F465065

General Info

Members Datasets Scaffolds Average Seq Length
572 312 551 235

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10369211|Ga0114129_103692112
Length 281
Sequence MQRAQTLARAARRQRDRELENWIHEFGDLWTFFNTTPTGMLSPMIDLYFSPTPNGLKLKLFFEESGLPHRVLPVRLSQGEQFKPEFLAISPNNKIPALVDHAPADGGEPLAMFESGAMLLYLAQKIGRFLPHGPRAMGELMQWLFWQVGGLGPMAGQNGHFTAHAPEKLPYAIERYTRETNRLYGVLDRRLAGRDYIVGSDYSIADMACYPWIVPHRSHGQDLQQFPHLARWFARIAARPATQRAYVGVQDAYAPSAQALSDEARRALFGQTSATSGSPSR

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
15 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
16 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
17 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
18 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
183 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
287 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
288 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
308 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0.35
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0.17
Rhizoplane 8.57
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006124 3300001915 Bacteria 2449
2 JGI24735J21928_10068943 3300002067 Bacteria 1014
3 JGI24735J21928_10073514 3300002067 Bacteria 979
4 JGI25153J46596_10051962 3300003215 Bacteria 1170
5 rootH2_10040930 3300003320 Bacteria 9788
6 JGI25160J50197_1000208 3300003354 Bacteria 48426
7 Ga0006562J51391_1117239 3300003578 Bacteria 4133
8 Ga0055535_1000480 3300003761 Bacteria 36096
9 Ga0055542_1000498 3300003762 Bacteria 36096
10 Ga0065165_1000119 3300005262 Bacteria 134464
11 Ga0065714_10064584 3300005288 Bacteria 32069
12 Ga0070676_10052441 3300005328 Bacteria 2398
13 Ga0070676_10090935 3300005328 Bacteria 1869
14 Ga0070683_100436854 3300005329 Bacteria 1249
15 Ga0070683_100520267 3300005329 Bacteria 1137
16 Ga0070670_100449375 3300005331 Bacteria 1142
17 Ga0068869_100056780 3300005334 Bacteria 2856
18 Ga0068869_100081067 3300005334 Bacteria 2423
19 Ga0068869_100129853 3300005334 Bacteria 1936
20 Ga0070666_10089653 3300005335 Bacteria 2111
21 Ga0070682_100499447 3300005337 Bacteria 942
22 Ga0068868_100105906 3300005338 Bacteria 2281
23 Ga0070660_100162258 3300005339 Bacteria 1801
24 Ga0070689_100066378 3300005340 Bacteria 2811
25 Ga0070668_100014694 3300005347 Bacteria 5851
26 Ga0070668_100066227 3300005347 Bacteria 2803
27 Ga0070668_100075258 3300005347 Bacteria 2636
28 Ga0070668_100290784 3300005347 Bacteria 1368
29 Ga0070669_100002673 3300005353 Bacteria 12838
30 Ga0070669_100063099 3300005353 Bacteria 2726
31 Ga0070669_100063183 3300005353 Bacteria 2725
32 Ga0070675_100063084 3300005354 Bacteria 3063
33 Ga0070671_100150090 3300005355 Bacteria 1968
34 Ga0070673_100085091 3300005364 Bacteria 2573
35 Ga0070667_100087564 3300005367 Bacteria 2673
36 Ga0070667_100148812 3300005367 Bacteria 2055
37 Ga0070709_10294781 3300005434 Bacteria 1183
38 Ga0070700_100047517 3300005441 Bacteria 2656
39 Ga0070663_100015745 3300005455 Bacteria 4891
40 Ga0070663_100047590 3300005455 Bacteria 3038
41 Ga0070663_100102577 3300005455 Bacteria 2137
42 Ga0070663_100114402 3300005455 Bacteria 2031
43 Ga0070663_100120811 3300005455 Bacteria 1979
44 Ga0070663_100317809 3300005455 Bacteria 1251
45 Ga0070678_100183402 3300005456 Bacteria 1715
46 Ga0070662_100048167 3300005457 Bacteria 3069
47 Ga0070662_100057900 3300005457 Bacteria 2817
48 Ga0070681_10040601 3300005458 Bacteria 4661
49 Ga0068867_100000977 3300005459 Bacteria 19533
50 Ga0070698_100229368 3300005471 Bacteria 1790
51 Ga0070698_100312159 3300005471 Bacteria 1503
52 Ga0068853_100011346 3300005539 Bacteria 7237
53 Ga0068853_100012222 3300005539 Bacteria 6981
54 Ga0068853_100083468 3300005539 Bacteria 2799
55 Ga0070672_100004832 3300005543 Bacteria 8856
56 Ga0070672_100093733 3300005543 Bacteria 2426
57 Ga0070672_100286340 3300005543 Bacteria 1394
58 Ga0070696_100034236 3300005546 Bacteria 3494
59 Ga0070665_100012782 3300005548 Bacteria 8458
60 Ga0070665_100235937 3300005548 Bacteria 1829
61 Ga0070665_100259614 3300005548 Bacteria 1739
62 Ga0070665_100286650 3300005548 Bacteria 1649
63 Ga0070665_100806840 3300005548 Bacteria 951
64 Ga0068855_100006688 3300005563 Bacteria 13999
65 Ga0068855_100036599 3300005563 Bacteria 5840
66 Ga0068855_100048401 3300005563 Bacteria 5017
67 Ga0068855_100232030 3300005563 Bacteria 2066
68 Ga0068855_100393111 3300005563 Bacteria 1521
69 Ga0068857_100001325 3300005577 Bacteria 19451
70 Ga0068857_100018771 3300005577 Bacteria 6067
71 Ga0068857_100055534 3300005577 Bacteria 3515
72 Ga0068854_100005095 3300005578 Bacteria 8278
73 Ga0068854_100037766 3300005578 Bacteria 3391
74 Ga0068856_100079863 3300005614 Bacteria 3244
75 Ga0068852_100141840 3300005616 Bacteria 2224
76 Ga0068852_100211265 3300005616 Bacteria 1841
77 Ga0068852_100226744 3300005616 Bacteria 1779
78 Ga0068852_100297830 3300005616 Bacteria 1560
79 Ga0068859_100000070 3300005617 Bacteria 94311
80 Ga0068859_101021260 3300005617 Bacteria 908
81 Ga0068861_100015016 3300005719 Bacteria 5448
82 Ga0068851_10001014 3300005834 Bacteria 12181
83 Ga0068851_10026033 3300005834 Bacteria 2872
84 Ga0068870_10021051 3300005840 Bacteria 3185
85 Ga0068863_100005629 3300005841 Bacteria 12309
86 Ga0068863_100222800 3300005841 Bacteria 1818
87 Ga0068858_100095249 3300005842 Bacteria 2773
88 Ga0068860_100287451 3300005843 Bacteria 1608
89 Ga0068860_100327298 3300005843 Bacteria 1505
90 Ga0068862_100000041 3300005844 Bacteria 166801
91 Ga0068862_100000722 3300005844 Bacteria 33471
92 Ga0068862_100001530 3300005844 Bacteria 21160
93 Ga0081455_10051486 3300005937 Bacteria 3532
94 Ga0081540_1010382 3300005983 Bacteria 6313
95 Ga0070717_10065536 3300006028 Bacteria 3020
96 Ga0075366_10083227 3300006195 Bacteria 1912
97 Ga0075366_10301756 3300006195 Bacteria 980
98 Ga0097621_100048825 3300006237 Bacteria 3436
99 Ga0097621_100133458 3300006237 Bacteria 2115
100 Ga0068871_100266435 3300006358 Bacteria 1496
101 Ga0068871_100373900 3300006358 Bacteria 1265
102 Ga0068871_100629097 3300006358 Bacteria 978
103 Ga0075428_100007767 3300006844 Bacteria 11888
104 Ga0075430_100000458 3300006846 Bacteria 30423
105 Ga0075430_100011525 3300006846 Bacteria 7514
106 Ga0075430_100013283 3300006846 Bacteria 7020
107 Ga0075431_100000243 3300006847 Bacteria 41087
108 Ga0075431_100000267 3300006847 Bacteria 40345
109 Ga0075431_100003216 3300006847 Bacteria 15805
110 Ga0075431_100008297 3300006847 Bacteria 10388
111 Ga0075429_100000445 3300006880 Bacteria 30747
112 Ga0075429_100001924 3300006880 Bacteria 17218
113 Ga0075429_100085573 3300006880 Bacteria 2748
114 Ga0075429_100341034 3300006880 Bacteria 1312
115 Ga0068865_100005556 3300006881 Bacteria 7646
116 Ga0068865_100008801 3300006881 Bacteria 6242
117 Ga0068865_100245651 3300006881 Bacteria 1410
118 Ga0097620_100000070 3300006931 Bacteria 94311
119 Ga0097620_101021339 3300006931 Bacteria 908
120 Ga0105240_10001295 3300009093 Bacteria 43234
121 Ga0105240_10016935 3300009093 Bacteria 9851
122 Ga0105240_10050609 3300009093 Bacteria 5236
123 Ga0105240_10073268 3300009093 Bacteria 4229
124 Ga0111539_10000989 3300009094 Bacteria 37233
125 Ga0111539_10041545 3300009094 Bacteria 5528
126 Ga0105247_10048258 3300009101 Bacteria 2615
127 Ga0105247_10074639 3300009101 Bacteria 2127
128 Ga0114129_10001320 3300009147 Bacteria 33176
129 Ga0114129_10029160 3300009147 Bacteria 7818
130 Ga0114129_10279423 3300009147 Bacteria 2231
131 Ga0114129_10369211 3300009147 Bacteria 1897
132 Ga0114129_10528959 3300009147 Bacteria 1536
133 Ga0105243_10002995 3300009148 Bacteria 13953
134 Ga0105248_10248344 3300009177 Bacteria 2003
135 Ga0105237_10000058 3300009545 Bacteria 146943
136 Ga0105237_10127701 3300009545 Bacteria 2537
137 Ga0105238_10169745 3300009551 Bacteria 2157
138 Ga0105238_10417804 3300009551 Bacteria 1335
139 Ga0105238_10661953 3300009551 Bacteria 1055
140 Ga0105249_10000015 3300009553 Bacteria 282138
141 Ga0105249_10028396 3300009553 Bacteria 5049
142 Ga0105032_101076 3300009979 Bacteria 2541
143 Ga0105239_10001092 3300010375 Bacteria 37501
144 Ga0105239_10041475 3300010375 Bacteria 5044
145 Ga0105239_10054456 3300010375 Bacteria 4388
146 Ga0105239_10169198 3300010375 Bacteria 2443
147 Ga0105239_10238031 3300010375 Bacteria 2043
148 Ga0105246_10081279 3300011119 Bacteria 2309
149 Ga0105246_10518216 3300011119 Bacteria 1016
150 Ga0157320_1004295 3300012481 Bacteria 904
151 Ga0157369_10044126 3300013105 Bacteria 4855
152 Ga0157374_10014689 3300013296 Bacteria 6855
153 Ga0157372_10104556 3300013307 Bacteria 3237
154 Ga0163163_10004056 3300014325 Bacteria 12490
155 Ga0163163_10297383 3300014325 Bacteria 1666
156 Ga0157377_10000098 3300014745 Bacteria 62330
157 Ga0157376_10193719 3300014969 Bacteria 1865
158 Ga0157376_10930007 3300014969 Bacteria 889
159 Ga0213872_10001251 3300021361 Bacteria 17114
160 Ga0213872_10015243 3300021361 Bacteria 3577
161 Ga0213872_10084699 3300021361 Bacteria 1421
162 Ga0213872_10146883 3300021361 Bacteria 1032
163 Ga0209672_101407 3300025228 Bacteria 8788
164 Ga0209258_100447 3300025242 Bacteria 45725
165 Ga0209148_1000438 3300025254 Bacteria 45725
166 Ga0209455_1019625 3300025272 Bacteria 1360
167 Ga0209130_1003726 3300025284 Bacteria 6242
168 Ga0209676_1008257 3300025292 Bacteria 4679
169 Ga0209758_1000698 3300025297 Bacteria 49793
170 Ga0207426_1000215 3300025302 Bacteria 136757
171 Ga0207656_10003294 3300025321 Bacteria 5534
172 Ga0207710_10049082 3300025900 Bacteria 1890
173 Ga0207647_10001327 3300025904 Bacteria 18998
174 Ga0207645_10059917 3300025907 Bacteria 2431
175 Ga0207645_10077640 3300025907 Bacteria 2128
176 Ga0207643_10058623 3300025908 Bacteria 2195
177 Ga0207695_10000520 3300025913 Bacteria 81547
178 Ga0207695_10001752 3300025913 Bacteria 34438
179 Ga0207695_10014966 3300025913 Bacteria 9157
180 Ga0207695_10022447 3300025913 Bacteria 7161
181 Ga0207695_10042746 3300025913 Bacteria 4835
182 Ga0207695_10065145 3300025913 Bacteria 3747
183 Ga0207671_10000026 3300025914 Bacteria 268845
184 Ga0207671_10119440 3300025914 Bacteria 2014
185 Ga0207657_10157735 3300025919 Bacteria 1845
186 Ga0207694_10601416 3300025924 Bacteria 925
187 Ga0207650_10347345 3300025925 Bacteria 1220
188 Ga0207706_10041975 3300025933 Bacteria 4053
189 Ga0207709_10002802 3300025935 Bacteria 10733
190 Ga0207670_10043258 3300025936 Bacteria 2973
191 Ga0207704_10131654 3300025938 Bacteria 1733
192 Ga0207704_10187110 3300025938 Bacteria 1502
193 Ga0207691_10013421 3300025940 Bacteria 7842
194 Ga0207691_10021154 3300025940 Bacteria 6148
195 Ga0207711_10105941 3300025941 Bacteria 2494
196 Ga0207689_10112761 3300025942 Bacteria 2235
197 Ga0207667_10008300 3300025949 Bacteria 12355
198 Ga0207667_10011300 3300025949 Bacteria 10384
199 Ga0207667_10013017 3300025949 Bacteria 9549
200 Ga0207651_10017327 3300025960 Bacteria 4254
201 Ga0207651_10220801 3300025960 Bacteria 1532
202 Ga0207712_10000023 3300025961 Bacteria 282081
203 Ga0207668_10005232 3300025972 Bacteria 7634
204 Ga0207668_10146898 3300025972 Bacteria 1820
205 Ga0207668_10311238 3300025972 Bacteria 1303
206 Ga0207640_10000632 3300025981 Bacteria 20641
207 Ga0207640_10024208 3300025981 Bacteria 3661
208 Ga0207640_10387960 3300025981 Bacteria 1134
209 Ga0207658_10187008 3300025986 Bacteria 1719
210 Ga0207658_10409212 3300025986 Bacteria 1194
211 Ga0207677_10177490 3300026023 Bacteria 1672
212 Ga0207703_10065769 3300026035 Bacteria 2980
213 Ga0207639_10001101 3300026041 Bacteria 18339
214 Ga0207639_10011796 3300026041 Bacteria 6077
215 Ga0207639_10026252 3300026041 Bacteria 4232
216 Ga0207639_10791946 3300026041 Bacteria 883
217 Ga0207678_10015043 3300026067 Bacteria 6808
218 Ga0207678_10016702 3300026067 Bacteria 6446
219 Ga0207678_10061661 3300026067 Bacteria 3225
220 Ga0207678_10089132 3300026067 Bacteria 2637
221 Ga0207678_10128531 3300026067 Bacteria 2161
222 Ga0207678_10210964 3300026067 Bacteria 1661
223 Ga0207708_10034108 3300026075 Bacteria 3870
224 Ga0207641_10004331 3300026088 Bacteria 12321
225 Ga0207641_10306198 3300026088 Bacteria 1502
226 Ga0207648_10000614 3300026089 Bacteria 39971
227 Ga0207648_10077651 3300026089 Bacteria 2895
228 Ga0207676_10402276 3300026095 Bacteria 1280
229 Ga0207674_10000219 3300026116 Bacteria 71283
230 Ga0207674_10038049 3300026116 Bacteria 4999
231 Ga0207674_10053694 3300026116 Bacteria 4106
232 Ga0207675_100000779 3300026118 Bacteria 31810
233 Ga0207683_10006329 3300026121 Bacteria 10139
234 Ga0207698_10037228 3300026142 Bacteria 3581
235 Ga0207698_10829463 3300026142 Bacteria 928
236 Ga0209982_1006591 3300027552 Bacteria 1691
237 Ga0209983_1005918 3300027665 Bacteria 2524
238 Ga0209971_1021303 3300027682 Bacteria 1542
239 Ga0209974_10038082 3300027876 Bacteria 1598
240 Ga0207428_10002156 3300027907 Bacteria 19753
241 Ga0207428_10127428 3300027907 Bacteria 1949
242 Ga0268266_10051840 3300028379 Bacteria 3523
243 Ga0268266_10123388 3300028379 Bacteria 2308
244 Ga0268266_10161255 3300028379 Bacteria 2029
245 Ga0268265_10000137 3300028380 Bacteria 93389
246 Ga0268265_10000164 3300028380 Bacteria 80747
247 Ga0268265_10000547 3300028380 Bacteria 38290
248 Ga0268265_10296873 3300028380 Bacteria 1453
249 Ga0268264_10000512 3300028381 Bacteria 49877
250 Ga0268264_10459757 3300028381 Bacteria 1235
251 Ga0265326_10029055 3300028558 Bacteria 1575
252 Ga0265334_10013502 3300028573 Bacteria 3417
253 Ga0307515_10124638 3300028794 Bacteria 2889
254 Ga0265771_1000454 3300031010 Bacteria 1501
255 Ga0265328_10014265 3300031239 Bacteria 3131
256 Ga0265325_10227146 3300031241 Bacteria 852
257 Ga0265340_10012538 3300031247 Bacteria 4475
258 Ga0265327_10065703 3300031251 Bacteria 1833
259 Ga0265316_10225457 3300031344 Bacteria 1382
260 Ga0307513_10035922 3300031456 Bacteria 5539
261 Ga0307509_10281710 3300031507 Bacteria 1423
262 Ga0307408_100066320 3300031548 Bacteria 2651
263 Ga0307408_100401281 3300031548 Bacteria 1177
264 Ga0265313_10001342 3300031595 Bacteria 23180
265 Ga0265313_10081976 3300031595 Bacteria 1463
266 Ga0265314_10024772 3300031711 Bacteria 4541
267 Ga0265314_10034063 3300031711 Bacteria 3726
268 Ga0265314_10151443 3300031711 Bacteria 1422
269 Ga0265342_10243142 3300031712 Bacteria 963
270 Ga0316576_10063059 3300031727 Bacteria 2720
271 Ga0316578_10179961 3300031728 Bacteria 1274
272 Ga0307405_10613631 3300031731 Bacteria 889
273 Ga0307413_10304380 3300031824 Bacteria 1210
274 Ga0307406_10000297 3300031901 Bacteria 29339
275 Ga0307412_10102449 3300031911 Bacteria 2027
276 Ga0307409_100558808 3300031995 Bacteria 1125
277 Ga0307416_100275560 3300032002 Bacteria 1655
278 Ga0307416_100396638 3300032002 Bacteria 1416
279 Ga0307414_10011862 3300032004 Bacteria 5132
280 Ga0307411_10022689 3300032005 Bacteria 3701
281 Ga0307507_10043872 3300033179 Bacteria 4430
282 Ga0307507_10067439 3300033179 Bacteria 3272
283 Ga0373944_0117281 3300035089 Bacteria 914
284 Ga0316584_0218883 3300036712 Bacteria 1400
285 Ga0316584_0259224 3300036712 Bacteria 1268
286 Ga0395905_0220376 3300037471 Bacteria 1775
287 Ga0436364_0011659 3300037853 Bacteria 94648
288 Ga0237819_02473 3300038705 Bacteria 3701
289 Ga0400483_011190 3300039062 Bacteria 182340
290 Ga0400483_093214 3300039062 Bacteria 200340
291 Ga0400483_215675 3300039062 Bacteria 181282
292 Ga0400483_219863 3300039062 Bacteria 173210
293 Ga0436361_0075622 3300039447 Bacteria 1227
294 Ga0436361_0117668 3300039447 Bacteria 1074
295 Ga0436361_0319126 3300039447 Bacteria 20837
296 Ga0436361_0728505 3300039447 Bacteria 4966
297 Ga0436361_1162608 3300039447 Bacteria 10383
298 Ga0436362_0223885 3300039453 Bacteria 871
299 Ga0439436_0003694 3300041404 Bacteria 4666
300 Ga0439436_0007932 3300041404 Bacteria 3261
301 Ga0439436_0018212 3300041404 Bacteria 2100
302 Ga0439439_0000798 3300041406 Bacteria 5724
303 Ga0451789_0963123 3300041443 Bacteria 981
304 Ga0451855_0860111 3300041511 Bacteria 944
305 Ga0451853_3855578 3300041512 Bacteria 1805
306 Ga0439432_012052 3300042006 Bacteria 2968
307 Ga0439432_018258 3300042006 Bacteria 2345
308 Ga0439449_0004237 3300042007 Bacteria 5543
309 Ga0439449_0023528 3300042007 Bacteria 2303
310 Ga0439452_038264 3300042010 Bacteria 1140
311 Ga0439462_0033408 3300042015 Bacteria 1364
312 Ga0439462_0050636 3300042015 Bacteria 1116
313 Ga0466972_0021849 3300044658 Bacteria 3188
314 Ga0466965_0004446 3300044683 Bacteria 6235
315 Ga0466965_0010823 3300044683 Bacteria 4267
316 Ga0466966_0011388 3300044684 Bacteria 5899
317 Ga0466961_0000285 3300044693 Bacteria 33498
318 Ga0466961_0016695 3300044693 Bacteria 4720
319 Ga0466964_0346105 3300044706 Bacteria 762
320 Ga0453684_0001075 3300044712 Bacteria 86968
321 Ga0466957_0102690 3300044842 Bacteria 1804
322 Ga0466960_0041675 3300044901 Bacteria 2176
323 Ga0466959_0003330 3300045049 Bacteria 10495
324 Ga0466959_0078857 3300045049 Bacteria 2375
325 Ga0451576_0000025 3300045051 Bacteria 427980
326 Ga0466958_0133741 3300045836 Bacteria 1558
327 Ga0466967_0795182 3300045976 Bacteria 939
328 Ga0495590_0038893 3300046457 Bacteria 1659
329 Ga0495641_0107650 3300046461 Bacteria 1244
330 Ga0495580_0008442 3300046472 Bacteria 8194
331 Ga0495605_0086601 3300046474 Bacteria 1457
332 Ga0495605_0096692 3300046474 Bacteria 1362
333 Ga0495594_0187165 3300046499 Bacteria 1179
334 Ga0495583_0007674 3300046506 Bacteria 6724
335 Ga0495606_0000859 3300046507 Bacteria 45541
336 Ga0495616_0069696 3300046513 Bacteria 1704
337 Ga0495648_0003754 3300046524 Bacteria 13221
338 Ga0495648_0091954 3300046524 Bacteria 1695
339 Ga0495666_0141598 3300046526 Bacteria 1121
340 Ga0495622_0070668 3300046557 Bacteria 1611
341 Ga0495634_0348646 3300046642 Bacteria 887
342 Ga0495669_0020406 3300046684 Bacteria 2868
343 Ga0495649_0170941 3300046694 Bacteria 1137
344 Ga0495600_0129549 3300046809 Bacteria 1641
345 Ga0495674_0017846 3300047319 Bacteria 6608
346 Ga0495674_0035618 3300047319 Bacteria 4488
347 Ga0495672_0015871 3300047320 Bacteria 5099
348 Ga0495672_0065825 3300047320 Bacteria 2070
349 Ga0495676_0166764 3300047321 Bacteria 1553
350 Ga0495683_0001829 3300047323 Bacteria 13372
351 Ga0495683_0048498 3300047323 Bacteria 2129
352 Ga0495675_0195634 3300047444 Bacteria 1233
353 Ga0495673_0005404 3300047469 Bacteria 7733
354 Ga0495626_0058031 3300048091 Bacteria 1770
355 Ga0496100_0019100 3300048903 Bacteria 4081
356 Ga0496100_0023537 3300048903 Bacteria 3743
357 Ga0496100_0159035 3300048903 Bacteria 1618
358 Ga0496100_0176487 3300048903 Bacteria 1543
359 Ga0496101_0001443 3300048904 Bacteria 14188
360 Ga0496101_0016189 3300048904 Bacteria 5033
361 Ga0496101_0031944 3300048904 Bacteria 3704
362 Ga0496101_0102884 3300048904 Bacteria 2140
363 Ga0496101_0258968 3300048904 Bacteria 1356
364 Ga0496102_0001539 3300048905 Bacteria 20355
365 Ga0496102_0608027 3300048905 Bacteria 1016
366 Ga0496103_0000371 3300048906 Bacteria 40307
367 Ga0496104_0000303 3300048907 Bacteria 43795
368 Ga0496104_0000713 3300048907 Bacteria 28574
369 Ga0496104_0009732 3300048907 Bacteria 8568
370 Ga0496104_0013391 3300048907 Bacteria 7391
371 Ga0496104_0027609 3300048907 Bacteria 5255
372 Ga0496104_0065720 3300048907 Bacteria 3442
373 Ga0496105_0000554 3300048908 Bacteria 24707
374 Ga0496105_0000693 3300048908 Bacteria 22693
375 Ga0496105_0001496 3300048908 Bacteria 16513
376 Ga0496105_0002549 3300048908 Bacteria 13221
377 Ga0496105_0018364 3300048908 Bacteria 5618
378 Ga0496105_0070818 3300048908 Bacteria 2882
379 Ga0496106_0046413 3300048909 Bacteria 3266
380 Ga0496106_0376745 3300048909 Bacteria 1140
381 Ga0496107_0021284 3300048910 Bacteria 4584
382 Ga0496107_0361471 3300048910 Bacteria 1080
383 Ga0496108_0011366 3300048911 Bacteria 7235
384 Ga0496108_0719938 3300048911 Bacteria 865
385 Ga0496109_0001233 3300048912 Bacteria 21242
386 Ga0496110_0027242 3300048913 Bacteria 4898
387 Ga0496110_0067115 3300048913 Bacteria 3173
388 Ga0496110_0398166 3300048913 Bacteria 1255
389 Ga0496111_0000819 3300048914 Bacteria 16705
390 Ga0496111_0088629 3300048914 Bacteria 2266
391 Ga0496112_0002425 3300048915 Bacteria 15010
392 Ga0496112_0028185 3300048915 Bacteria 5418
393 Ga0496112_0237324 3300048915 Bacteria 1777
394 Ga0496112_0405711 3300048915 Bacteria 1302
395 Ga0496113_0000636 3300048916 Bacteria 17648
396 Ga0496113_0006616 3300048916 Bacteria 7371
397 Ga0496113_0042470 3300048916 Bacteria 3360
398 Ga0496114_0117756 3300048917 Bacteria 2282
399 Ga0496115_0019682 3300048918 Bacteria 5197
400 Ga0496115_0027822 3300048918 Bacteria 4426
401 Ga0496115_0038542 3300048918 Bacteria 3792
402 Ga0496115_0174178 3300048918 Bacteria 1779
403 Ga0496117_0002705 3300048920 Bacteria 21898
404 Ga0496117_0103635 3300048920 Bacteria 1792
405 Ga0496118_0000698 3300048921 Bacteria 54435
406 Ga0496118_0006725 3300048921 Bacteria 12529
407 Ga0496118_0010118 3300048921 Bacteria 9376
408 Ga0496119_0002149 3300048922 Bacteria 22159
409 Ga0496119_0023633 3300048922 Bacteria 4350
410 Ga0496119_0035658 3300048922 Bacteria 3256
411 Ga0496119_0046469 3300048922 Bacteria 2711
412 Ga0496119_0121233 3300048922 Bacteria 1437
413 Ga0496120_0000505 3300048923 Bacteria 60875
414 Ga0496120_0009890 3300048923 Bacteria 6717
415 Ga0496120_0177986 3300048923 Bacteria 1047
416 Ga0496120_0184684 3300048923 Bacteria 1021
417 Ga0496121_0001198 3300048924 Bacteria 45422
418 Ga0496121_0001778 3300048924 Bacteria 34958
419 Ga0496121_0010022 3300048924 Bacteria 10765
420 Ga0496121_0032282 3300048924 Bacteria 4764
421 Ga0496121_0222220 3300048924 Bacteria 1329
422 Ga0496122_0132861 3300048925 Bacteria 1577
423 Ga0496125_0025836 3300048928 Bacteria 5368
424 Ga0496126_0003502 3300048929 Bacteria 19805
425 Ga0496126_0233298 3300048929 Bacteria 1541
426 Ga0495682_0001483 3300049460 Bacteria 12534
427 Ga0495682_0003355 3300049460 Bacteria 7146
428 Ga0501300_012312 3300049523 Bacteria 1247
429 Ga0501031_0002340 3300049568 Bacteria 12000
430 Ga0501031_0004589 3300049568 Bacteria 8956
431 Ga0501032_0098654 3300049569 Bacteria 1935
432 Ga0501032_0121509 3300049569 Bacteria 1726
433 Ga0501033_0050319 3300049570 Bacteria 3091
434 Ga0501033_0081465 3300049570 Bacteria 2374
435 Ga0501033_0409128 3300049570 Bacteria 945
436 Ga0501034_0002289 3300049571 Bacteria 23506
437 Ga0501034_0386157 3300049571 Bacteria 1324
438 Ga0501034_0414282 3300049571 Bacteria 1269
439 Ga0501036_0070548 3300049572 Bacteria 2954
440 Ga0501036_0084941 3300049572 Bacteria 2676
441 Ga0501036_0581690 3300049572 Bacteria 930
442 Ga0501037_0024859 3300049573 Bacteria 4428
443 Ga0501037_0034349 3300049573 Bacteria 3741
444 Ga0501037_0120426 3300049573 Bacteria 1887
445 Ga0501037_0241413 3300049573 Bacteria 1266
446 Ga0501038_0006839 3300049574 Bacteria 10535
447 Ga0501038_0025833 3300049574 Bacteria 5232
448 Ga0501039_0002455 3300049575 Bacteria 13802
449 Ga0501039_0019269 3300049575 Bacteria 5232
450 Ga0501039_0054822 3300049575 Bacteria 3086
451 Ga0501040_0001281 3300049576 Bacteria 15982
452 Ga0501040_0031172 3300049576 Bacteria 3601
453 Ga0501040_0165056 3300049576 Bacteria 1566
454 Ga0501041_0000998 3300049577 Bacteria 15459
455 Ga0501042_0004027 3300049578 Bacteria 9310
456 Ga0501042_0011146 3300049578 Bacteria 6057
457 Ga0501042_0292046 3300049578 Bacteria 1177
458 Ga0501043_0137534 3300049579 Bacteria 1913
459 Ga0501046_0028278 3300049580 Bacteria 4567
460 Ga0501046_0129870 3300049580 Bacteria 1911
461 Ga0501047_0102039 3300049581 Bacteria 2748
462 Ga0501048_0005038 3300049582 Bacteria 10071
463 Ga0501048_0034694 3300049582 Bacteria 3637
464 Ga0501048_0047128 3300049582 Bacteria 3075
465 Ga0501067_0049349 3300049583 Bacteria 2332
466 Ga0501068_0014546 3300049584 Bacteria 4500
467 Ga0501069_0000759 3300049585 Bacteria 15083
468 Ga0501070_0050193 3300049586 Bacteria 3463
469 Ga0501070_0140373 3300049586 Bacteria 1995
470 Ga0501071_0004084 3300049587 Bacteria 9226
471 Ga0501071_0115109 3300049587 Bacteria 1989
472 Ga0501071_0283615 3300049587 Bacteria 1253
473 Ga0501072_0002683 3300049588 Bacteria 13352
474 Ga0501072_0175911 3300049588 Bacteria 1707
475 Ga0501072_0312678 3300049588 Bacteria 1248
476 Ga0501073_0013314 3300049589 Bacteria 5989
477 Ga0501073_0042629 3300049589 Bacteria 3202
478 Ga0501073_0054648 3300049589 Bacteria 2795
479 Ga0501073_0227307 3300049589 Bacteria 1289
480 Ga0501074_0006764 3300049590 Bacteria 8275
481 Ga0501074_0031514 3300049590 Bacteria 3840
482 Ga0501074_0061768 3300049590 Bacteria 2699
483 Ga0501075_0000491 3300049591 Bacteria 23672
484 Ga0501075_0159507 3300049591 Bacteria 1720
485 Ga0501076_0002706 3300049592 Bacteria 12252
486 Ga0501076_0122088 3300049592 Bacteria 2109
487 Ga0501076_0131973 3300049592 Bacteria 2026
488 Ga0501077_0004253 3300049593 Bacteria 8652
489 Ga0501077_0103344 3300049593 Bacteria 1805
490 Ga0501239_002223 3300049672 Bacteria 1745
491 Ga0501079_0012112 3300049741 Bacteria 6583
492 Ga0501080_0019681 3300049742 Bacteria 6251
493 Ga0501080_0064742 3300049742 Bacteria 3400
494 Ga0501080_0186262 3300049742 Bacteria 1908
495 Ga0501080_0187500 3300049742 Bacteria 1902
496 Ga0501080_0374699 3300049742 Bacteria 1283
497 Ga0501081_0001389 3300049743 Bacteria 14771
498 Ga0501083_0002183 3300049744 Bacteria 13384
499 Ga0501083_0003882 3300049744 Bacteria 10497
500 Ga0501083_0014533 3300049744 Bacteria 5505
501 Ga0501083_0241490 3300049744 Bacteria 1176
502 Ga0501241_046467 3300049758 Bacteria 851
503 Ga0501280_001227 3300049776 Bacteria 5001
504 Ga0501282_001588 3300049778 Bacteria 2516
505 Ga0501035_0006601 3300049822 Bacteria 10862
506 Ga0501035_0027804 3300049822 Bacteria 5169
507 Ga0501035_0112301 3300049822 Bacteria 2387
508 Ga0501035_0144195 3300049822 Bacteria 2069
509 Ga0501044_0001614 3300049823 Bacteria 26409
510 Ga0501044_0007794 3300049823 Bacteria 11770
511 Ga0501044_0021241 3300049823 Bacteria 6930
512 Ga0501044_0043349 3300049823 Bacteria 4674
513 Ga0501044_0418010 3300049823 Bacteria 1251
514 Ga0501045_0011691 3300049824 Bacteria 6165
515 nmdc:mga0k408_76839_c1 3300050493 Bacteria 1952
516 nmdc:mga05p37_3848_c1 3300050507 Bacteria 15141
517 nmdc:mga05p37_429170_c1 3300050507 Bacteria 1536
518 nmdc:mga05p37_586549_c1 3300050507 Bacteria 1261
519 nmdc:mga05p37_6663_c1 3300050507 Bacteria 13628
520 nmdc:mga09592_16048_c1 3300050508 Bacteria 6123
521 nmdc:mga09592_29529_c1 3300050508 Bacteria 4559
522 nmdc:mga09592_755_c1 3300050508 Bacteria 24846
523 nmdc:mga0qj67_10964_c1 3300050509 Bacteria 6783
524 nmdc:mga0qj67_741_c1 3300050509 Bacteria 22140
525 nmdc:mga06r32_2020_c1 3300050510 Bacteria 18156
526 nmdc:mga06r32_331256_c1 3300050510 Bacteria 1507
527 nmdc:mga06r32_45332_c1 3300050510 Bacteria 4191
528 nmdc:mga06r32_63_c1 3300050510 Bacteria 68165
529 nmdc:mga08y16_254_c1 3300050511 Bacteria 48008
530 nmdc:mga08y16_57862_c1 3300050511 Bacteria 4050
531 Ga0495601_0355123 3300053077 Bacteria 953
532 Ga0495619_0019882 3300053085 Bacteria 4274
533 Ga0500643_054119 3300053087 Bacteria 1140
534 Ga0500583_0004078 3300053092 Bacteria 4705
535 Ga0500597_027597 3300053120 Bacteria 2308
536 Ga0500652_089760 3300053131 Bacteria 1283
537 Ga0500559_0011170 3300053136 Bacteria 3841
538 Ga0500568_0000435 3300053139 Bacteria 31407
539 Ga0500573_0000016 3300053140 Bacteria 182675
540 Ga0500622_0007927 3300053156 Bacteria 5980
541 Ga0500624_000043 3300053157 Bacteria 90095
542 Ga0500637_0000089 3300053178 Bacteria 32896
543 Ga0501084_0003070 3300054114 Bacteria 13530
544 Ga0501084_0005932 3300054114 Bacteria 10059
545 Ga0501084_0088532 3300054114 Bacteria 2599
546 Ga0501082_0004147 3300060353 Bacteria 12666
547 Ga0501082_0006298 3300060353 Bacteria 10291
548 Ga0501082_0112190 3300060353 Bacteria 2360
549 Ga0530510_0002822 3300061734 Bacteria 11948
550 Ga0530510_0095604 3300061734 Bacteria 2171
551 Ga0530510_0395219 3300061734 Bacteria 1041

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0860111 Ga0451855_0860111_54_638 175
2 3300049672 Ga0501239_002223 Ga0501239_002223_1042_1734 200
3 3300053140 Ga0500573_0000016 Ga0500573_0000016_87981_88628 215
4 3300005328 Ga0070676_10052441 Ga0070676_100524412 217
5 3300005337 Ga0070682_100499447 Ga0070682_1004994471 217
6 3300005339 Ga0070660_100162258 Ga0070660_1001622581 217
7 3300005347 Ga0070668_100066227 Ga0070668_1000662273 217
8 3300005353 Ga0070669_100063099 Ga0070669_1000630993 217
9 3300005441 Ga0070700_100047517 Ga0070700_1000475172 217
10 3300005455 Ga0070663_100317809 Ga0070663_1003178092 217
11 3300005457 Ga0070662_100048167 Ga0070662_1000481672 217
12 3300005543 Ga0070672_100286340 Ga0070672_1002863402 217
13 3300005719 Ga0068861_100015016 Ga0068861_1000150162 217
14 3300005844 Ga0068862_100000722 Ga0068862_10000072220 217
15 3300006844 Ga0075428_100007767 Ga0075428_1000077676 217
16 3300006846 Ga0075430_100000458 Ga0075430_10000045811 217
17 3300006846 Ga0075430_100011525 Ga0075430_1000115253 217
18 3300006847 Ga0075431_100000243 Ga0075431_10000024313 217
19 3300006847 Ga0075431_100000267 Ga0075431_10000026720 217
20 3300006847 Ga0075431_100003216 Ga0075431_10000321610 217
21 3300006880 Ga0075429_100000445 Ga0075429_10000044511 217
22 3300006880 Ga0075429_100001924 Ga0075429_1000019249 217
23 3300006880 Ga0075429_100341034 Ga0075429_1003410342 217
24 3300006881 Ga0068865_100245651 Ga0068865_1002456512 217
25 3300009094 Ga0111539_10000989 Ga0111539_1000098919 217
26 3300009094 Ga0111539_10041545 Ga0111539_100415454 217
27 3300009147 Ga0114129_10001320 Ga0114129_1000132012 217
28 3300009147 Ga0114129_10029160 Ga0114129_100291609 217
29 3300009147 Ga0114129_10279423 Ga0114129_102794232 217
30 3300010375 Ga0105239_10238031 Ga0105239_102380313 217
31 3300011119 Ga0105246_10081279 Ga0105246_100812792 217
32 3300025907 Ga0207645_10059917 Ga0207645_100599172 217
33 3300025919 Ga0207657_10157735 Ga0207657_101577352 217
34 3300025933 Ga0207706_10041975 Ga0207706_100419752 217
35 3300025938 Ga0207704_10187110 Ga0207704_101871102 217
36 3300025972 Ga0207668_10005232 Ga0207668_100052323 217
37 3300025981 Ga0207640_10387960 Ga0207640_103879601 217
38 3300026067 Ga0207678_10210964 Ga0207678_102109641 217
39 3300026075 Ga0207708_10034108 Ga0207708_100341083 217
40 3300026118 Ga0207675_100000779 Ga0207675_1000007798 217
41 3300027907 Ga0207428_10002156 Ga0207428_100021563 217
42 3300027907 Ga0207428_10127428 Ga0207428_101274282 217
43 3300028380 Ga0268265_10000547 Ga0268265_1000054720 217
44 3300032002 Ga0307416_100275560 Ga0307416_1002755602 217
45 3300050507 nmdc:mga05p37_3848_c1 nmdc:mga05p37_3848_c1_12236_12901 217
46 3300050507 nmdc:mga05p37_586549_c1 nmdc:mga05p37_586549_c1_393_1103 217
47 3300050507 nmdc:mga05p37_6663_c1 nmdc:mga05p37_6663_c1_5699_6364 217
48 3300050508 nmdc:mga09592_16048_c1 nmdc:mga09592_16048_c1_4437_5102 217
49 3300050508 nmdc:mga09592_755_c1 nmdc:mga09592_755_c1_9498_10163 217
50 3300050509 nmdc:mga0qj67_741_c1 nmdc:mga0qj67_741_c1_3148_3813 217
51 3300050510 nmdc:mga06r32_2020_c1 nmdc:mga06r32_2020_c1_5090_5755 217
52 3300050510 nmdc:mga06r32_331256_c1 nmdc:mga06r32_331256_c1_548_1213 217
53 3300050510 nmdc:mga06r32_45332_c1 nmdc:mga06r32_45332_c1_2816_3481 217
54 3300050510 nmdc:mga06r32_63_c1 nmdc:mga06r32_63_c1_42614_43279 217
55 3300050511 nmdc:mga08y16_254_c1 nmdc:mga08y16_254_c1_6045_6710 217
56 3300050511 nmdc:mga08y16_57862_c1 nmdc:mga08y16_57862_c1_1663_2328 217
57 3300044712 Ga0453684_0001075 Ga0453684_0001075_28231_28911 219
58 3300045051 Ga0451576_0000025 Ga0451576_0000025_57817_58497 219
59 iso_pu_bacteria 2939631187 2939633067 219
60 3300005577 Ga0068857_100055534 Ga0068857_1000555344 220
61 3300003354 JGI25160J50197_1000208 JGI25160J50197_100020812 222
62 3300005262 Ga0065165_1000119 Ga0065165_10001199 222
63 3300005455 Ga0070663_100102577 Ga0070663_1001025773 222
64 3300005616 Ga0068852_100297830 Ga0068852_1002978302 222
65 3300025284 Ga0209130_1003726 Ga0209130_10037262 222
66 3300025302 Ga0207426_1000215 Ga0207426_100021510 222
67 3300026067 Ga0207678_10128531 Ga0207678_101285311 222
68 3300031595 Ga0265313_10081976 Ga0265313_100819761 222
69 3300046457 Ga0495590_0038893 Ga0495590_0038893_926_1630 222
70 3300046472 Ga0495580_0008442 Ga0495580_0008442_232_1041 222
71 3300046474 Ga0495605_0086601 Ga0495605_0086601_672_1376 222
72 3300046474 Ga0495605_0096692 Ga0495605_0096692_112_888 222
73 3300046506 Ga0495583_0007674 Ga0495583_0007674_1297_2073 222
74 3300046513 Ga0495616_0069696 Ga0495616_0069696_632_1441 222
75 3300046524 Ga0495648_0003754 Ga0495648_0003754_1523_2299 222
76 3300046524 Ga0495648_0091954 Ga0495648_0091954_572_1381 222
77 3300046526 Ga0495666_0141598 Ga0495666_0141598_39_848 222
78 3300046557 Ga0495622_0070668 Ga0495622_0070668_765_1541 222
79 3300046684 Ga0495669_0020406 Ga0495669_0020406_1774_2478 222
80 3300046694 Ga0495649_0170941 Ga0495649_0170941_61_837 222
81 3300047319 Ga0495674_0017846 Ga0495674_0017846_2514_3323 222
82 3300047319 Ga0495674_0035618 Ga0495674_0035618_1516_2292 222
83 3300047320 Ga0495672_0015871 Ga0495672_0015871_27_836 222
84 3300047323 Ga0495683_0001829 Ga0495683_0001829_1621_2397 222
85 3300047323 Ga0495683_0048498 Ga0495683_0048498_169_978 222
86 3300047469 Ga0495673_0005404 Ga0495673_0005404_5379_6188 222
87 3300048091 Ga0495626_0058031 Ga0495626_0058031_290_1099 222
88 3300048903 Ga0496100_0019100 Ga0496100_0019100_1329_2138 222
89 3300048903 Ga0496100_0023537 Ga0496100_0023537_1269_2045 222
90 3300048903 Ga0496100_0159035 Ga0496100_0159035_626_1435 222
91 3300048904 Ga0496101_0001443 Ga0496101_0001443_2791_3600 222
92 3300048904 Ga0496101_0102884 Ga0496101_0102884_215_991 222
93 3300048904 Ga0496101_0258968 Ga0496101_0258968_378_1187 222
94 3300048905 Ga0496102_0001539 Ga0496102_0001539_17203_18012 222
95 3300048906 Ga0496103_0000371 Ga0496103_0000371_35301_36110 222
96 3300048907 Ga0496104_0013391 Ga0496104_0013391_3346_4155 222
97 3300048907 Ga0496104_0065720 Ga0496104_0065720_1814_2623 222
98 3300048908 Ga0496105_0018364 Ga0496105_0018364_1700_2476 222
99 3300048908 Ga0496105_0070818 Ga0496105_0070818_1691_2500 222
100 3300048909 Ga0496106_0046413 Ga0496106_0046413_902_1678 222
101 3300048909 Ga0496106_0376745 Ga0496106_0376745_310_1041 222
102 3300048910 Ga0496107_0361471 Ga0496107_0361471_228_1004 222
103 3300048913 Ga0496110_0398166 Ga0496110_0398166_191_967 222
104 3300048915 Ga0496112_0028185 Ga0496112_0028185_4316_5125 222
105 3300048915 Ga0496112_0237324 Ga0496112_0237324_379_1188 222
106 3300048915 Ga0496112_0405711 Ga0496112_0405711_330_1106 222
107 3300048916 Ga0496113_0006616 Ga0496113_0006616_225_1001 222
108 3300048916 Ga0496113_0042470 Ga0496113_0042470_438_1142 222
109 3300048918 Ga0496115_0174178 Ga0496115_0174178_450_1259 222
110 3300048920 Ga0496117_0002705 Ga0496117_0002705_17203_18012 222
111 3300048921 Ga0496118_0000698 Ga0496118_0000698_17203_18012 222
112 3300048922 Ga0496119_0023633 Ga0496119_0023633_1533_2342 222
113 3300048922 Ga0496119_0035658 Ga0496119_0035658_177_986 222
114 3300048922 Ga0496119_0121233 Ga0496119_0121233_53_757 222
115 3300048923 Ga0496120_0177986 Ga0496120_0177986_47_856 222
116 3300048923 Ga0496120_0184684 Ga0496120_0184684_220_954 222
117 3300048924 Ga0496121_0001198 Ga0496121_0001198_17203_18012 222
118 3300048924 Ga0496121_0001778 Ga0496121_0001778_22670_23479 222
119 3300048925 Ga0496122_0132861 Ga0496122_0132861_168_977 222
120 3300048929 Ga0496126_0233298 Ga0496126_0233298_179_910 222
121 3300049460 Ga0495682_0001483 Ga0495682_0001483_9272_10048 222
122 3300049460 Ga0495682_0003355 Ga0495682_0003355_6181_6990 222
123 3300053136 Ga0500559_0011170 Ga0500559_0011170_2492_3190 222
124 iso_pu_bacteria 2562617112 2563063185 222
125 iso_pu_bacteria 2562617112 2563065059 222
126 iso_pu_bacteria 2711768613 2713477393 222
127 iso_pu_bacteria 2711768613 2713481953 222
128 iso_pu_bacteria 2921643360 2921645198 222
129 3300005288 Ga0065714_10064584 Ga0065714_1006458412 223
130 3300005471 Ga0070698_100229368 Ga0070698_1002293682 223
131 3300028794 Ga0307515_10124638 Ga0307515_101246382 223
132 3300046507 Ga0495606_0000859 Ga0495606_0000859_8487_9167 223
133 3300053156 Ga0500622_0007927 Ga0500622_0007927_2121_2801 223
134 3300031727 Ga0316576_10063059 Ga0316576_100630593 224
135 3300031728 Ga0316578_10179961 Ga0316578_101799612 224
136 3300036712 Ga0316584_0218883 Ga0316584_0218883_429_1109 224
137 3300036712 Ga0316584_0259224 Ga0316584_0259224_119_799 224
138 iso_pu_bacteria 2643221560 2643820808 224
139 3300003320 rootH2_10040930 rootH2_100409307 225
140 3300005329 Ga0070683_100520267 Ga0070683_1005202672 225
141 3300005455 Ga0070663_100047590 Ga0070663_1000475902 225
142 3300005458 Ga0070681_10040601 Ga0070681_100406016 225
143 3300005539 Ga0068853_100012222 Ga0068853_1000122227 225
144 3300005563 Ga0068855_100232030 Ga0068855_1002320302 225
145 3300005577 Ga0068857_100018771 Ga0068857_1000187717 225
146 3300026041 Ga0207639_10026252 Ga0207639_100262523 225
147 3300026116 Ga0207674_10053694 Ga0207674_100536947 225
148 3300031344 Ga0265316_10225457 Ga0265316_102254572 226
149 3300047320 Ga0495672_0065825 Ga0495672_0065825_965_1657 226
150 3300053120 Ga0500597_027597 Ga0500597_027597_19_705 226
151 3300053157 Ga0500624_000043 Ga0500624_000043_67950_68636 226
152 3300053178 Ga0500637_0000089 Ga0500637_0000089_7633_8319 226
153 iso_pu_bacteria 2643221559 2643816959 226
154 iso_pu_bacteria 2643221573 2643881244 226
155 iso_pu_bacteria 2643221586 2643939381 226
156 iso_pu_bacteria 2643221612 2644078062 226
157 iso_pu_bacteria 2643221695 2644528590 226
158 iso_pu_bacteria 2643221720 2644662017 226
159 iso_pu_bacteria 2643221727 2644696363 226
160 iso_pu_bacteria 2643221728 2644700155 226
161 3300005328 Ga0070676_10090935 Ga0070676_100909352 227
162 3300005331 Ga0070670_100449375 Ga0070670_1004493752 227
163 3300005334 Ga0068869_100129853 Ga0068869_1001298532 227
164 3300005335 Ga0070666_10089653 Ga0070666_100896533 227
165 3300005338 Ga0068868_100105906 Ga0068868_1001059062 227
166 3300005340 Ga0070689_100066378 Ga0070689_1000663781 227
167 3300005347 Ga0070668_100075258 Ga0070668_1000752582 227
168 3300005353 Ga0070669_100063183 Ga0070669_1000631832 227
169 3300005354 Ga0070675_100063084 Ga0070675_1000630842 227
170 3300005364 Ga0070673_100085091 Ga0070673_1000850913 227
171 3300005456 Ga0070678_100183402 Ga0070678_1001834022 227
172 3300005543 Ga0070672_100093733 Ga0070672_1000937333 227
173 3300005548 Ga0070665_100259614 Ga0070665_1002596142 227
174 3300005840 Ga0068870_10021051 Ga0068870_100210514 227
175 3300005841 Ga0068863_100005629 Ga0068863_1000056293 227
176 3300005843 Ga0068860_100287451 Ga0068860_1002874512 227
177 3300005844 Ga0068862_100001530 Ga0068862_1000015307 227
178 3300006358 Ga0068871_100629097 Ga0068871_1006290971 227
179 3300006881 Ga0068865_100008801 Ga0068865_1000088012 227
180 3300009101 Ga0105247_10074639 Ga0105247_100746392 227
181 3300009553 Ga0105249_10000015 Ga0105249_1000001546 227
182 3300011119 Ga0105246_10518216 Ga0105246_105182162 227
183 3300014969 Ga0157376_10930007 Ga0157376_109300071 227
184 3300025900 Ga0207710_10049082 Ga0207710_100490822 227
185 3300025907 Ga0207645_10077640 Ga0207645_100776402 227
186 3300025908 Ga0207643_10058623 Ga0207643_100586232 227
187 3300025925 Ga0207650_10347345 Ga0207650_103473451 227
188 3300025936 Ga0207670_10043258 Ga0207670_100432583 227
189 3300025938 Ga0207704_10131654 Ga0207704_101316542 227
190 3300025940 Ga0207691_10013421 Ga0207691_100134217 227
191 3300025942 Ga0207689_10112761 Ga0207689_101127612 227
192 3300025960 Ga0207651_10017327 Ga0207651_100173272 227
193 3300025961 Ga0207712_10000023 Ga0207712_10000023239 227
194 3300025972 Ga0207668_10146898 Ga0207668_101468982 227
195 3300026023 Ga0207677_10177490 Ga0207677_101774902 227
196 3300026088 Ga0207641_10004331 Ga0207641_100043319 227
197 3300026089 Ga0207648_10077651 Ga0207648_100776512 227
198 3300026121 Ga0207683_10006329 Ga0207683_100063298 227
199 3300028380 Ga0268265_10000164 Ga0268265_100001646 227
200 3300028381 Ga0268264_10000512 Ga0268264_100005122 227
201 3300031251 Ga0265327_10065703 Ga0265327_100657032 227
202 3300031456 Ga0307513_10035922 Ga0307513_100359224 227
203 3300039062 Ga0400483_011190 Ga0400483_011190_99972_100667 227
204 3300039062 Ga0400483_215675 Ga0400483_215675_99634_100329 227
205 3300046499 Ga0495594_0187165 Ga0495594_0187165_415_1101 227
206 iso_pu_bacteria 2522572158 2523102838 227
207 iso_pu_bacteria 2571042365 2572256267 227
208 iso_pu_bacteria 2597490356 2599105892 227
209 iso_pu_bacteria 2846952575 2846955677 227
210 iso_pu_bacteria 2848858292 2848862338 227
211 3300012481 Ga0157320_1004295 Ga0157320_10042951 228
212 3300032004 Ga0307414_10011862 Ga0307414_100118623 228
213 3300041512 Ga0451853_3855578 Ga0451853_3855578_848_1537 228
214 3300048922 Ga0496119_0046469 Ga0496119_0046469_915_1604 228
215 3300048923 Ga0496120_0009890 Ga0496120_0009890_1217_1906 228
216 3300049573 Ga0501037_0241413 Ga0501037_0241413_199_897 228
217 3300049822 Ga0501035_0112301 Ga0501035_0112301_1380_2078 228
218 3300049823 Ga0501044_0021241 Ga0501044_0021241_25_723 228
219 3300005617 Ga0068859_101021260 Ga0068859_1010212602 229
220 3300005983 Ga0081540_1010382 Ga0081540_10103829 229
221 3300006931 Ga0097620_101021339 Ga0097620_1010213392 229
222 3300009979 Ga0105032_101076 Ga0105032_1010762 229
223 3300021361 Ga0213872_10084699 Ga0213872_100846992 229
224 3300028558 Ga0265326_10029055 Ga0265326_100290551 229
225 3300028573 Ga0265334_10013502 Ga0265334_100135023 229
226 3300031247 Ga0265340_10012538 Ga0265340_100125385 229
227 3300031507 Ga0307509_10281710 Ga0307509_102817102 229
228 3300031711 Ga0265314_10034063 Ga0265314_100340634 229
229 3300033179 Ga0307507_10043872 Ga0307507_100438725 229
230 3300038705 Ga0237819_02473 Ga0237819_02473_2441_3139 229
231 3300039062 Ga0400483_093214 Ga0400483_093214_181317_182018 229
232 3300039062 Ga0400483_093214 Ga0400483_093214_18323_19024 229
233 3300039062 Ga0400483_219863 Ga0400483_219863_91352_92053 229
234 3300039447 Ga0436361_1162608 Ga0436361_1162608_3302_3991 229
235 3300002067 JGI24735J21928_10068943 JGI24735J21928_100689431 230
236 3300002067 JGI24735J21928_10073514 JGI24735J21928_100735141 230
237 3300003215 JGI25153J46596_10051962 JGI25153J46596_100519622 230
238 3300003578 Ga0006562J51391_1117239 Ga0006562J51391_11172395 230
239 3300003761 Ga0055535_1000480 Ga0055535_100048025 230
240 3300003762 Ga0055542_1000498 Ga0055542_10004988 230
241 3300005455 Ga0070663_100015745 Ga0070663_1000157453 230
242 3300005457 Ga0070662_100057900 Ga0070662_1000579003 230
243 3300005546 Ga0070696_100034236 Ga0070696_1000342362 230
244 3300005563 Ga0068855_100036599 Ga0068855_1000365997 230
245 3300005563 Ga0068855_100048401 Ga0068855_1000484013 230
246 3300005577 Ga0068857_100001325 Ga0068857_1000013253 230
247 3300005578 Ga0068854_100005095 Ga0068854_1000050957 230
248 3300005578 Ga0068854_100037766 Ga0068854_1000377661 230
249 3300005616 Ga0068852_100211265 Ga0068852_1002112652 230
250 3300005616 Ga0068852_100226744 Ga0068852_1002267441 230
251 3300005834 Ga0068851_10001014 Ga0068851_100010143 230
252 3300005842 Ga0068858_100095249 Ga0068858_1000952492 230
253 3300005937 Ga0081455_10051486 Ga0081455_100514862 230
254 3300006028 Ga0070717_10065536 Ga0070717_100655362 230
255 3300006195 Ga0075366_10301756 Ga0075366_103017561 230
256 3300006846 Ga0075430_100013283 Ga0075430_1000132832 230
257 3300006847 Ga0075431_100008297 Ga0075431_1000082977 230
258 3300006880 Ga0075429_100085573 Ga0075429_1000855733 230
259 3300009093 Ga0105240_10001295 Ga0105240_100012956 230
260 3300009093 Ga0105240_10016935 Ga0105240_100169356 230
261 3300009093 Ga0105240_10050609 Ga0105240_100506092 230
262 3300009093 Ga0105240_10073268 Ga0105240_100732685 230
263 3300009147 Ga0114129_10528959 Ga0114129_105289592 230
264 3300009545 Ga0105237_10000058 Ga0105237_1000005867 230
265 3300009551 Ga0105238_10169745 Ga0105238_101697452 230
266 3300009551 Ga0105238_10661953 Ga0105238_106619531 230
267 3300010375 Ga0105239_10001092 Ga0105239_1000109215 230
268 3300013105 Ga0157369_10044126 Ga0157369_100441261 230
269 3300014325 Ga0163163_10004056 Ga0163163_1000405612 230
270 3300021361 Ga0213872_10015243 Ga0213872_100152434 230
271 3300025228 Ga0209672_101407 Ga0209672_1014078 230
272 3300025242 Ga0209258_100447 Ga0209258_10044717 230
273 3300025254 Ga0209148_1000438 Ga0209148_100043817 230
274 3300025272 Ga0209455_1019625 Ga0209455_10196252 230
275 3300025297 Ga0209758_1000698 Ga0209758_100069838 230
276 3300025321 Ga0207656_10003294 Ga0207656_100032947 230
277 3300025904 Ga0207647_10001327 Ga0207647_100013272 230
278 3300025913 Ga0207695_10000520 Ga0207695_1000052064 230
279 3300025913 Ga0207695_10001752 Ga0207695_1000175226 230
280 3300025913 Ga0207695_10014966 Ga0207695_100149667 230
281 3300025913 Ga0207695_10022447 Ga0207695_100224473 230
282 3300025913 Ga0207695_10042746 Ga0207695_100427462 230
283 3300025913 Ga0207695_10065145 Ga0207695_100651454 230
284 3300025914 Ga0207671_10000026 Ga0207671_10000026183 230
285 3300025924 Ga0207694_10601416 Ga0207694_106014161 230
286 3300025949 Ga0207667_10011300 Ga0207667_100113005 230
287 3300025949 Ga0207667_10013017 Ga0207667_100130177 230
288 3300025981 Ga0207640_10000632 Ga0207640_1000063213 230
289 3300025981 Ga0207640_10024208 Ga0207640_100242084 230
290 3300026035 Ga0207703_10065769 Ga0207703_100657692 230
291 3300026067 Ga0207678_10089132 Ga0207678_100891321 230
292 3300026095 Ga0207676_10402276 Ga0207676_104022762 230
293 3300026116 Ga0207674_10000219 Ga0207674_1000021967 230
294 3300026142 Ga0207698_10037228 Ga0207698_100372285 230
295 3300031010 Ga0265771_1000454 Ga0265771_10004542 230
296 3300031241 Ga0265325_10227146 Ga0265325_102271461 230
297 3300031548 Ga0307408_100066320 Ga0307408_1000663202 230
298 3300031548 Ga0307408_100401281 Ga0307408_1004012811 230
299 3300031595 Ga0265313_10001342 Ga0265313_100013422 230
300 3300031711 Ga0265314_10024772 Ga0265314_100247725 230
301 3300031712 Ga0265342_10243142 Ga0265342_102431421 230
302 3300031731 Ga0307405_10613631 Ga0307405_106136311 230
303 3300031824 Ga0307413_10304380 Ga0307413_103043803 230
304 3300031911 Ga0307412_10102449 Ga0307412_101024492 230
305 3300031995 Ga0307409_100558808 Ga0307409_1005588081 230
306 3300032002 Ga0307416_100396638 Ga0307416_1003966382 230
307 3300032005 Ga0307411_10022689 Ga0307411_100226893 230
308 3300035089 Ga0373944_0117281 Ga0373944_0117281_165_863 230
309 3300037471 Ga0395905_0220376 Ga0395905_0220376_73_846 230
310 3300039447 Ga0436361_0728505 Ga0436361_0728505_1440_2150 230
311 3300039453 Ga0436362_0223885 Ga0436362_0223885_127_819 230
312 3300041404 Ga0439436_0003694 Ga0439436_0003694_3664_4359 230
313 3300041404 Ga0439436_0007932 Ga0439436_0007932_2077_2778 230
314 3300041406 Ga0439439_0000798 Ga0439439_0000798_3359_4054 230
315 3300042006 Ga0439432_012052 Ga0439432_012052_1901_2638 230
316 3300042006 Ga0439432_018258 Ga0439432_018258_1347_2117 230
317 3300042007 Ga0439449_0004237 Ga0439449_0004237_1831_2568 230
318 3300042007 Ga0439449_0023528 Ga0439449_0023528_1460_2230 230
319 3300042010 Ga0439452_038264 Ga0439452_038264_194_931 230
320 3300042015 Ga0439462_0033408 Ga0439462_0033408_306_1001 230
321 3300042015 Ga0439462_0050636 Ga0439462_0050636_297_1034 230
322 3300044658 Ga0466972_0021849 Ga0466972_0021849_475_1182 230
323 3300044683 Ga0466965_0004446 Ga0466965_0004446_3523_4227 230
324 3300044683 Ga0466965_0010823 Ga0466965_0010823_914_1615 230
325 3300044684 Ga0466966_0011388 Ga0466966_0011388_4702_5403 230
326 3300044693 Ga0466961_0000285 Ga0466961_0000285_24168_24869 230
327 3300044693 Ga0466961_0016695 Ga0466961_0016695_661_1359 230
328 3300044706 Ga0466964_0346105 Ga0466964_0346105_20_721 230
329 3300044901 Ga0466960_0041675 Ga0466960_0041675_777_1484 230
330 3300045049 Ga0466959_0003330 Ga0466959_0003330_8769_9470 230
331 3300045049 Ga0466959_0078857 Ga0466959_0078857_966_1667 230
332 3300045836 Ga0466958_0133741 Ga0466958_0133741_61_759 230
333 3300046642 Ga0495634_0348646 Ga0495634_0348646_77_793 230
334 3300046809 Ga0495600_0129549 Ga0495600_0129549_557_1273 230
335 3300047321 Ga0495676_0166764 Ga0495676_0166764_635_1333 230
336 3300047444 Ga0495675_0195634 Ga0495675_0195634_400_1116 230
337 3300048904 Ga0496101_0016189 Ga0496101_0016189_3223_3918 230
338 3300048904 Ga0496101_0031944 Ga0496101_0031944_1102_1800 230
339 3300048905 Ga0496102_0608027 Ga0496102_0608027_33_728 230
340 3300048907 Ga0496104_0000303 Ga0496104_0000303_30185_30901 230
341 3300048907 Ga0496104_0000713 Ga0496104_0000713_21106_21804 230
342 3300048907 Ga0496104_0009732 Ga0496104_0009732_257_973 230
343 3300048907 Ga0496104_0027609 Ga0496104_0027609_4012_4707 230
344 3300048908 Ga0496105_0000554 Ga0496105_0000554_15769_16467 230
345 3300048908 Ga0496105_0000693 Ga0496105_0000693_10618_11334 230
346 3300048908 Ga0496105_0001496 Ga0496105_0001496_257_973 230
347 3300048908 Ga0496105_0002549 Ga0496105_0002549_4090_4785 230
348 3300048910 Ga0496107_0021284 Ga0496107_0021284_1259_1954 230
349 3300048911 Ga0496108_0011366 Ga0496108_0011366_615_1313 230
350 3300048912 Ga0496109_0001233 Ga0496109_0001233_19467_20165 230
351 3300048913 Ga0496110_0027242 Ga0496110_0027242_2533_3249 230
352 3300048913 Ga0496110_0067115 Ga0496110_0067115_2273_2971 230
353 3300048914 Ga0496111_0000819 Ga0496111_0000819_9402_10100 230
354 3300048914 Ga0496111_0088629 Ga0496111_0088629_627_1343 230
355 3300048915 Ga0496112_0002425 Ga0496112_0002425_13987_14685 230
356 3300048916 Ga0496113_0000636 Ga0496113_0000636_10233_10931 230
357 3300048918 Ga0496115_0027822 Ga0496115_0027822_2945_3640 230
358 3300048918 Ga0496115_0038542 Ga0496115_0038542_3012_3728 230
359 3300048920 Ga0496117_0103635 Ga0496117_0103635_959_1654 230
360 3300048921 Ga0496118_0006725 Ga0496118_0006725_3051_3746 230
361 3300048921 Ga0496118_0010118 Ga0496118_0010118_5398_6093 230
362 3300048922 Ga0496119_0002149 Ga0496119_0002149_15870_16565 230
363 3300048923 Ga0496120_0000505 Ga0496120_0000505_38898_39593 230
364 3300048924 Ga0496121_0010022 Ga0496121_0010022_5263_5958 230
365 3300048924 Ga0496121_0032282 Ga0496121_0032282_2813_3508 230
366 3300048924 Ga0496121_0222220 Ga0496121_0222220_109_813 230
367 3300048928 Ga0496125_0025836 Ga0496125_0025836_109_810 230
368 3300048929 Ga0496126_0003502 Ga0496126_0003502_15798_16493 230
369 3300049570 Ga0501033_0081465 Ga0501033_0081465_893_1603 230
370 3300049571 Ga0501034_0414282 Ga0501034_0414282_120_854 230
371 3300049589 Ga0501073_0013314 Ga0501073_0013314_1264_1983 230
372 3300049744 Ga0501083_0241490 Ga0501083_0241490_438_1142 230
373 3300049758 Ga0501241_046467 Ga0501241_046467_62_781 230
374 3300049823 Ga0501044_0418010 Ga0501044_0418010_128_862 230
375 3300050507 nmdc:mga05p37_429170_c1 nmdc:mga05p37_429170_c1_731_1429 230
376 3300050508 nmdc:mga09592_29529_c1 nmdc:mga09592_29529_c1_3722_4420 230
377 3300050509 nmdc:mga0qj67_10964_c1 nmdc:mga0qj67_10964_c1_1841_2539 230
378 3300053077 Ga0495601_0355123 Ga0495601_0355123_205_921 230
379 3300053085 Ga0495619_0019882 Ga0495619_0019882_161_877 230
380 3300053087 Ga0500643_054119 Ga0500643_054119_306_1025 230
381 3300053131 Ga0500652_089760 Ga0500652_089760_182_886 230
382 3300053139 Ga0500568_0000435 Ga0500568_0000435_3696_4400 230
383 3300005329 Ga0070683_100436854 Ga0070683_1004368541 231
384 3300005334 Ga0068869_100056780 Ga0068869_1000567802 231
385 3300005334 Ga0068869_100081067 Ga0068869_1000810672 231
386 3300005347 Ga0070668_100014694 Ga0070668_1000146943 231
387 3300005347 Ga0070668_100290784 Ga0070668_1002907842 231
388 3300005353 Ga0070669_100002673 Ga0070669_10000267315 231
389 3300005355 Ga0070671_100150090 Ga0070671_1001500902 231
390 3300005367 Ga0070667_100087564 Ga0070667_1000875642 231
391 3300005367 Ga0070667_100148812 Ga0070667_1001488123 231
392 3300005434 Ga0070709_10294781 Ga0070709_102947811 231
393 3300005455 Ga0070663_100114402 Ga0070663_1001144022 231
394 3300005455 Ga0070663_100120811 Ga0070663_1001208112 231
395 3300005459 Ga0068867_100000977 Ga0068867_10000097718 231
396 3300005471 Ga0070698_100312159 Ga0070698_1003121592 231
397 3300005539 Ga0068853_100011346 Ga0068853_1000113468 231
398 3300005539 Ga0068853_100083468 Ga0068853_1000834683 231
399 3300005543 Ga0070672_100004832 Ga0070672_1000048325 231
400 3300005548 Ga0070665_100012782 Ga0070665_1000127826 231
401 3300005548 Ga0070665_100235937 Ga0070665_1002359372 231
402 3300005548 Ga0070665_100286650 Ga0070665_1002866502 231
403 3300005548 Ga0070665_100806840 Ga0070665_1008068402 231
404 3300005563 Ga0068855_100006688 Ga0068855_1000066888 231
405 3300005563 Ga0068855_100393111 Ga0068855_1003931112 231
406 3300005614 Ga0068856_100079863 Ga0068856_1000798632 231
407 3300005616 Ga0068852_100141840 Ga0068852_1001418402 231
408 3300005617 Ga0068859_100000070 Ga0068859_10000007014 231
409 3300005834 Ga0068851_10026033 Ga0068851_100260333 231
410 3300005841 Ga0068863_100222800 Ga0068863_1002228002 231
411 3300005843 Ga0068860_100327298 Ga0068860_1003272982 231
412 3300005844 Ga0068862_100000041 Ga0068862_10000004115 231
413 3300006195 Ga0075366_10083227 Ga0075366_100832272 231
414 3300006237 Ga0097621_100048825 Ga0097621_1000488252 231
415 3300006237 Ga0097621_100133458 Ga0097621_1001334583 231
416 3300006358 Ga0068871_100266435 Ga0068871_1002664351 231
417 3300006358 Ga0068871_100373900 Ga0068871_1003739002 231
418 3300006881 Ga0068865_100005556 Ga0068865_1000055564 231
419 3300006931 Ga0097620_100000070 Ga0097620_10000007014 231
420 3300009101 Ga0105247_10048258 Ga0105247_100482582 231
421 3300009148 Ga0105243_10002995 Ga0105243_1000299511 231
422 3300009177 Ga0105248_10248344 Ga0105248_102483442 231
423 3300009545 Ga0105237_10127701 Ga0105237_101277012 231
424 3300009551 Ga0105238_10417804 Ga0105238_104178042 231
425 3300009553 Ga0105249_10028396 Ga0105249_100283962 231
426 3300010375 Ga0105239_10041475 Ga0105239_100414754 231
427 3300010375 Ga0105239_10054456 Ga0105239_100544562 231
428 3300010375 Ga0105239_10169198 Ga0105239_101691982 231
429 3300013296 Ga0157374_10014689 Ga0157374_100146894 231
430 3300013307 Ga0157372_10104556 Ga0157372_101045564 231
431 3300014325 Ga0163163_10297383 Ga0163163_102973832 231
432 3300014745 Ga0157377_10000098 Ga0157377_1000009839 231
433 3300014969 Ga0157376_10193719 Ga0157376_101937192 231
434 3300021361 Ga0213872_10001251 Ga0213872_100012516 231
435 3300021361 Ga0213872_10146883 Ga0213872_101468831 231
436 3300025292 Ga0209676_1008257 Ga0209676_10082573 231
437 3300025914 Ga0207671_10119440 Ga0207671_101194402 231
438 3300025935 Ga0207709_10002802 Ga0207709_100028029 231
439 3300025940 Ga0207691_10021154 Ga0207691_100211547 231
440 3300025941 Ga0207711_10105941 Ga0207711_101059412 231
441 3300025949 Ga0207667_10008300 Ga0207667_100083008 231
442 3300025960 Ga0207651_10220801 Ga0207651_102208013 231
443 3300025972 Ga0207668_10311238 Ga0207668_103112382 231
444 3300025986 Ga0207658_10187008 Ga0207658_101870081 231
445 3300025986 Ga0207658_10409212 Ga0207658_104092122 231
446 3300026041 Ga0207639_10001101 Ga0207639_100011015 231
447 3300026041 Ga0207639_10011796 Ga0207639_100117966 231
448 3300026041 Ga0207639_10791946 Ga0207639_107919462 231
449 3300026067 Ga0207678_10015043 Ga0207678_100150432 231
450 3300026067 Ga0207678_10016702 Ga0207678_100167025 231
451 3300026067 Ga0207678_10061661 Ga0207678_100616614 231
452 3300026088 Ga0207641_10306198 Ga0207641_103061982 231
453 3300026089 Ga0207648_10000614 Ga0207648_1000061432 231
454 3300026116 Ga0207674_10038049 Ga0207674_100380496 231
455 3300026142 Ga0207698_10829463 Ga0207698_108294631 231
456 3300027552 Ga0209982_1006591 Ga0209982_10065912 231
457 3300027665 Ga0209983_1005918 Ga0209983_10059182 231
458 3300027682 Ga0209971_1021303 Ga0209971_10213032 231
459 3300027876 Ga0209974_10038082 Ga0209974_100380822 231
460 3300028379 Ga0268266_10051840 Ga0268266_100518403 231
461 3300028379 Ga0268266_10123388 Ga0268266_101233882 231
462 3300028379 Ga0268266_10161255 Ga0268266_101612552 231
463 3300028380 Ga0268265_10000137 Ga0268265_1000013766 231
464 3300028380 Ga0268265_10296873 Ga0268265_102968732 231
465 3300028381 Ga0268264_10459757 Ga0268264_104597572 231
466 3300031239 Ga0265328_10014265 Ga0265328_100142652 231
467 3300031711 Ga0265314_10151443 Ga0265314_101514432 231
468 3300031901 Ga0307406_10000297 Ga0307406_100002978 231
469 3300039447 Ga0436361_0075622 Ga0436361_0075622_306_1007 231
470 3300039447 Ga0436361_0117668 Ga0436361_0117668_168_872 231
471 3300039447 Ga0436361_0319126 Ga0436361_0319126_20101_20823 231
472 3300041404 Ga0439436_0018212 Ga0439436_0018212_22_726 231
473 3300041443 Ga0451789_0963123 Ga0451789_0963123_152_922 231
474 3300046461 Ga0495641_0107650 Ga0495641_0107650_396_1124 231
475 3300048903 Ga0496100_0176487 Ga0496100_0176487_359_1060 231
476 3300048911 Ga0496108_0719938 Ga0496108_0719938_122_823 231
477 3300048917 Ga0496114_0117756 Ga0496114_0117756_119_847 231
478 3300048918 Ga0496115_0019682 Ga0496115_0019682_3478_4182 231
479 3300049523 Ga0501300_012312 Ga0501300_012312_462_1166 231
480 3300049568 Ga0501031_0002340 Ga0501031_0002340_54_752 231
481 3300049568 Ga0501031_0004589 Ga0501031_0004589_1936_2637 231
482 3300049569 Ga0501032_0098654 Ga0501032_0098654_459_1160 231
483 3300049569 Ga0501032_0121509 Ga0501032_0121509_983_1681 231
484 3300049570 Ga0501033_0050319 Ga0501033_0050319_1939_2640 231
485 3300049570 Ga0501033_0409128 Ga0501033_0409128_147_845 231
486 3300049571 Ga0501034_0002289 Ga0501034_0002289_15424_16125 231
487 3300049571 Ga0501034_0386157 Ga0501034_0386157_156_851 231
488 3300049572 Ga0501036_0070548 Ga0501036_0070548_2186_2887 231
489 3300049572 Ga0501036_0084941 Ga0501036_0084941_1593_2294 231
490 3300049572 Ga0501036_0581690 Ga0501036_0581690_181_879 231
491 3300049573 Ga0501037_0024859 Ga0501037_0024859_371_1069 231
492 3300049573 Ga0501037_0034349 Ga0501037_0034349_452_1153 231
493 3300049573 Ga0501037_0120426 Ga0501037_0120426_274_975 231
494 3300049574 Ga0501038_0006839 Ga0501038_0006839_6447_7148 231
495 3300049574 Ga0501038_0025833 Ga0501038_0025833_776_1477 231
496 3300049575 Ga0501039_0002455 Ga0501039_0002455_7165_7866 231
497 3300049575 Ga0501039_0019269 Ga0501039_0019269_3756_4457 231
498 3300049575 Ga0501039_0054822 Ga0501039_0054822_2183_2881 231
499 3300049576 Ga0501040_0001281 Ga0501040_0001281_1196_1897 231
500 3300049576 Ga0501040_0031172 Ga0501040_0031172_2747_3448 231
501 3300049576 Ga0501040_0165056 Ga0501040_0165056_148_846 231
502 3300049577 Ga0501041_0000998 Ga0501041_0000998_8633_9334 231
503 3300049578 Ga0501042_0004027 Ga0501042_0004027_5926_6627 231
504 3300049578 Ga0501042_0011146 Ga0501042_0011146_2226_2924 231
505 3300049578 Ga0501042_0292046 Ga0501042_0292046_159_860 231
506 3300049579 Ga0501043_0137534 Ga0501043_0137534_437_1138 231
507 3300049580 Ga0501046_0028278 Ga0501046_0028278_554_1255 231
508 3300049580 Ga0501046_0129870 Ga0501046_0129870_435_1136 231
509 3300049581 Ga0501047_0102039 Ga0501047_0102039_436_1137 231
510 3300049582 Ga0501048_0005038 Ga0501048_0005038_3870_4571 231
511 3300049582 Ga0501048_0034694 Ga0501048_0034694_2742_3440 231
512 3300049582 Ga0501048_0047128 Ga0501048_0047128_1933_2634 231
513 3300049583 Ga0501067_0049349 Ga0501067_0049349_1192_1893 231
514 3300049584 Ga0501068_0014546 Ga0501068_0014546_2568_3269 231
515 3300049585 Ga0501069_0000759 Ga0501069_0000759_13363_14064 231
516 3300049586 Ga0501070_0050193 Ga0501070_0050193_440_1141 231
517 3300049586 Ga0501070_0140373 Ga0501070_0140373_380_1075 231
518 3300049587 Ga0501071_0004084 Ga0501071_0004084_1357_2058 231
519 3300049587 Ga0501071_0115109 Ga0501071_0115109_227_928 231
520 3300049587 Ga0501071_0283615 Ga0501071_0283615_45_743 231
521 3300049588 Ga0501072_0002683 Ga0501072_0002683_5137_5838 231
522 3300049588 Ga0501072_0175911 Ga0501072_0175911_852_1553 231
523 3300049588 Ga0501072_0312678 Ga0501072_0312678_510_1208 231
524 3300049589 Ga0501073_0042629 Ga0501073_0042629_1699_2400 231
525 3300049589 Ga0501073_0054648 Ga0501073_0054648_452_1153 231
526 3300049589 Ga0501073_0227307 Ga0501073_0227307_364_1062 231
527 3300049590 Ga0501074_0006764 Ga0501074_0006764_881_1582 231
528 3300049590 Ga0501074_0031514 Ga0501074_0031514_3064_3762 231
529 3300049590 Ga0501074_0061768 Ga0501074_0061768_993_1694 231
530 3300049591 Ga0501075_0000491 Ga0501075_0000491_4144_4845 231
531 3300049591 Ga0501075_0159507 Ga0501075_0159507_20_718 231
532 3300049592 Ga0501076_0002706 Ga0501076_0002706_2574_3275 231
533 3300049592 Ga0501076_0122088 Ga0501076_0122088_197_895 231
534 3300049592 Ga0501076_0131973 Ga0501076_0131973_874_1575 231
535 3300049593 Ga0501077_0004253 Ga0501077_0004253_4288_4989 231
536 3300049593 Ga0501077_0103344 Ga0501077_0103344_70_768 231
537 3300049741 Ga0501079_0012112 Ga0501079_0012112_2232_2933 231
538 3300049742 Ga0501080_0019681 Ga0501080_0019681_2002_2703 231
539 3300049742 Ga0501080_0064742 Ga0501080_0064742_1676_2392 231
540 3300049742 Ga0501080_0186262 Ga0501080_0186262_432_1133 231
541 3300049742 Ga0501080_0187500 Ga0501080_0187500_398_1096 231
542 3300049742 Ga0501080_0374699 Ga0501080_0374699_516_1211 231
543 3300049743 Ga0501081_0001389 Ga0501081_0001389_6535_7236 231
544 3300049744 Ga0501083_0002183 Ga0501083_0002183_10043_10774 231
545 3300049744 Ga0501083_0003882 Ga0501083_0003882_8726_9427 231
546 3300049744 Ga0501083_0014533 Ga0501083_0014533_1399_2097 231
547 3300049776 Ga0501280_001227 Ga0501280_001227_1211_2044 231
548 3300049778 Ga0501282_001588 Ga0501282_001588_1575_2408 231
549 3300049822 Ga0501035_0006601 Ga0501035_0006601_10101_10802 231
550 3300049822 Ga0501035_0027804 Ga0501035_0027804_3450_4151 231
551 3300049822 Ga0501035_0144195 Ga0501035_0144195_1338_2033 231
552 3300049823 Ga0501044_0001614 Ga0501044_0001614_14391_15092 231
553 3300049823 Ga0501044_0007794 Ga0501044_0007794_4499_5194 231
554 3300049823 Ga0501044_0043349 Ga0501044_0043349_3739_4437 231
555 3300049824 Ga0501045_0011691 Ga0501045_0011691_2927_3628 231
556 3300050493 nmdc:mga0k408_76839_c1 nmdc:mga0k408_76839_c1_471_1169 231
557 3300053092 Ga0500583_0004078 Ga0500583_0004078_3565_4275 231
558 3300054114 Ga0501084_0003070 Ga0501084_0003070_6152_6853 231
559 3300054114 Ga0501084_0005932 Ga0501084_0005932_4624_5355 231
560 3300054114 Ga0501084_0088532 Ga0501084_0088532_320_1021 231
561 3300060353 Ga0501082_0004147 Ga0501082_0004147_1243_1944 231
562 3300060353 Ga0501082_0006298 Ga0501082_0006298_7471_8172 231
563 3300060353 Ga0501082_0112190 Ga0501082_0112190_1024_1722 231
564 3300061734 Ga0530510_0002822 Ga0530510_0002822_3604_4305 231
565 3300061734 Ga0530510_0095604 Ga0530510_0095604_1337_2032 231
566 3300061734 Ga0530510_0395219 Ga0530510_0395219_197_895 231
567 3300009147 Ga0114129_10369211 Ga0114129_103692112 232
568 3300033179 Ga0307507_10067439 Ga0307507_100674393 232
569 3300037853 Ga0436364_0011659 Ga0436364_0011659_13233_13946 232
570 3300044842 Ga0466957_0102690 Ga0466957_0102690_391_1098 232
571 3300045976 Ga0466967_0795182 Ga0466967_0795182_140_850 232
572 3300001915 JGI24741J21665_1006124 JGI24741J21665_10061242 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

153

240

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

52

125

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

160

246

0.89

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

43

124

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

170

235

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

47

129

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9846 1 200
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9807 1 198
4mf6-assembly1.cif.gz_A crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit 0.9713 2 199
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9676 3 199
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.9672 2 199
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 1 1 84 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9997 3 86 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9771 1 84 3.40.30.10
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9591 2 84 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.959 94 204 1.20.1050.130
ID Description Score Start End GO Terms
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 1.001 1 101 GO:0016740
AF-A0A522J4D5-F1-model_v4 Thiol:disulfide oxidoreductase 1.001 1 84
AF-A0A379WQP5-F1-model_v4 Glutathione-S transferase 0.9987 1 110 GO:0015036
GO:0016740
AF-A0A535B6S1-F1-model_v4 Thiol:disulfide oxidoreductase 0.9967 1 82
AF-A0A3D5Y447-F1-model_v4 Thiol:disulfide oxidoreductase 0.9965 1 71

Feature Viewer

pLDDT pTM Quality
93.1 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map