ga0496115_0174178 | 3300048918 | Bacteria | 1779 |
| 403 | Ga0496117_0002705 | 3300048920 | Bacteria | 21898 |
| 404 | Ga0496117_0103635 | 3300048920 | Bacteria | 1792 |
| 405 | Ga0496118_0000698 | 3300048921 | Bacteria | 54435 |
| 406 | Ga0496118_0006725 | 3300048921 | Bacteria | 12529 |
| 407 | Ga0496118_0010118 | 3300048921 | Bacteria | 9376 |
| 408 | Ga0496119_0002149 | 3300048922 | Bacteria | 22159 |
| 409 | Ga0496119_0023633 | 3300048922 | Bacteria | 4350 |
| 410 | Ga0496119_0035658 | 3300048922 | Bacteria | 3256 |
| 411 | Ga0496119_0046469 | 3300048922 | Bacteria | 2711 |
| 412 | Ga0496119_0121233 | 3300048922 | Bacteria | 1437 |
| 413 | Ga0496120_0000505 | 3300048923 | Bacteria | 60875 |
| 414 | Ga0496120_0009890 | 3300048923 | Bacteria | 6717 |
| 415 | Ga0496120_0177986 | 3300048923 | Bacteria | 1047 |
| 416 | Ga0496120_0184684 | 3300048923 | Bacteria | 1021 |
| 417 | Ga0496121_0001198 | 3300048924 | Bacteria | 45422 |
| 418 | Ga0496121_0001778 | 3300048924 | Bacteria | 34958 |
| 419 | Ga0496121_0010022 | 3300048924 | Bacteria | 10765 |
| 420 | Ga0496121_0032282 | 3300048924 | Bacteria | 4764 |
| 421 | Ga0496121_0222220 | 3300048924 | Bacteria | 1329 |
| 422 | Ga0496122_0132861 | 3300048925 | Bacteria | 1577 |
| 423 | Ga0496125_0025836 | 3300048928 | Bacteria | 5368 |
| 424 | Ga0496126_0003502 | 3300048929 | Bacteria | 19805 |
| 425 | Ga0496126_0233298 | 3300048929 | Bacteria | 1541 |
| 426 | Ga0495682_0001483 | 3300049460 | Bacteria | 12534 |
| 427 | Ga0495682_0003355 | 3300049460 | Bacteria | 7146 |
| 428 | Ga0501300_012312 | 3300049523 | Bacteria | 1247 |
| 429 | Ga0501031_0002340 | 3300049568 | Bacteria | 12000 |
| 430 | Ga0501031_0004589 | 3300049568 | Bacteria | 8956 |
| 431 | Ga0501032_0098654 | 3300049569 | Bacteria | 1935 |
| 432 | Ga0501032_0121509 | 3300049569 | Bacteria | 1726 |
| 433 | Ga0501033_0050319 | 3300049570 | Bacteria | 3091 |
| 434 | Ga0501033_0081465 | 3300049570 | Bacteria | 2374 |
| 435 | Ga0501033_0409128 | 3300049570 | Bacteria | 945 |
| 436 | Ga0501034_0002289 | 3300049571 | Bacteria | 23506 |
| 437 | Ga0501034_0386157 | 3300049571 | Bacteria | 1324 |
| 438 | Ga0501034_0414282 | 3300049571 | Bacteria | 1269 |
| 439 | Ga0501036_0070548 | 3300049572 | Bacteria | 2954 |
| 440 | Ga0501036_0084941 | 3300049572 | Bacteria | 2676 |
| 441 | Ga0501036_0581690 | 3300049572 | Bacteria | 930 |
| 442 | Ga0501037_0024859 | 3300049573 | Bacteria | 4428 |
| 443 | Ga0501037_0034349 | 3300049573 | Bacteria | 3741 |
| 444 | Ga0501037_0120426 | 3300049573 | Bacteria | 1887 |
| 445 | Ga0501037_0241413 | 3300049573 | Bacteria | 1266 |
| 446 | Ga0501038_0006839 | 3300049574 | Bacteria | 10535 |
| 447 | Ga0501038_0025833 | 3300049574 | Bacteria | 5232 |
| 448 | Ga0501039_0002455 | 3300049575 | Bacteria | 13802 |
| 449 | Ga0501039_0019269 | 3300049575 | Bacteria | 5232 |
| 450 | Ga0501039_0054822 | 3300049575 | Bacteria | 3086 |
| 451 | Ga0501040_0001281 | 3300049576 | Bacteria | 15982 |
| 452 | Ga0501040_0031172 | 3300049576 | Bacteria | 3601 |
| 453 | Ga0501040_0165056 | 3300049576 | Bacteria | 1566 |
| 454 | Ga0501041_0000998 | 3300049577 | Bacteria | 15459 |
| 455 | Ga0501042_0004027 | 3300049578 | Bacteria | 9310 |
| 456 | Ga0501042_0011146 | 3300049578 | Bacteria | 6057 |
| 457 | Ga0501042_0292046 | 3300049578 | Bacteria | 1177 |
| 458 | Ga0501043_0137534 | 3300049579 | Bacteria | 1913 |
| 459 | Ga0501046_0028278 | 3300049580 | Bacteria | 4567 |
| 460 | Ga0501046_0129870 | 3300049580 | Bacteria | 1911 |
| 461 | Ga0501047_0102039 | 3300049581 | Bacteria | 2748 |
| 462 | Ga0501048_0005038 | 3300049582 | Bacteria | 10071 |
| 463 | Ga0501048_0034694 | 3300049582 | Bacteria | 3637 |
| 464 | Ga0501048_0047128 | 3300049582 | Bacteria | 3075 |
| 465 | Ga0501067_0049349 | 3300049583 | Bacteria | 2332 |
| 466 | Ga0501068_0014546 | 3300049584 | Bacteria | 4500 |
| 467 | Ga0501069_0000759 | 3300049585 | Bacteria | 15083 |
| 468 | Ga0501070_0050193 | 3300049586 | Bacteria | 3463 |
| 469 | Ga0501070_0140373 | 3300049586 | Bacteria | 1995 |
| 470 | Ga0501071_0004084 | 3300049587 | Bacteria | 9226 |
| 471 | Ga0501071_0115109 | 3300049587 | Bacteria | 1989 |
| 472 | Ga0501071_0283615 | 3300049587 | Bacteria | 1253 |
| 473 | Ga0501072_0002683 | 3300049588 | Bacteria | 13352 |
| 474 | Ga0501072_0175911 | 3300049588 | Bacteria | 1707 |
| 475 | Ga0501072_0312678 | 3300049588 | Bacteria | 1248 |
| 476 | Ga0501073_0013314 | 3300049589 | Bacteria | 5989 |
| 477 | Ga0501073_0042629 | 3300049589 | Bacteria | 3202 |
| 478 | Ga0501073_0054648 | 3300049589 | Bacteria | 2795 |
| 479 | Ga0501073_0227307 | 3300049589 | Bacteria | 1289 |
| 480 | Ga0501074_0006764 | 3300049590 | Bacteria | 8275 |
| 481 | Ga0501074_0031514 | 3300049590 | Bacteria | 3840 |
| 482 | Ga0501074_0061768 | 3300049590 | Bacteria | 2699 |
| 483 | Ga0501075_0000491 | 3300049591 | Bacteria | 23672 |
| 484 | Ga0501075_0159507 | 3300049591 | Bacteria | 1720 |
| 485 | Ga0501076_0002706 | 3300049592 | Bacteria | 12252 |
| 486 | Ga0501076_0122088 | 3300049592 | Bacteria | 2109 |
| 487 | Ga0501076_0131973 | 3300049592 | Bacteria | 2026 |
| 488 | Ga0501077_0004253 | 3300049593 | Bacteria | 8652 |
| 489 | Ga0501077_0103344 | 3300049593 | Bacteria | 1805 |
| 490 | Ga0501239_002223 | 3300049672 | Bacteria | 1745 |
| 491 | Ga0501079_0012112 | 3300049741 | Bacteria | 6583 |
| 492 | Ga0501080_0019681 | 3300049742 | Bacteria | 6251 |
| 493 | Ga0501080_0064742 | 3300049742 | Bacteria | 3400 |
| 494 | Ga0501080_0186262 | 3300049742 | Bacteria | 1908 |
| 495 | Ga0501080_0187500 | 3300049742 | Bacteria | 1902 |
| 496 | Ga0501080_0374699 | 3300049742 | Bacteria | 1283 |
| 497 | Ga0501081_0001389 | 3300049743 | Bacteria | 14771 |
| 498 | Ga0501083_0002183 | 3300049744 | Bacteria | 13384 |
| 499 | Ga0501083_0003882 | 3300049744 | Bacteria | 10497 |
| 500 | Ga0501083_0014533 | 3300049744 | Bacteria | 5505 |
| 501 | Ga0501083_0241490 | 3300049744 | Bacteria | 1176 |
| 502 | Ga0501241_046467 | 3300049758 | Bacteria | 851 |
| 503 | Ga0501280_001227 | 3300049776 | Bacteria | 5001 |
| 504 | Ga0501282_001588 | 3300049778 | Bacteria | 2516 |
| 505 | Ga0501035_0006601 | 3300049822 | Bacteria | 10862 |
| 506 | Ga0501035_0027804 | 3300049822 | Bacteria | 5169 |
| 507 | Ga0501035_0112301 | 3300049822 | Bacteria | 2387 |
| 508 | Ga0501035_0144195 | 3300049822 | Bacteria | 2069 |
| 509 | Ga0501044_0001614 | 3300049823 | Bacteria | 26409 |
| 510 | Ga0501044_0007794 | 3300049823 | Bacteria | 11770 |
| 511 | Ga0501044_0021241 | 3300049823 | Bacteria | 6930 |
| 512 | Ga0501044_0043349 | 3300049823 | Bacteria | 4674 |
| 513 | Ga0501044_0418010 | 3300049823 | Bacteria | 1251 |
| 514 | Ga0501045_0011691 | 3300049824 | Bacteria | 6165 |
| 515 | nmdc:mga0k408_76839_c1 | 3300050493 | Bacteria | 1952 |
| 516 | nmdc:mga05p37_3848_c1 | 3300050507 | Bacteria | 15141 |
| 517 | nmdc:mga05p37_429170_c1 | 3300050507 | Bacteria | 1536 |
| 518 | nmdc:mga05p37_586549_c1 | 3300050507 | Bacteria | 1261 |
| 519 | nmdc:mga05p37_6663_c1 | 3300050507 | Bacteria | 13628 |
| 520 | nmdc:mga09592_16048_c1 | 3300050508 | Bacteria | 6123 |
| 521 | nmdc:mga09592_29529_c1 | 3300050508 | Bacteria | 4559 |
| 522 | nmdc:mga09592_755_c1 | 3300050508 | Bacteria | 24846 |
| 523 | nmdc:mga0qj67_10964_c1 | 3300050509 | Bacteria | 6783 |
| 524 | nmdc:mga0qj67_741_c1 | 3300050509 | Bacteria | 22140 |
| 525 | nmdc:mga06r32_2020_c1 | 3300050510 | Bacteria | 18156 |
| 526 | nmdc:mga06r32_331256_c1 | 3300050510 | Bacteria | 1507 |
| 527 | nmdc:mga06r32_45332_c1 | 3300050510 | Bacteria | 4191 |
| 528 | nmdc:mga06r32_63_c1 | 3300050510 | Bacteria | 68165 |
| 529 | nmdc:mga08y16_254_c1 | 3300050511 | Bacteria | 48008 |
| 530 | nmdc:mga08y16_57862_c1 | 3300050511 | Bacteria | 4050 |
| 531 | Ga0495601_0355123 | 3300053077 | Bacteria | 953 |
| 532 | Ga0495619_0019882 | 3300053085 | Bacteria | 4274 |
| 533 | Ga0500643_054119 | 3300053087 | Bacteria | 1140 |
| 534 | Ga0500583_0004078 | 3300053092 | Bacteria | 4705 |
| 535 | Ga0500597_027597 | 3300053120 | Bacteria | 2308 |
| 536 | Ga0500652_089760 | 3300053131 | Bacteria | 1283 |
| 537 | Ga0500559_0011170 | 3300053136 | Bacteria | 3841 |
| 538 | Ga0500568_0000435 | 3300053139 | Bacteria | 31407 |
| 539 | Ga0500573_0000016 | 3300053140 | Bacteria | 182675 |
| 540 | Ga0500622_0007927 | 3300053156 | Bacteria | 5980 |
| 541 | Ga0500624_000043 | 3300053157 | Bacteria | 90095 |
| 542 | Ga0500637_0000089 | 3300053178 | Bacteria | 32896 |
| 543 | Ga0501084_0003070 | 3300054114 | Bacteria | 13530 |
| 544 | Ga0501084_0005932 | 3300054114 | Bacteria | 10059 |
| 545 | Ga0501084_0088532 | 3300054114 | Bacteria | 2599 |
| 546 | Ga0501082_0004147 | 3300060353 | Bacteria | 12666 |
| 547 | Ga0501082_0006298 | 3300060353 | Bacteria | 10291 |
| 548 | Ga0501082_0112190 | 3300060353 | Bacteria | 2360 |
| 549 | Ga0530510_0002822 | 3300061734 | Bacteria | 11948 |
| 550 | Ga0530510_0095604 | 3300061734 | Bacteria | 2171 |
| 551 | Ga0530510_0395219 | 3300061734 | Bacteria | 1041 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041511 | Ga0451855_0860111 | Ga0451855_0860111_54_638 | 175 |
| 2 | 3300049672 | Ga0501239_002223 | Ga0501239_002223_1042_1734 | 200 |
| 3 | 3300053140 | Ga0500573_0000016 | Ga0500573_0000016_87981_88628 | 215 |
| 4 | 3300005328 | Ga0070676_10052441 | Ga0070676_100524412 | 217 |
| 5 | 3300005337 | Ga0070682_100499447 | Ga0070682_1004994471 | 217 |
| 6 | 3300005339 | Ga0070660_100162258 | Ga0070660_1001622581 | 217 |
| 7 | 3300005347 | Ga0070668_100066227 | Ga0070668_1000662273 | 217 |
| 8 | 3300005353 | Ga0070669_100063099 | Ga0070669_1000630993 | 217 |
| 9 | 3300005441 | Ga0070700_100047517 | Ga0070700_1000475172 | 217 |
| 10 | 3300005455 | Ga0070663_100317809 | Ga0070663_1003178092 | 217 |
| 11 | 3300005457 | Ga0070662_100048167 | Ga0070662_1000481672 | 217 |
| 12 | 3300005543 | Ga0070672_100286340 | Ga0070672_1002863402 | 217 |
| 13 | 3300005719 | Ga0068861_100015016 | Ga0068861_1000150162 | 217 |
| 14 | 3300005844 | Ga0068862_100000722 | Ga0068862_10000072220 | 217 |
| 15 | 3300006844 | Ga0075428_100007767 | Ga0075428_1000077676 | 217 |
| 16 | 3300006846 | Ga0075430_100000458 | Ga0075430_10000045811 | 217 |
| 17 | 3300006846 | Ga0075430_100011525 | Ga0075430_1000115253 | 217 |
| 18 | 3300006847 | Ga0075431_100000243 | Ga0075431_10000024313 | 217 |
| 19 | 3300006847 | Ga0075431_100000267 | Ga0075431_10000026720 | 217 |
| 20 | 3300006847 | Ga0075431_100003216 | Ga0075431_10000321610 | 217 |
| 21 | 3300006880 | Ga0075429_100000445 | Ga0075429_10000044511 | 217 |
| 22 | 3300006880 | Ga0075429_100001924 | Ga0075429_1000019249 | 217 |
| 23 | 3300006880 | Ga0075429_100341034 | Ga0075429_1003410342 | 217 |
| 24 | 3300006881 | Ga0068865_100245651 | Ga0068865_1002456512 | 217 |
| 25 | 3300009094 | Ga0111539_10000989 | Ga0111539_1000098919 | 217 |
| 26 | 3300009094 | Ga0111539_10041545 | Ga0111539_100415454 | 217 |
| 27 | 3300009147 | Ga0114129_10001320 | Ga0114129_1000132012 | 217 |
| 28 | 3300009147 | Ga0114129_10029160 | Ga0114129_100291609 | 217 |
| 29 | 3300009147 | Ga0114129_10279423 | Ga0114129_102794232 | 217 |
| 30 | 3300010375 | Ga0105239_10238031 | Ga0105239_102380313 | 217 |
| 31 | 3300011119 | Ga0105246_10081279 | Ga0105246_100812792 | 217 |
| 32 | 3300025907 | Ga0207645_10059917 | Ga0207645_100599172 | 217 |
| 33 | 3300025919 | Ga0207657_10157735 | Ga0207657_101577352 | 217 |
| 34 | 3300025933 | Ga0207706_10041975 | Ga0207706_100419752 | 217 |
| 35 | 3300025938 | Ga0207704_10187110 | Ga0207704_101871102 | 217 |
| 36 | 3300025972 | Ga0207668_10005232 | Ga0207668_100052323 | 217 |
| 37 | 3300025981 | Ga0207640_10387960 | Ga0207640_103879601 | 217 |
| 38 | 3300026067 | Ga0207678_10210964 | Ga0207678_102109641 | 217 |
| 39 | 3300026075 | Ga0207708_10034108 | Ga0207708_100341083 | 217 |
| 40 | 3300026118 | Ga0207675_100000779 | Ga0207675_1000007798 | 217 |
| 41 | 3300027907 | Ga0207428_10002156 | Ga0207428_100021563 | 217 |
| 42 | 3300027907 | Ga0207428_10127428 | Ga0207428_101274282 | 217 |
| 43 | 3300028380 | Ga0268265_10000547 | Ga0268265_1000054720 | 217 |
| 44 | 3300032002 | Ga0307416_100275560 | Ga0307416_1002755602 | 217 |
| 45 | 3300050507 | nmdc:mga05p37_3848_c1 | nmdc:mga05p37_3848_c1_12236_12901 | 217 |
| 46 | 3300050507 | nmdc:mga05p37_586549_c1 | nmdc:mga05p37_586549_c1_393_1103 | 217 |
| 47 | 3300050507 | nmdc:mga05p37_6663_c1 | nmdc:mga05p37_6663_c1_5699_6364 | 217 |
| 48 | 3300050508 | nmdc:mga09592_16048_c1 | nmdc:mga09592_16048_c1_4437_5102 | 217 |
| 49 | 3300050508 | nmdc:mga09592_755_c1 | nmdc:mga09592_755_c1_9498_10163 | 217 |
| 50 | 3300050509 | nmdc:mga0qj67_741_c1 | nmdc:mga0qj67_741_c1_3148_3813 | 217 |
| 51 | 3300050510 | nmdc:mga06r32_2020_c1 | nmdc:mga06r32_2020_c1_5090_5755 | 217 |
| 52 | 3300050510 | nmdc:mga06r32_331256_c1 | nmdc:mga06r32_331256_c1_548_1213 | 217 |
| 53 | 3300050510 | nmdc:mga06r32_45332_c1 | nmdc:mga06r32_45332_c1_2816_3481 | 217 |
| 54 | 3300050510 | nmdc:mga06r32_63_c1 | nmdc:mga06r32_63_c1_42614_43279 | 217 |
| 55 | 3300050511 | nmdc:mga08y16_254_c1 | nmdc:mga08y16_254_c1_6045_6710 | 217 |
| 56 | 3300050511 | nmdc:mga08y16_57862_c1 | nmdc:mga08y16_57862_c1_1663_2328 | 217 |
| 57 | 3300044712 | Ga0453684_0001075 | Ga0453684_0001075_28231_28911 | 219 |
| 58 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_57817_58497 | 219 |
| 59 | iso_pu_bacteria | 2939631187 | 2939633067 | 219 |
| 60 | 3300005577 | Ga0068857_100055534 | Ga0068857_1000555344 | 220 |
| 61 | 3300003354 | JGI25160J50197_1000208 | JGI25160J50197_100020812 | 222 |
| 62 | 3300005262 | Ga0065165_1000119 | Ga0065165_10001199 | 222 |
| 63 | 3300005455 | Ga0070663_100102577 | Ga0070663_1001025773 | 222 |
| 64 | 3300005616 | Ga0068852_100297830 | Ga0068852_1002978302 | 222 |
| 65 | 3300025284 | Ga0209130_1003726 | Ga0209130_10037262 | 222 |
| 66 | 3300025302 | Ga0207426_1000215 | Ga0207426_100021510 | 222 |
| 67 | 3300026067 | Ga0207678_10128531 | Ga0207678_101285311 | 222 |
| 68 | 3300031595 | Ga0265313_10081976 | Ga0265313_100819761 | 222 |
| 69 | 3300046457 | Ga0495590_0038893 | Ga0495590_0038893_926_1630 | 222 |
| 70 | 3300046472 | Ga0495580_0008442 | Ga0495580_0008442_232_1041 | 222 |
| 71 | 3300046474 | Ga0495605_0086601 | Ga0495605_0086601_672_1376 | 222 |
| 72 | 3300046474 | Ga0495605_0096692 | Ga0495605_0096692_112_888 | 222 |
| 73 | 3300046506 | Ga0495583_0007674 | Ga0495583_0007674_1297_2073 | 222 |
| 74 | 3300046513 | Ga0495616_0069696 | Ga0495616_0069696_632_1441 | 222 |
| 75 | 3300046524 | Ga0495648_0003754 | Ga0495648_0003754_1523_2299 | 222 |
| 76 | 3300046524 | Ga0495648_0091954 | Ga0495648_0091954_572_1381 | 222 |
| 77 | 3300046526 | Ga0495666_0141598 | Ga0495666_0141598_39_848 | 222 |
| 78 | 3300046557 | Ga0495622_0070668 | Ga0495622_0070668_765_1541 | 222 |
| 79 | 3300046684 | Ga0495669_0020406 | Ga0495669_0020406_1774_2478 | 222 |
| 80 | 3300046694 | Ga0495649_0170941 | Ga0495649_0170941_61_837 | 222 |
| 81 | 3300047319 | Ga0495674_0017846 | Ga0495674_0017846_2514_3323 | 222 |
| 82 | 3300047319 | Ga0495674_0035618 | Ga0495674_0035618_1516_2292 | 222 |
| 83 | 3300047320 | Ga0495672_0015871 | Ga0495672_0015871_27_836 | 222 |
| 84 | 3300047323 | Ga0495683_0001829 | Ga0495683_0001829_1621_2397 | 222 |
| 85 | 3300047323 | Ga0495683_0048498 | Ga0495683_0048498_169_978 | 222 |
| 86 | 3300047469 | Ga0495673_0005404 | Ga0495673_0005404_5379_6188 | 222 |
| 87 | 3300048091 | Ga0495626_0058031 | Ga0495626_0058031_290_1099 | 222 |
| 88 | 3300048903 | Ga0496100_0019100 | Ga0496100_0019100_1329_2138 | 222 |
| 89 | 3300048903 | Ga0496100_0023537 | Ga0496100_0023537_1269_2045 | 222 |
| 90 | 3300048903 | Ga0496100_0159035 | Ga0496100_0159035_626_1435 | 222 |
| 91 | 3300048904 | Ga0496101_0001443 | Ga0496101_0001443_2791_3600 | 222 |
| 92 | 3300048904 | Ga0496101_0102884 | Ga0496101_0102884_215_991 | 222 |
| 93 | 3300048904 | Ga0496101_0258968 | Ga0496101_0258968_378_1187 | 222 |
| 94 | 3300048905 | Ga0496102_0001539 | Ga0496102_0001539_17203_18012 | 222 |
| 95 | 3300048906 | Ga0496103_0000371 | Ga0496103_0000371_35301_36110 | 222 |
| 96 | 3300048907 | Ga0496104_0013391 | Ga0496104_0013391_3346_4155 | 222 |
| 97 | 3300048907 | Ga0496104_0065720 | Ga0496104_0065720_1814_2623 | 222 |
| 98 | 3300048908 | Ga0496105_0018364 | Ga0496105_0018364_1700_2476 | 222 |
| 99 | 3300048908 | Ga0496105_0070818 | Ga0496105_0070818_1691_2500 | 222 |
| 100 | 3300048909 | Ga0496106_0046413 | Ga0496106_0046413_902_1678 | 222 |
| 101 | 3300048909 | Ga0496106_0376745 | Ga0496106_0376745_310_1041 | 222 |
| 102 | 3300048910 | Ga0496107_0361471 | Ga0496107_0361471_228_1004 | 222 |
| 103 | 3300048913 | Ga0496110_0398166 | Ga0496110_0398166_191_967 | 222 |
| 104 | 3300048915 | Ga0496112_0028185 | Ga0496112_0028185_4316_5125 | 222 |
| 105 | 3300048915 | Ga0496112_0237324 | Ga0496112_0237324_379_1188 | 222 |
| 106 | 3300048915 | Ga0496112_0405711 | Ga0496112_0405711_330_1106 | 222 |
| 107 | 3300048916 | Ga0496113_0006616 | Ga0496113_0006616_225_1001 | 222 |
| 108 | 3300048916 | Ga0496113_0042470 | Ga0496113_0042470_438_1142 | 222 |
| 109 | 3300048918 | Ga0496115_0174178 | Ga0496115_0174178_450_1259 | 222 |
| 110 | 3300048920 | Ga0496117_0002705 | Ga0496117_0002705_17203_18012 | 222 |
| 111 | 3300048921 | Ga0496118_0000698 | Ga0496118_0000698_17203_18012 | 222 |
| 112 | 3300048922 | Ga0496119_0023633 | Ga0496119_0023633_1533_2342 | 222 |
| 113 | 3300048922 | Ga0496119_0035658 | Ga0496119_0035658_177_986 | 222 |
| 114 | 3300048922 | Ga0496119_0121233 | Ga0496119_0121233_53_757 | 222 |
| 115 | 3300048923 | Ga0496120_0177986 | Ga0496120_0177986_47_856 | 222 |
| 116 | 3300048923 | Ga0496120_0184684 | Ga0496120_0184684_220_954 | 222 |
| 117 | 3300048924 | Ga0496121_0001198 | Ga0496121_0001198_17203_18012 | 222 |
| 118 | 3300048924 | Ga0496121_0001778 | Ga0496121_0001778_22670_23479 | 222 |
| 119 | 3300048925 | Ga0496122_0132861 | Ga0496122_0132861_168_977 | 222 |
| 120 | 3300048929 | Ga0496126_0233298 | Ga0496126_0233298_179_910 | 222 |
| 121 | 3300049460 | Ga0495682_0001483 | Ga0495682_0001483_9272_10048 | 222 |
| 122 | 3300049460 | Ga0495682_0003355 | Ga0495682_0003355_6181_6990 | 222 |
| 123 | 3300053136 | Ga0500559_0011170 | Ga0500559_0011170_2492_3190 | 222 |
| 124 | iso_pu_bacteria | 2562617112 | 2563063185 | 222 |
| 125 | iso_pu_bacteria | 2562617112 | 2563065059 | 222 |
| 126 | iso_pu_bacteria | 2711768613 | 2713477393 | 222 |
| 127 | iso_pu_bacteria | 2711768613 | 2713481953 | 222 |
| 128 | iso_pu_bacteria | 2921643360 | 2921645198 | 222 |
| 129 | 3300005288 | Ga0065714_10064584 | Ga0065714_1006458412 | 223 |
| 130 | 3300005471 | Ga0070698_100229368 | Ga0070698_1002293682 | 223 |
| 131 | 3300028794 | Ga0307515_10124638 | Ga0307515_101246382 | 223 |
| 132 | 3300046507 | Ga0495606_0000859 | Ga0495606_0000859_8487_9167 | 223 |
| 133 | 3300053156 | Ga0500622_0007927 | Ga0500622_0007927_2121_2801 | 223 |
| 134 | 3300031727 | Ga0316576_10063059 | Ga0316576_100630593 | 224 |
| 135 | 3300031728 | Ga0316578_10179961 | Ga0316578_101799612 | 224 |
| 136 | 3300036712 | Ga0316584_0218883 | Ga0316584_0218883_429_1109 | 224 |
| 137 | 3300036712 | Ga0316584_0259224 | Ga0316584_0259224_119_799 | 224 |
| 138 | iso_pu_bacteria | 2643221560 | 2643820808 | 224 |
| 139 | 3300003320 | rootH2_10040930 | rootH2_100409307 | 225 |
| 140 | 3300005329 | Ga0070683_100520267 | Ga0070683_1005202672 | 225 |
| 141 | 3300005455 | Ga0070663_100047590 | Ga0070663_1000475902 | 225 |
| 142 | 3300005458 | Ga0070681_10040601 | Ga0070681_100406016 | 225 |
| 143 | 3300005539 | Ga0068853_100012222 | Ga0068853_1000122227 | 225 |
| 144 | 3300005563 | Ga0068855_100232030 | Ga0068855_1002320302 | 225 |
| 145 | 3300005577 | Ga0068857_100018771 | Ga0068857_1000187717 | 225 |
| 146 | 3300026041 | Ga0207639_10026252 | Ga0207639_100262523 | 225 |
| 147 | 3300026116 | Ga0207674_10053694 | Ga0207674_100536947 | 225 |
| 148 | 3300031344 | Ga0265316_10225457 | Ga0265316_102254572 | 226 |
| 149 | 3300047320 | Ga0495672_0065825 | Ga0495672_0065825_965_1657 | 226 |
| 150 | 3300053120 | Ga0500597_027597 | Ga0500597_027597_19_705 | 226 |
| 151 | 3300053157 | Ga0500624_000043 | Ga0500624_000043_67950_68636 | 226 |
| 152 | 3300053178 | Ga0500637_0000089 | Ga0500637_0000089_7633_8319 | 226 |
| 153 | iso_pu_bacteria | 2643221559 | 2643816959 | 226 |
| 154 | iso_pu_bacteria | 2643221573 | 2643881244 | 226 |
| 155 | iso_pu_bacteria | 2643221586 | 2643939381 | 226 |
| 156 | iso_pu_bacteria | 2643221612 | 2644078062 | 226 |
| 157 | iso_pu_bacteria | 2643221695 | 2644528590 | 226 |
| 158 | iso_pu_bacteria | 2643221720 | 2644662017 | 226 |
| 159 | iso_pu_bacteria | 2643221727 | 2644696363 | 226 |
| 160 | iso_pu_bacteria | 2643221728 | 2644700155 | 226 |
| 161 | 3300005328 | Ga0070676_10090935 | Ga0070676_100909352 | 227 |
| 162 | 3300005331 | Ga0070670_100449375 | Ga0070670_1004493752 | 227 |
| 163 | 3300005334 | Ga0068869_100129853 | Ga0068869_1001298532 | 227 |
| 164 | 3300005335 | Ga0070666_10089653 | Ga0070666_100896533 | 227 |
| 165 | 3300005338 | Ga0068868_100105906 | Ga0068868_1001059062 | 227 |
| 166 | 3300005340 | Ga0070689_100066378 | Ga0070689_1000663781 | 227 |
| 167 | 3300005347 | Ga0070668_100075258 | Ga0070668_1000752582 | 227 |
| 168 | 3300005353 | Ga0070669_100063183 | Ga0070669_1000631832 | 227 |
| 169 | 3300005354 | Ga0070675_100063084 | Ga0070675_1000630842 | 227 |
| 170 | 3300005364 | Ga0070673_100085091 | Ga0070673_1000850913 | 227 |
| 171 | 3300005456 | Ga0070678_100183402 | Ga0070678_1001834022 | 227 |
| 172 | 3300005543 | Ga0070672_100093733 | Ga0070672_1000937333 | 227 |
| 173 | 3300005548 | Ga0070665_100259614 | Ga0070665_1002596142 | 227 |
| 174 | 3300005840 | Ga0068870_10021051 | Ga0068870_100210514 | 227 |
| 175 | 3300005841 | Ga0068863_100005629 | Ga0068863_1000056293 | 227 |
| 176 | 3300005843 | Ga0068860_100287451 | Ga0068860_1002874512 | 227 |
| 177 | 3300005844 | Ga0068862_100001530 | Ga0068862_1000015307 | 227 |
| 178 | 3300006358 | Ga0068871_100629097 | Ga0068871_1006290971 | 227 |
| 179 | 3300006881 | Ga0068865_100008801 | Ga0068865_1000088012 | 227 |
| 180 | 3300009101 | Ga0105247_10074639 | Ga0105247_100746392 | 227 |
| 181 | 3300009553 | Ga0105249_10000015 | Ga0105249_1000001546 | 227 |
| 182 | 3300011119 | Ga0105246_10518216 | Ga0105246_105182162 | 227 |
| 183 | 3300014969 | Ga0157376_10930007 | Ga0157376_109300071 | 227 |
| 184 | 3300025900 | Ga0207710_10049082 | Ga0207710_100490822 | 227 |
| 185 | 3300025907 | Ga0207645_10077640 | Ga0207645_100776402 | 227 |
| 186 | 3300025908 | Ga0207643_10058623 | Ga0207643_100586232 | 227 |
| 187 | 3300025925 | Ga0207650_10347345 | Ga0207650_103473451 | 227 |
| 188 | 3300025936 | Ga0207670_10043258 | Ga0207670_100432583 | 227 |
| 189 | 3300025938 | Ga0207704_10131654 | Ga0207704_101316542 | 227 |
| 190 | 3300025940 | Ga0207691_10013421 | Ga0207691_100134217 | 227 |
| 191 | 3300025942 | Ga0207689_10112761 | Ga0207689_101127612 | 227 |
| 192 | 3300025960 | Ga0207651_10017327 | Ga0207651_100173272 | 227 |
| 193 | 3300025961 | Ga0207712_10000023 | Ga0207712_10000023239 | 227 |
| 194 | 3300025972 | Ga0207668_10146898 | Ga0207668_101468982 | 227 |
| 195 | 3300026023 | Ga0207677_10177490 | Ga0207677_101774902 | 227 |
| 196 | 3300026088 | Ga0207641_10004331 | Ga0207641_100043319 | 227 |
| 197 | 3300026089 | Ga0207648_10077651 | Ga0207648_100776512 | 227 |
| 198 | 3300026121 | Ga0207683_10006329 | Ga0207683_100063298 | 227 |
| 199 | 3300028380 | Ga0268265_10000164 | Ga0268265_100001646 | 227 |
| 200 | 3300028381 | Ga0268264_10000512 | Ga0268264_100005122 | 227 |
| 201 | 3300031251 | Ga0265327_10065703 | Ga0265327_100657032 | 227 |
| 202 | 3300031456 | Ga0307513_10035922 | Ga0307513_100359224 | 227 |
| 203 | 3300039062 | Ga0400483_011190 | Ga0400483_011190_99972_100667 | 227 |
| 204 | 3300039062 | Ga0400483_215675 | Ga0400483_215675_99634_100329 | 227 |
| 205 | 3300046499 | Ga0495594_0187165 | Ga0495594_0187165_415_1101 | 227 |
| 206 | iso_pu_bacteria | 2522572158 | 2523102838 | 227 |
| 207 | iso_pu_bacteria | 2571042365 | 2572256267 | 227 |
| 208 | iso_pu_bacteria | 2597490356 | 2599105892 | 227 |
| 209 | iso_pu_bacteria | 2846952575 | 2846955677 | 227 |
| 210 | iso_pu_bacteria | 2848858292 | 2848862338 | 227 |
| 211 | 3300012481 | Ga0157320_1004295 | Ga0157320_10042951 | 228 |
| 212 | 3300032004 | Ga0307414_10011862 | Ga0307414_100118623 | 228 |
| 213 | 3300041512 | Ga0451853_3855578 | Ga0451853_3855578_848_1537 | 228 |
| 214 | 3300048922 | Ga0496119_0046469 | Ga0496119_0046469_915_1604 | 228 |
| 215 | 3300048923 | Ga0496120_0009890 | Ga0496120_0009890_1217_1906 | 228 |
| 216 | 3300049573 | Ga0501037_0241413 | Ga0501037_0241413_199_897 | 228 |
| 217 | 3300049822 | Ga0501035_0112301 | Ga0501035_0112301_1380_2078 | 228 |
| 218 | 3300049823 | Ga0501044_0021241 | Ga0501044_0021241_25_723 | 228 |
| 219 | 3300005617 | Ga0068859_101021260 | Ga0068859_1010212602 | 229 |
| 220 | 3300005983 | Ga0081540_1010382 | Ga0081540_10103829 | 229 |
| 221 | 3300006931 | Ga0097620_101021339 | Ga0097620_1010213392 | 229 |
| 222 | 3300009979 | Ga0105032_101076 | Ga0105032_1010762 | 229 |
| 223 | 3300021361 | Ga0213872_10084699 | Ga0213872_100846992 | 229 |
| 224 | 3300028558 | Ga0265326_10029055 | Ga0265326_100290551 | 229 |
| 225 | 3300028573 | Ga0265334_10013502 | Ga0265334_100135023 | 229 |
| 226 | 3300031247 | Ga0265340_10012538 | Ga0265340_100125385 | 229 |
| 227 | 3300031507 | Ga0307509_10281710 | Ga0307509_102817102 | 229 |
| 228 | 3300031711 | Ga0265314_10034063 | Ga0265314_100340634 | 229 |
| 229 | 3300033179 | Ga0307507_10043872 | Ga0307507_100438725 | 229 |
| 230 | 3300038705 | Ga0237819_02473 | Ga0237819_02473_2441_3139 | 229 |
| 231 | 3300039062 | Ga0400483_093214 | Ga0400483_093214_181317_182018 | 229 |
| 232 | 3300039062 | Ga0400483_093214 | Ga0400483_093214_18323_19024 | 229 |
| 233 | 3300039062 | Ga0400483_219863 | Ga0400483_219863_91352_92053 | 229 |
| 234 | 3300039447 | Ga0436361_1162608 | Ga0436361_1162608_3302_3991 | 229 |
| 235 | 3300002067 | JGI24735J21928_10068943 | JGI24735J21928_100689431 | 230 |
| 236 | 3300002067 | JGI24735J21928_10073514 | JGI24735J21928_100735141 | 230 |
| 237 | 3300003215 | JGI25153J46596_10051962 | JGI25153J46596_100519622 | 230 |
| 238 | 3300003578 | Ga0006562J51391_1117239 | Ga0006562J51391_11172395 | 230 |
| 239 | 3300003761 | Ga0055535_1000480 | Ga0055535_100048025 | 230 |
| 240 | 3300003762 | Ga0055542_1000498 | Ga0055542_10004988 | 230 |
| 241 | 3300005455 | Ga0070663_100015745 | Ga0070663_1000157453 | 230 |
| 242 | 3300005457 | Ga0070662_100057900 | Ga0070662_1000579003 | 230 |
| 243 | 3300005546 | Ga0070696_100034236 | Ga0070696_1000342362 | 230 |
| 244 | 3300005563 | Ga0068855_100036599 | Ga0068855_1000365997 | 230 |
| 245 | 3300005563 | Ga0068855_100048401 | Ga0068855_1000484013 | 230 |
| 246 | 3300005577 | Ga0068857_100001325 | Ga0068857_1000013253 | 230 |
| 247 | 3300005578 | Ga0068854_100005095 | Ga0068854_1000050957 | 230 |
| 248 | 3300005578 | Ga0068854_100037766 | Ga0068854_1000377661 | 230 |
| 249 | 3300005616 | Ga0068852_100211265 | Ga0068852_1002112652 | 230 |
| 250 | 3300005616 | Ga0068852_100226744 | Ga0068852_1002267441 | 230 |
| 251 | 3300005834 | Ga0068851_10001014 | Ga0068851_100010143 | 230 |
| 252 | 3300005842 | Ga0068858_100095249 | Ga0068858_1000952492 | 230 |
| 253 | 3300005937 | Ga0081455_10051486 | Ga0081455_100514862 | 230 |
| 254 | 3300006028 | Ga0070717_10065536 | Ga0070717_100655362 | 230 |
| 255 | 3300006195 | Ga0075366_10301756 | Ga0075366_103017561 | 230 |
| 256 | 3300006846 | Ga0075430_100013283 | Ga0075430_1000132832 | 230 |
| 257 | 3300006847 | Ga0075431_100008297 | Ga0075431_1000082977 | 230 |
| 258 | 3300006880 | Ga0075429_100085573 | Ga0075429_1000855733 | 230 |
| 259 | 3300009093 | Ga0105240_10001295 | Ga0105240_100012956 | 230 |
| 260 | 3300009093 | Ga0105240_10016935 | Ga0105240_100169356 | 230 |
| 261 | 3300009093 | Ga0105240_10050609 | Ga0105240_100506092 | 230 |
| 262 | 3300009093 | Ga0105240_10073268 | Ga0105240_100732685 | 230 |
| 263 | 3300009147 | Ga0114129_10528959 | Ga0114129_105289592 | 230 |
| 264 | 3300009545 | Ga0105237_10000058 | Ga0105237_1000005867 | 230 |
| 265 | 3300009551 | Ga0105238_10169745 | Ga0105238_101697452 | 230 |
| 266 | 3300009551 | Ga0105238_10661953 | Ga0105238_106619531 | 230 |
| 267 | 3300010375 | Ga0105239_10001092 | Ga0105239_1000109215 | 230 |
| 268 | 3300013105 | Ga0157369_10044126 | Ga0157369_100441261 | 230 |
| 269 | 3300014325 | Ga0163163_10004056 | Ga0163163_1000405612 | 230 |
| 270 | 3300021361 | Ga0213872_10015243 | Ga0213872_100152434 | 230 |
| 271 | 3300025228 | Ga0209672_101407 | Ga0209672_1014078 | 230 |
| 272 | 3300025242 | Ga0209258_100447 | Ga0209258_10044717 | 230 |
| 273 | 3300025254 | Ga0209148_1000438 | Ga0209148_100043817 | 230 |
| 274 | 3300025272 | Ga0209455_1019625 | Ga0209455_10196252 | 230 |
| 275 | 3300025297 | Ga0209758_1000698 | Ga0209758_100069838 | 230 |
| 276 | 3300025321 | Ga0207656_10003294 | Ga0207656_100032947 | 230 |
| 277 | 3300025904 | Ga0207647_10001327 | Ga0207647_100013272 | 230 |
| 278 | 3300025913 | Ga0207695_10000520 | Ga0207695_1000052064 | 230 |
| 279 | 3300025913 | Ga0207695_10001752 | Ga0207695_1000175226 | 230 |
| 280 | 3300025913 | Ga0207695_10014966 | Ga0207695_100149667 | 230 |
| 281 | 3300025913 | Ga0207695_10022447 | Ga0207695_100224473 | 230 |
| 282 | 3300025913 | Ga0207695_10042746 | Ga0207695_100427462 | 230 |
| 283 | 3300025913 | Ga0207695_10065145 | Ga0207695_100651454 | 230 |
| 284 | 3300025914 | Ga0207671_10000026 | Ga0207671_10000026183 | 230 |
| 285 | 3300025924 | Ga0207694_10601416 | Ga0207694_106014161 | 230 |
| 286 | 3300025949 | Ga0207667_10011300 | Ga0207667_100113005 | 230 |
| 287 | 3300025949 | Ga0207667_10013017 | Ga0207667_100130177 | 230 |
| 288 | 3300025981 | Ga0207640_10000632 | Ga0207640_1000063213 | 230 |
| 289 | 3300025981 | Ga0207640_10024208 | Ga0207640_100242084 | 230 |
| 290 | 3300026035 | Ga0207703_10065769 | Ga0207703_100657692 | 230 |
| 291 | 3300026067 | Ga0207678_10089132 | Ga0207678_100891321 | 230 |
| 292 | 3300026095 | Ga0207676_10402276 | Ga0207676_104022762 | 230 |
| 293 | 3300026116 | Ga0207674_10000219 | Ga0207674_1000021967 | 230 |
| 294 | 3300026142 | Ga0207698_10037228 | Ga0207698_100372285 | 230 |
| 295 | 3300031010 | Ga0265771_1000454 | Ga0265771_10004542 | 230 |
| 296 | 3300031241 | Ga0265325_10227146 | Ga0265325_102271461 | 230 |
| 297 | 3300031548 | Ga0307408_100066320 | Ga0307408_1000663202 | 230 |
| 298 | 3300031548 | Ga0307408_100401281 | Ga0307408_1004012811 | 230 |
| 299 | 3300031595 | Ga0265313_10001342 | Ga0265313_100013422 | 230 |
| 300 | 3300031711 | Ga0265314_10024772 | Ga0265314_100247725 | 230 |
| 301 | 3300031712 | Ga0265342_10243142 | Ga0265342_102431421 | 230 |
| 302 | 3300031731 | Ga0307405_10613631 | Ga0307405_106136311 | 230 |
| 303 | 3300031824 | Ga0307413_10304380 | Ga0307413_103043803 | 230 |
| 304 | 3300031911 | Ga0307412_10102449 | Ga0307412_101024492 | 230 |
| 305 | 3300031995 | Ga0307409_100558808 | Ga0307409_1005588081 | 230 |
| 306 | 3300032002 | Ga0307416_100396638 | Ga0307416_1003966382 | 230 |
| 307 | 3300032005 | Ga0307411_10022689 | Ga0307411_100226893 | 230 |
| 308 | 3300035089 | Ga0373944_0117281 | Ga0373944_0117281_165_863 | 230 |
| 309 | 3300037471 | Ga0395905_0220376 | Ga0395905_0220376_73_846 | 230 |
| 310 | 3300039447 | Ga0436361_0728505 | Ga0436361_0728505_1440_2150 | 230 |
| 311 | 3300039453 | Ga0436362_0223885 | Ga0436362_0223885_127_819 | 230 |
| 312 | 3300041404 | Ga0439436_0003694 | Ga0439436_0003694_3664_4359 | 230 |
| 313 | 3300041404 | Ga0439436_0007932 | Ga0439436_0007932_2077_2778 | 230 |
| 314 | 3300041406 | Ga0439439_0000798 | Ga0439439_0000798_3359_4054 | 230 |
| 315 | 3300042006 | Ga0439432_012052 | Ga0439432_012052_1901_2638 | 230 |
| 316 | 3300042006 | Ga0439432_018258 | Ga0439432_018258_1347_2117 | 230 |
| 317 | 3300042007 | Ga0439449_0004237 | Ga0439449_0004237_1831_2568 | 230 |
| 318 | 3300042007 | Ga0439449_0023528 | Ga0439449_0023528_1460_2230 | 230 |
| 319 | 3300042010 | Ga0439452_038264 | Ga0439452_038264_194_931 | 230 |
| 320 | 3300042015 | Ga0439462_0033408 | Ga0439462_0033408_306_1001 | 230 |
| 321 | 3300042015 | Ga0439462_0050636 | Ga0439462_0050636_297_1034 | 230 |
| 322 | 3300044658 | Ga0466972_0021849 | Ga0466972_0021849_475_1182 | 230 |
| 323 | 3300044683 | Ga0466965_0004446 | Ga0466965_0004446_3523_4227 | 230 |
| 324 | 3300044683 | Ga0466965_0010823 | Ga0466965_0010823_914_1615 | 230 |
| 325 | 3300044684 | Ga0466966_0011388 | Ga0466966_0011388_4702_5403 | 230 |
| 326 | 3300044693 | Ga0466961_0000285 | Ga0466961_0000285_24168_24869 | 230 |
| 327 | 3300044693 | Ga0466961_0016695 | Ga0466961_0016695_661_1359 | 230 |
| 328 | 3300044706 | Ga0466964_0346105 | Ga0466964_0346105_20_721 | 230 |
| 329 | 3300044901 | Ga0466960_0041675 | Ga0466960_0041675_777_1484 | 230 |
| 330 | 3300045049 | Ga0466959_0003330 | Ga0466959_0003330_8769_9470 | 230 |
| 331 | 3300045049 | Ga0466959_0078857 | Ga0466959_0078857_966_1667 | 230 |
| 332 | 3300045836 | Ga0466958_0133741 | Ga0466958_0133741_61_759 | 230 |
| 333 | 3300046642 | Ga0495634_0348646 | Ga0495634_0348646_77_793 | 230 |
| 334 | 3300046809 | Ga0495600_0129549 | Ga0495600_0129549_557_1273 | 230 |
| 335 | 3300047321 | Ga0495676_0166764 | Ga0495676_0166764_635_1333 | 230 |
| 336 | 3300047444 | Ga0495675_0195634 | Ga0495675_0195634_400_1116 | 230 |
| 337 | 3300048904 | Ga0496101_0016189 | Ga0496101_0016189_3223_3918 | 230 |
| 338 | 3300048904 | Ga0496101_0031944 | Ga0496101_0031944_1102_1800 | 230 |
| 339 | 3300048905 | Ga0496102_0608027 | Ga0496102_0608027_33_728 | 230 |
| 340 | 3300048907 | Ga0496104_0000303 | Ga0496104_0000303_30185_30901 | 230 |
| 341 | 3300048907 | Ga0496104_0000713 | Ga0496104_0000713_21106_21804 | 230 |
| 342 | 3300048907 | Ga0496104_0009732 | Ga0496104_0009732_257_973 | 230 |
| 343 | 3300048907 | Ga0496104_0027609 | Ga0496104_0027609_4012_4707 | 230 |
| 344 | 3300048908 | Ga0496105_0000554 | Ga0496105_0000554_15769_16467 | 230 |
| 345 | 3300048908 | Ga0496105_0000693 | Ga0496105_0000693_10618_11334 | 230 |
| 346 | 3300048908 | Ga0496105_0001496 | Ga0496105_0001496_257_973 | 230 |
| 347 | 3300048908 | Ga0496105_0002549 | Ga0496105_0002549_4090_4785 | 230 |
| 348 | 3300048910 | Ga0496107_0021284 | Ga0496107_0021284_1259_1954 | 230 |
| 349 | 3300048911 | Ga0496108_0011366 | Ga0496108_0011366_615_1313 | 230 |
| 350 | 3300048912 | Ga0496109_0001233 | Ga0496109_0001233_19467_20165 | 230 |
| 351 | 3300048913 | Ga0496110_0027242 | Ga0496110_0027242_2533_3249 | 230 |
| 352 | 3300048913 | Ga0496110_0067115 | Ga0496110_0067115_2273_2971 | 230 |
| 353 | 3300048914 | Ga0496111_0000819 | Ga0496111_0000819_9402_10100 | 230 |
| 354 | 3300048914 | Ga0496111_0088629 | Ga0496111_0088629_627_1343 | 230 |
| 355 | 3300048915 | Ga0496112_0002425 | Ga0496112_0002425_13987_14685 | 230 |
| 356 | 3300048916 | Ga0496113_0000636 | Ga0496113_0000636_10233_10931 | 230 |
| 357 | 3300048918 | Ga0496115_0027822 | Ga0496115_0027822_2945_3640 | 230 |
| 358 | 3300048918 | Ga0496115_0038542 | Ga0496115_0038542_3012_3728 | 230 |
| 359 | 3300048920 | Ga0496117_0103635 | Ga0496117_0103635_959_1654 | 230 |
| 360 | 3300048921 | Ga0496118_0006725 | Ga0496118_0006725_3051_3746 | 230 |
| 361 | 3300048921 | Ga0496118_0010118 | Ga0496118_0010118_5398_6093 | 230 |
| 362 | 3300048922 | Ga0496119_0002149 | Ga0496119_0002149_15870_16565 | 230 |
| 363 | 3300048923 | Ga0496120_0000505 | Ga0496120_0000505_38898_39593 | 230 |
| 364 | 3300048924 | Ga0496121_0010022 | Ga0496121_0010022_5263_5958 | 230 |
| 365 | 3300048924 | Ga0496121_0032282 | Ga0496121_0032282_2813_3508 | 230 |
| 366 | 3300048924 | Ga0496121_0222220 | Ga0496121_0222220_109_813 | 230 |
| 367 | 3300048928 | Ga0496125_0025836 | Ga0496125_0025836_109_810 | 230 |
| 368 | 3300048929 | Ga0496126_0003502 | Ga0496126_0003502_15798_16493 | 230 |
| 369 | 3300049570 | Ga0501033_0081465 | Ga0501033_0081465_893_1603 | 230 |
| 370 | 3300049571 | Ga0501034_0414282 | Ga0501034_0414282_120_854 | 230 |
| 371 | 3300049589 | Ga0501073_0013314 | Ga0501073_0013314_1264_1983 | 230 |
| 372 | 3300049744 | Ga0501083_0241490 | Ga0501083_0241490_438_1142 | 230 |
| 373 | 3300049758 | Ga0501241_046467 | Ga0501241_046467_62_781 | 230 |
| 374 | 3300049823 | Ga0501044_0418010 | Ga0501044_0418010_128_862 | 230 |
| 375 | 3300050507 | nmdc:mga05p37_429170_c1 | nmdc:mga05p37_429170_c1_731_1429 | 230 |
| 376 | 3300050508 | nmdc:mga09592_29529_c1 | nmdc:mga09592_29529_c1_3722_4420 | 230 |
| 377 | 3300050509 | nmdc:mga0qj67_10964_c1 | nmdc:mga0qj67_10964_c1_1841_2539 | 230 |
| 378 | 3300053077 | Ga0495601_0355123 | Ga0495601_0355123_205_921 | 230 |
| 379 | 3300053085 | Ga0495619_0019882 | Ga0495619_0019882_161_877 | 230 |
| 380 | 3300053087 | Ga0500643_054119 | Ga0500643_054119_306_1025 | 230 |
| 381 | 3300053131 | Ga0500652_089760 | Ga0500652_089760_182_886 | 230 |
| 382 | 3300053139 | Ga0500568_0000435 | Ga0500568_0000435_3696_4400 | 230 |
| 383 | 3300005329 | Ga0070683_100436854 | Ga0070683_1004368541 | 231 |
| 384 | 3300005334 | Ga0068869_100056780 | Ga0068869_1000567802 | 231 |
| 385 | 3300005334 | Ga0068869_100081067 | Ga0068869_1000810672 | 231 |
| 386 | 3300005347 | Ga0070668_100014694 | Ga0070668_1000146943 | 231 |
| 387 | 3300005347 | Ga0070668_100290784 | Ga0070668_1002907842 | 231 |
| 388 | 3300005353 | Ga0070669_100002673 | Ga0070669_10000267315 | 231 |
| 389 | 3300005355 | Ga0070671_100150090 | Ga0070671_1001500902 | 231 |
| 390 | 3300005367 | Ga0070667_100087564 | Ga0070667_1000875642 | 231 |
| 391 | 3300005367 | Ga0070667_100148812 | Ga0070667_1001488123 | 231 |
| 392 | 3300005434 | Ga0070709_10294781 | Ga0070709_102947811 | 231 |
| 393 | 3300005455 | Ga0070663_100114402 | Ga0070663_1001144022 | 231 |
| 394 | 3300005455 | Ga0070663_100120811 | Ga0070663_1001208112 | 231 |
| 395 | 3300005459 | Ga0068867_100000977 | Ga0068867_10000097718 | 231 |
| 396 | 3300005471 | Ga0070698_100312159 | Ga0070698_1003121592 | 231 |
| 397 | 3300005539 | Ga0068853_100011346 | Ga0068853_1000113468 | 231 |
| 398 | 3300005539 | Ga0068853_100083468 | Ga0068853_1000834683 | 231 |
| 399 | 3300005543 | Ga0070672_100004832 | Ga0070672_1000048325 | 231 |
| 400 | 3300005548 | Ga0070665_100012782 | Ga0070665_1000127826 | 231 |
| 401 | 3300005548 | Ga0070665_100235937 | Ga0070665_1002359372 | 231 |
| 402 | 3300005548 | Ga0070665_100286650 | Ga0070665_1002866502 | 231 |
| 403 | 3300005548 | Ga0070665_100806840 | Ga0070665_1008068402 | 231 |
| 404 | 3300005563 | Ga0068855_100006688 | Ga0068855_1000066888 | 231 |
| 405 | 3300005563 | Ga0068855_100393111 | Ga0068855_1003931112 | 231 |
| 406 | 3300005614 | Ga0068856_100079863 | Ga0068856_1000798632 | 231 |
| 407 | 3300005616 | Ga0068852_100141840 | Ga0068852_1001418402 | 231 |
| 408 | 3300005617 | Ga0068859_100000070 | Ga0068859_10000007014 | 231 |
| 409 | 3300005834 | Ga0068851_10026033 | Ga0068851_100260333 | 231 |
| 410 | 3300005841 | Ga0068863_100222800 | Ga0068863_1002228002 | 231 |
| 411 | 3300005843 | Ga0068860_100327298 | Ga0068860_1003272982 | 231 |
| 412 | 3300005844 | Ga0068862_100000041 | Ga0068862_10000004115 | 231 |
| 413 | 3300006195 | Ga0075366_10083227 | Ga0075366_100832272 | 231 |
| 414 | 3300006237 | Ga0097621_100048825 | Ga0097621_1000488252 | 231 |
| 415 | 3300006237 | Ga0097621_100133458 | Ga0097621_1001334583 | 231 |
| 416 | 3300006358 | Ga0068871_100266435 | Ga0068871_1002664351 | 231 |
| 417 | 3300006358 | Ga0068871_100373900 | Ga0068871_1003739002 | 231 |
| 418 | 3300006881 | Ga0068865_100005556 | Ga0068865_1000055564 | 231 |
| 419 | 3300006931 | Ga0097620_100000070 | Ga0097620_10000007014 | 231 |
| 420 | 3300009101 | Ga0105247_10048258 | Ga0105247_100482582 | 231 |
| 421 | 3300009148 | Ga0105243_10002995 | Ga0105243_1000299511 | 231 |
| 422 | 3300009177 | Ga0105248_10248344 | Ga0105248_102483442 | 231 |
| 423 | 3300009545 | Ga0105237_10127701 | Ga0105237_101277012 | 231 |
| 424 | 3300009551 | Ga0105238_10417804 | Ga0105238_104178042 | 231 |
| 425 | 3300009553 | Ga0105249_10028396 | Ga0105249_100283962 | 231 |
| 426 | 3300010375 | Ga0105239_10041475 | Ga0105239_100414754 | 231 |
| 427 | 3300010375 | Ga0105239_10054456 | Ga0105239_100544562 | 231 |
| 428 | 3300010375 | Ga0105239_10169198 | Ga0105239_101691982 | 231 |
| 429 | 3300013296 | Ga0157374_10014689 | Ga0157374_100146894 | 231 |
| 430 | 3300013307 | Ga0157372_10104556 | Ga0157372_101045564 | 231 |
| 431 | 3300014325 | Ga0163163_10297383 | Ga0163163_102973832 | 231 |
| 432 | 3300014745 | Ga0157377_10000098 | Ga0157377_1000009839 | 231 |
| 433 | 3300014969 | Ga0157376_10193719 | Ga0157376_101937192 | 231 |
| 434 | 3300021361 | Ga0213872_10001251 | Ga0213872_100012516 | 231 |
| 435 | 3300021361 | Ga0213872_10146883 | Ga0213872_101468831 | 231 |
| 436 | 3300025292 | Ga0209676_1008257 | Ga0209676_10082573 | 231 |
| 437 | 3300025914 | Ga0207671_10119440 | Ga0207671_101194402 | 231 |
| 438 | 3300025935 | Ga0207709_10002802 | Ga0207709_100028029 | 231 |
| 439 | 3300025940 | Ga0207691_10021154 | Ga0207691_100211547 | 231 |
| 440 | 3300025941 | Ga0207711_10105941 | Ga0207711_101059412 | 231 |
| 441 | 3300025949 | Ga0207667_10008300 | Ga0207667_100083008 | 231 |
| 442 | 3300025960 | Ga0207651_10220801 | Ga0207651_102208013 | 231 |
| 443 | 3300025972 | Ga0207668_10311238 | Ga0207668_103112382 | 231 |
| 444 | 3300025986 | Ga0207658_10187008 | Ga0207658_101870081 | 231 |
| 445 | 3300025986 | Ga0207658_10409212 | Ga0207658_104092122 | 231 |
| 446 | 3300026041 | Ga0207639_10001101 | Ga0207639_100011015 | 231 |
| 447 | 3300026041 | Ga0207639_10011796 | Ga0207639_100117966 | 231 |
| 448 | 3300026041 | Ga0207639_10791946 | Ga0207639_107919462 | 231 |
| 449 | 3300026067 | Ga0207678_10015043 | Ga0207678_100150432 | 231 |
| 450 | 3300026067 | Ga0207678_10016702 | Ga0207678_100167025 | 231 |
| 451 | 3300026067 | Ga0207678_10061661 | Ga0207678_100616614 | 231 |
| 452 | 3300026088 | Ga0207641_10306198 | Ga0207641_103061982 | 231 |
| 453 | 3300026089 | Ga0207648_10000614 | Ga0207648_1000061432 | 231 |
| 454 | 3300026116 | Ga0207674_10038049 | Ga0207674_100380496 | 231 |
| 455 | 3300026142 | Ga0207698_10829463 | Ga0207698_108294631 | 231 |
| 456 | 3300027552 | Ga0209982_1006591 | Ga0209982_10065912 | 231 |
| 457 | 3300027665 | Ga0209983_1005918 | Ga0209983_10059182 | 231 |
| 458 | 3300027682 | Ga0209971_1021303 | Ga0209971_10213032 | 231 |
| 459 | 3300027876 | Ga0209974_10038082 | Ga0209974_100380822 | 231 |
| 460 | 3300028379 | Ga0268266_10051840 | Ga0268266_100518403 | 231 |
| 461 | 3300028379 | Ga0268266_10123388 | Ga0268266_101233882 | 231 |
| 462 | 3300028379 | Ga0268266_10161255 | Ga0268266_101612552 | 231 |
| 463 | 3300028380 | Ga0268265_10000137 | Ga0268265_1000013766 | 231 |
| 464 | 3300028380 | Ga0268265_10296873 | Ga0268265_102968732 | 231 |
| 465 | 3300028381 | Ga0268264_10459757 | Ga0268264_104597572 | 231 |
| 466 | 3300031239 | Ga0265328_10014265 | Ga0265328_100142652 | 231 |
| 467 | 3300031711 | Ga0265314_10151443 | Ga0265314_101514432 | 231 |
| 468 | 3300031901 | Ga0307406_10000297 | Ga0307406_100002978 | 231 |
| 469 | 3300039447 | Ga0436361_0075622 | Ga0436361_0075622_306_1007 | 231 |
| 470 | 3300039447 | Ga0436361_0117668 | Ga0436361_0117668_168_872 | 231 |
| 471 | 3300039447 | Ga0436361_0319126 | Ga0436361_0319126_20101_20823 | 231 |
| 472 | 3300041404 | Ga0439436_0018212 | Ga0439436_0018212_22_726 | 231 |
| 473 | 3300041443 | Ga0451789_0963123 | Ga0451789_0963123_152_922 | 231 |
| 474 | 3300046461 | Ga0495641_0107650 | Ga0495641_0107650_396_1124 | 231 |
| 475 | 3300048903 | Ga0496100_0176487 | Ga0496100_0176487_359_1060 | 231 |
| 476 | 3300048911 | Ga0496108_0719938 | Ga0496108_0719938_122_823 | 231 |
| 477 | 3300048917 | Ga0496114_0117756 | Ga0496114_0117756_119_847 | 231 |
| 478 | 3300048918 | Ga0496115_0019682 | Ga0496115_0019682_3478_4182 | 231 |
| 479 | 3300049523 | Ga0501300_012312 | Ga0501300_012312_462_1166 | 231 |
| 480 | 3300049568 | Ga0501031_0002340 | Ga0501031_0002340_54_752 | 231 |
| 481 | 3300049568 | Ga0501031_0004589 | Ga0501031_0004589_1936_2637 | 231 |
| 482 | 3300049569 | Ga0501032_0098654 | Ga0501032_0098654_459_1160 | 231 |
| 483 | 3300049569 | Ga0501032_0121509 | Ga0501032_0121509_983_1681 | 231 |
| 484 | 3300049570 | Ga0501033_0050319 | Ga0501033_0050319_1939_2640 | 231 |
| 485 | 3300049570 | Ga0501033_0409128 | Ga0501033_0409128_147_845 | 231 |
| 486 | 3300049571 | Ga0501034_0002289 | Ga0501034_0002289_15424_16125 | 231 |
| 487 | 3300049571 | Ga0501034_0386157 | Ga0501034_0386157_156_851 | 231 |
| 488 | 3300049572 | Ga0501036_0070548 | Ga0501036_0070548_2186_2887 | 231 |
| 489 | 3300049572 | Ga0501036_0084941 | Ga0501036_0084941_1593_2294 | 231 |
| 490 | 3300049572 | Ga0501036_0581690 | Ga0501036_0581690_181_879 | 231 |
| 491 | 3300049573 | Ga0501037_0024859 | Ga0501037_0024859_371_1069 | 231 |
| 492 | 3300049573 | Ga0501037_0034349 | Ga0501037_0034349_452_1153 | 231 |
| 493 | 3300049573 | Ga0501037_0120426 | Ga0501037_0120426_274_975 | 231 |
| 494 | 3300049574 | Ga0501038_0006839 | Ga0501038_0006839_6447_7148 | 231 |
| 495 | 3300049574 | Ga0501038_0025833 | Ga0501038_0025833_776_1477 | 231 |
| 496 | 3300049575 | Ga0501039_0002455 | Ga0501039_0002455_7165_7866 | 231 |
| 497 | 3300049575 | Ga0501039_0019269 | Ga0501039_0019269_3756_4457 | 231 |
| 498 | 3300049575 | Ga0501039_0054822 | Ga0501039_0054822_2183_2881 | 231 |
| 499 | 3300049576 | Ga0501040_0001281 | Ga0501040_0001281_1196_1897 | 231 |
| 500 | 3300049576 | Ga0501040_0031172 | Ga0501040_0031172_2747_3448 | 231 |
| 501 | 3300049576 | Ga0501040_0165056 | Ga0501040_0165056_148_846 | 231 |
| 502 | 3300049577 | Ga0501041_0000998 | Ga0501041_0000998_8633_9334 | 231 |
| 503 | 3300049578 | Ga0501042_0004027 | Ga0501042_0004027_5926_6627 | 231 |
| 504 | 3300049578 | Ga0501042_0011146 | Ga0501042_0011146_2226_2924 | 231 |
| 505 | 3300049578 | Ga0501042_0292046 | Ga0501042_0292046_159_860 | 231 |
| 506 | 3300049579 | Ga0501043_0137534 | Ga0501043_0137534_437_1138 | 231 |
| 507 | 3300049580 | Ga0501046_0028278 | Ga0501046_0028278_554_1255 | 231 |
| 508 | 3300049580 | Ga0501046_0129870 | Ga0501046_0129870_435_1136 | 231 |
| 509 | 3300049581 | Ga0501047_0102039 | Ga0501047_0102039_436_1137 | 231 |
| 510 | 3300049582 | Ga0501048_0005038 | Ga0501048_0005038_3870_4571 | 231 |
| 511 | 3300049582 | Ga0501048_0034694 | Ga0501048_0034694_2742_3440 | 231 |
| 512 | 3300049582 | Ga0501048_0047128 | Ga0501048_0047128_1933_2634 | 231 |
| 513 | 3300049583 | Ga0501067_0049349 | Ga0501067_0049349_1192_1893 | 231 |
| 514 | 3300049584 | Ga0501068_0014546 | Ga0501068_0014546_2568_3269 | 231 |
| 515 | 3300049585 | Ga0501069_0000759 | Ga0501069_0000759_13363_14064 | 231 |
| 516 | 3300049586 | Ga0501070_0050193 | Ga0501070_0050193_440_1141 | 231 |
| 517 | 3300049586 | Ga0501070_0140373 | Ga0501070_0140373_380_1075 | 231 |
| 518 | 3300049587 | Ga0501071_0004084 | Ga0501071_0004084_1357_2058 | 231 |
| 519 | 3300049587 | Ga0501071_0115109 | Ga0501071_0115109_227_928 | 231 |
| 520 | 3300049587 | Ga0501071_0283615 | Ga0501071_0283615_45_743 | 231 |
| 521 | 3300049588 | Ga0501072_0002683 | Ga0501072_0002683_5137_5838 | 231 |
| 522 | 3300049588 | Ga0501072_0175911 | Ga0501072_0175911_852_1553 | 231 |
| 523 | 3300049588 | Ga0501072_0312678 | Ga0501072_0312678_510_1208 | 231 |
| 524 | 3300049589 | Ga0501073_0042629 | Ga0501073_0042629_1699_2400 | 231 |
| 525 | 3300049589 | Ga0501073_0054648 | Ga0501073_0054648_452_1153 | 231 |
| 526 | 3300049589 | Ga0501073_0227307 | Ga0501073_0227307_364_1062 | 231 |
| 527 | 3300049590 | Ga0501074_0006764 | Ga0501074_0006764_881_1582 | 231 |
| 528 | 3300049590 | Ga0501074_0031514 | Ga0501074_0031514_3064_3762 | 231 |
| 529 | 3300049590 | Ga0501074_0061768 | Ga0501074_0061768_993_1694 | 231 |
| 530 | 3300049591 | Ga0501075_0000491 | Ga0501075_0000491_4144_4845 | 231 |
| 531 | 3300049591 | Ga0501075_0159507 | Ga0501075_0159507_20_718 | 231 |
| 532 | 3300049592 | Ga0501076_0002706 | Ga0501076_0002706_2574_3275 | 231 |
| 533 | 3300049592 | Ga0501076_0122088 | Ga0501076_0122088_197_895 | 231 |
| 534 | 3300049592 | Ga0501076_0131973 | Ga0501076_0131973_874_1575 | 231 |
| 535 | 3300049593 | Ga0501077_0004253 | Ga0501077_0004253_4288_4989 | 231 |
| 536 | 3300049593 | Ga0501077_0103344 | Ga0501077_0103344_70_768 | 231 |
| 537 | 3300049741 | Ga0501079_0012112 | Ga0501079_0012112_2232_2933 | 231 |
| 538 | 3300049742 | Ga0501080_0019681 | Ga0501080_0019681_2002_2703 | 231 |
| 539 | 3300049742 | Ga0501080_0064742 | Ga0501080_0064742_1676_2392 | 231 |
| 540 | 3300049742 | Ga0501080_0186262 | Ga0501080_0186262_432_1133 | 231 |
| 541 | 3300049742 | Ga0501080_0187500 | Ga0501080_0187500_398_1096 | 231 |
| 542 | 3300049742 | Ga0501080_0374699 | Ga0501080_0374699_516_1211 | 231 |
| 543 | 3300049743 | Ga0501081_0001389 | Ga0501081_0001389_6535_7236 | 231 |
| 544 | 3300049744 | Ga0501083_0002183 | Ga0501083_0002183_10043_10774 | 231 |
| 545 | 3300049744 | Ga0501083_0003882 | Ga0501083_0003882_8726_9427 | 231 |
| 546 | 3300049744 | Ga0501083_0014533 | Ga0501083_0014533_1399_2097 | 231 |
| 547 | 3300049776 | Ga0501280_001227 | Ga0501280_001227_1211_2044 | 231 |
| 548 | 3300049778 | Ga0501282_001588 | Ga0501282_001588_1575_2408 | 231 |
| 549 | 3300049822 | Ga0501035_0006601 | Ga0501035_0006601_10101_10802 | 231 |
| 550 | 3300049822 | Ga0501035_0027804 | Ga0501035_0027804_3450_4151 | 231 |
| 551 | 3300049822 | Ga0501035_0144195 | Ga0501035_0144195_1338_2033 | 231 |
| 552 | 3300049823 | Ga0501044_0001614 | Ga0501044_0001614_14391_15092 | 231 |
| 553 | 3300049823 | Ga0501044_0007794 | Ga0501044_0007794_4499_5194 | 231 |
| 554 | 3300049823 | Ga0501044_0043349 | Ga0501044_0043349_3739_4437 | 231 |
| 555 | 3300049824 | Ga0501045_0011691 | Ga0501045_0011691_2927_3628 | 231 |
| 556 | 3300050493 | nmdc:mga0k408_76839_c1 | nmdc:mga0k408_76839_c1_471_1169 | 231 |
| 557 | 3300053092 | Ga0500583_0004078 | Ga0500583_0004078_3565_4275 | 231 |
| 558 | 3300054114 | Ga0501084_0003070 | Ga0501084_0003070_6152_6853 | 231 |
| 559 | 3300054114 | Ga0501084_0005932 | Ga0501084_0005932_4624_5355 | 231 |
| 560 | 3300054114 | Ga0501084_0088532 | Ga0501084_0088532_320_1021 | 231 |
| 561 | 3300060353 | Ga0501082_0004147 | Ga0501082_0004147_1243_1944 | 231 |
| 562 | 3300060353 | Ga0501082_0006298 | Ga0501082_0006298_7471_8172 | 231 |
| 563 | 3300060353 | Ga0501082_0112190 | Ga0501082_0112190_1024_1722 | 231 |
| 564 | 3300061734 | Ga0530510_0002822 | Ga0530510_0002822_3604_4305 | 231 |
| 565 | 3300061734 | Ga0530510_0095604 | Ga0530510_0095604_1337_2032 | 231 |
| 566 | 3300061734 | Ga0530510_0395219 | Ga0530510_0395219_197_895 | 231 |
| 567 | 3300009147 | Ga0114129_10369211 | Ga0114129_103692112 | 232 |
| 568 | 3300033179 | Ga0307507_10067439 | Ga0307507_100674393 | 232 |
| 569 | 3300037853 | Ga0436364_0011659 | Ga0436364_0011659_13233_13946 | 232 |
| 570 | 3300044842 | Ga0466957_0102690 | Ga0466957_0102690_391_1098 | 232 |
| 571 | 3300045976 | Ga0466967_0795182 | Ga0466967_0795182_140_850 | 232 |
| 572 | 3300001915 | JGI24741J21665_1006124 | JGI24741J21665_10061242 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9846 | 1 | 200 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9807 | 1 | 198 |
| 4mf6-assembly1.cif.gz_A | crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit | 0.9713 | 2 | 199 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9676 | 3 | 199 |
| 4ikh-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound | 0.9672 | 2 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 1 | 1 | 84 | 3.40.30.10 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9997 | 3 | 86 | 3.40.30.10 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9771 | 1 | 84 | 3.40.30.10 |
| 4ikhA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9591 | 2 | 84 | 3.40.30.10 |
| af_P77526_93_209_1.20.1050.130 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.959 | 94 | 204 | 1.20.1050.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S8AWI8-F1-model_v4 | Glutathione S-transferase | 1.001 | 1 | 101 |
GO:0016740
|
| AF-A0A522J4D5-F1-model_v4 | Thiol:disulfide oxidoreductase | 1.001 | 1 | 84 |
|
| AF-A0A379WQP5-F1-model_v4 | Glutathione-S transferase | 0.9987 | 1 | 110 |
GO:0015036
GO:0016740 |
| AF-A0A535B6S1-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9967 | 1 | 82 |
|
| AF-A0A3D5Y447-F1-model_v4 | Thiol:disulfide oxidoreductase | 0.9965 | 1 | 71 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar