F464876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 348 | 519 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300048910|Ga0496107_0000041|Ga0496107_0000041_65324_66199 |
| Length | 291 |
| Sequence | MPCRVLVLRQAQDEDDCAGGSFETLILSLSKDEGFTHYPPNGELKMFDLTGKTALVTGATGGIGGAIAKALHEQGAHVVLSGTRESALSELAAQFGERVSFVAANLSDAAAVDGLVAKAEEAAGAPLDIVIANAGITRDGLIVRMKDEDWDTVIKVNLEGYFRLSRAAAKGMMKRRSGRIIGITSIVGVTGNPGQTNYAASKAGMIGFSKALAQELASRNVTVNCVAPGFIASPMTDALNEQQKAGILSTIPAGRLGEGSDIAAACVYLASDQGGYVTGQTLHVNGGMAMI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 4 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 5 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 8 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 9 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 10 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 11 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 15 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 16 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 17 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 18 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 19 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 20 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 21 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 22 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 23 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 24 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 25 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 26 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 27 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 28 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 29 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 30 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 31 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 32 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 33 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 34 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 35 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 36 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 37 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 38 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 39 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 40 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 41 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 42 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 43 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 44 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 45 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 46 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 47 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 48 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 49 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 50 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 286 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 311 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 324 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 329 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 334 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.79 |
| Metatranscriptomes | 5.26 |
| Isolates | 8.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.84 |
| Nodule | 0.18 |
| Rhizoplane | 5.09 |
| Rhizosphere | 67.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006562J51391_1006021 | 3300003578 | Bacteria | 3710 |
| 2 | Ga0055526_1036160 | 3300003771 | Bacteria | 1316 |
| 3 | Ga0055537_1002952 | 3300003773 | Bacteria | 5398 |
| 4 | Ga0055524_1033508 | 3300003775 | Bacteria | 1436 |
| 5 | Ga0055536_1000478 | 3300003781 | Bacteria | 27802 |
| 6 | Ga0055536_1005309 | 3300003781 | Bacteria | 6337 |
| 7 | Ga0055536_1006045 | 3300003781 | Bacteria | 5740 |
| 8 | Ga0055528_1008440 | 3300003790 | Bacteria | 4415 |
| 9 | Ga0055528_1021094 | 3300003790 | Bacteria | 2082 |
| 10 | Ga0055530_10014825 | 3300003791 | Bacteria | 2575 |
| 11 | Ga0055530_10017903 | 3300003791 | Bacteria | 2203 |
| 12 | Ga0055531_10001093 | 3300003794 | Bacteria | 21245 |
| 13 | Ga0055531_10003069 | 3300003794 | Bacteria | 10803 |
| 14 | Ga0055531_10003487 | 3300003794 | Bacteria | 10004 |
| 15 | Ga0065165_1001045 | 3300005262 | Bacteria | 33371 |
| 16 | Ga0065715_10185097 | 3300005293 | Bacteria | 1444 |
| 17 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 18 | Ga0070658_10004249 | 3300005327 | Bacteria | 11711 |
| 19 | Ga0070670_100216330 | 3300005331 | Bacteria | 1667 |
| 20 | Ga0070680_100000264 | 3300005336 | Bacteria | 34683 |
| 21 | Ga0070660_100001280 | 3300005339 | Bacteria | 17152 |
| 22 | Ga0070660_100639238 | 3300005339 | Bacteria | 891 |
| 23 | Ga0070689_100691165 | 3300005340 | Bacteria | 890 |
| 24 | Ga0070668_100003297 | 3300005347 | Bacteria | 11910 |
| 25 | Ga0070668_100021693 | 3300005347 | Bacteria | 4852 |
| 26 | Ga0070668_100093507 | 3300005347 | Bacteria | 2373 |
| 27 | Ga0070668_100371606 | 3300005347 | Bacteria | 1215 |
| 28 | Ga0070668_100426046 | 3300005347 | Bacteria | 1137 |
| 29 | Ga0070669_100018715 | 3300005353 | Bacteria | 4950 |
| 30 | Ga0070671_100000479 | 3300005355 | Bacteria | 27800 |
| 31 | Ga0070671_100019977 | 3300005355 | Bacteria | 5457 |
| 32 | Ga0070688_100018458 | 3300005365 | Bacteria | 4025 |
| 33 | Ga0070659_100015232 | 3300005366 | Bacteria | 5755 |
| 34 | Ga0070667_100002158 | 3300005367 | Bacteria | 17328 |
| 35 | Ga0070667_100021993 | 3300005367 | Bacteria | 5292 |
| 36 | Ga0070667_100076986 | 3300005367 | Bacteria | 2848 |
| 37 | Ga0070713_100085475 | 3300005436 | Bacteria | 2702 |
| 38 | Ga0070710_10115372 | 3300005437 | Bacteria | 1619 |
| 39 | Ga0070711_100369595 | 3300005439 | Bacteria | 1157 |
| 40 | Ga0070663_100468703 | 3300005455 | Bacteria | 1041 |
| 41 | Ga0070678_100237023 | 3300005456 | Bacteria | 1523 |
| 42 | Ga0070662_100489754 | 3300005457 | Bacteria | 1024 |
| 43 | Ga0070681_10000213 | 3300005458 | Bacteria | 45271 |
| 44 | Ga0070679_100242218 | 3300005530 | Bacteria | 1761 |
| 45 | Ga0068853_100178507 | 3300005539 | Bacteria | 1925 |
| 46 | Ga0070693_100291452 | 3300005547 | Bacteria | 1097 |
| 47 | Ga0070665_100000940 | 3300005548 | Bacteria | 37209 |
| 48 | Ga0070665_100001410 | 3300005548 | Bacteria | 28253 |
| 49 | Ga0070665_100010051 | 3300005548 | Bacteria | 9574 |
| 50 | Ga0068855_100001693 | 3300005563 | Bacteria | 27587 |
| 51 | Ga0068855_100214207 | 3300005563 | Bacteria | 2163 |
| 52 | Ga0070664_100449815 | 3300005564 | Bacteria | 1182 |
| 53 | Ga0068856_100056115 | 3300005614 | Bacteria | 3886 |
| 54 | Ga0068856_100201468 | 3300005614 | Bacteria | 2005 |
| 55 | Ga0068856_100990431 | 3300005614 | Bacteria | 859 |
| 56 | Ga0068859_100000999 | 3300005617 | Bacteria | 28968 |
| 57 | Ga0068859_100469516 | 3300005617 | Bacteria | 1354 |
| 58 | Ga0068864_100003837 | 3300005618 | Bacteria | 12390 |
| 59 | Ga0068864_100016985 | 3300005618 | Bacteria | 6064 |
| 60 | Ga0068864_100168894 | 3300005618 | Bacteria | 1993 |
| 61 | Ga0068864_100620802 | 3300005618 | Bacteria | 1050 |
| 62 | Ga0068864_100797002 | 3300005618 | Bacteria | 928 |
| 63 | Ga0068861_100318426 | 3300005719 | Bacteria | 1354 |
| 64 | Ga0068863_100006162 | 3300005841 | Bacteria | 11760 |
| 65 | Ga0068863_100007149 | 3300005841 | Bacteria | 10951 |
| 66 | Ga0068858_100014500 | 3300005842 | Bacteria | 7426 |
| 67 | Ga0068858_100054499 | 3300005842 | Bacteria | 3697 |
| 68 | Ga0068858_100064743 | 3300005842 | Bacteria | 3384 |
| 69 | Ga0068860_100001370 | 3300005843 | Bacteria | 26465 |
| 70 | Ga0068860_100012979 | 3300005843 | Bacteria | 8183 |
| 71 | Ga0068860_100111046 | 3300005843 | Bacteria | 2621 |
| 72 | Ga0068862_100004692 | 3300005844 | Bacteria | 11510 |
| 73 | Ga0068862_100146975 | 3300005844 | Bacteria | 2095 |
| 74 | Ga0068862_100420817 | 3300005844 | Bacteria | 1254 |
| 75 | Ga0081455_10094409 | 3300005937 | Bacteria | 2416 |
| 76 | Ga0081455_10184193 | 3300005937 | Bacteria | 1578 |
| 77 | Ga0075365_10002352 | 3300006038 | Bacteria | 9218 |
| 78 | Ga0075368_10000471 | 3300006042 | Bacteria | 11930 |
| 79 | Ga0075363_100008842 | 3300006048 | Bacteria | 4712 |
| 80 | Ga0075363_100072890 | 3300006048 | Bacteria | 1868 |
| 81 | Ga0070712_100099696 | 3300006175 | Bacteria | 2144 |
| 82 | Ga0075362_10035447 | 3300006177 | Bacteria | 2178 |
| 83 | Ga0075367_10020160 | 3300006178 | Bacteria | 3709 |
| 84 | Ga0075369_10010780 | 3300006186 | Bacteria | 3581 |
| 85 | Ga0075366_10037719 | 3300006195 | Bacteria | 2854 |
| 86 | Ga0075370_10075248 | 3300006353 | Bacteria | 1936 |
| 87 | Ga0075428_100032742 | 3300006844 | Bacteria | 5741 |
| 88 | Ga0075431_100021443 | 3300006847 | Bacteria | 6607 |
| 89 | Ga0097620_100000999 | 3300006931 | Bacteria | 28968 |
| 90 | Ga0097620_100469435 | 3300006931 | Bacteria | 1354 |
| 91 | Ga0099795_10000521 | 3300007788 | Bacteria | 7219 |
| 92 | Ga0105244_10066915 | 3300009036 | Bacteria | 1798 |
| 93 | Ga0105240_10003426 | 3300009093 | Bacteria | 24643 |
| 94 | Ga0105240_10099371 | 3300009093 | Bacteria | 3542 |
| 95 | Ga0105240_10399768 | 3300009093 | Bacteria | 1548 |
| 96 | Ga0105245_10039365 | 3300009098 | Bacteria | 4207 |
| 97 | Ga0105245_10131745 | 3300009098 | Bacteria | 2346 |
| 98 | Ga0114129_10063020 | 3300009147 | Bacteria | 5179 |
| 99 | Ga0105242_10120391 | 3300009176 | Bacteria | 2251 |
| 100 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 101 | Ga0105248_10000685 | 3300009177 | Bacteria | 38290 |
| 102 | Ga0105248_10012881 | 3300009177 | Bacteria | 9223 |
| 103 | Ga0105248_10044544 | 3300009177 | Bacteria | 4976 |
| 104 | Ga0105248_10070680 | 3300009177 | Bacteria | 3920 |
| 105 | Ga0105248_10201991 | 3300009177 | Bacteria | 2239 |
| 106 | Ga0105248_10604118 | 3300009177 | Bacteria | 1238 |
| 107 | Ga0105238_10020646 | 3300009551 | Bacteria | 6709 |
| 108 | Ga0105238_10331880 | 3300009551 | Bacteria | 1508 |
| 109 | Ga0105249_10000818 | 3300009553 | Bacteria | 28052 |
| 110 | Ga0105249_10384626 | 3300009553 | Bacteria | 1430 |
| 111 | Ga0099796_10000086 | 3300010159 | Bacteria | 15528 |
| 112 | Ga0099796_10107096 | 3300010159 | Bacteria | 1060 |
| 113 | Ga0157371_10107495 | 3300013102 | Bacteria | 1980 |
| 114 | Ga0157369_10023976 | 3300013105 | Bacteria | 6789 |
| 115 | Ga0163162_10018748 | 3300013306 | Bacteria | 6782 |
| 116 | Ga0163162_10202233 | 3300013306 | Bacteria | 2115 |
| 117 | Ga0163162_10436117 | 3300013306 | Bacteria | 1442 |
| 118 | Ga0163163_10014204 | 3300014325 | Bacteria | 7315 |
| 119 | Ga0163163_10070984 | 3300014325 | Bacteria | 3469 |
| 120 | Ga0163163_10562593 | 3300014325 | Bacteria | 1203 |
| 121 | Ga0157380_10035915 | 3300014326 | Bacteria | 3831 |
| 122 | Ga0157380_10129517 | 3300014326 | Bacteria | 2150 |
| 123 | Ga0157380_10275785 | 3300014326 | Bacteria | 1536 |
| 124 | Ga0157379_10064313 | 3300014968 | Bacteria | 3278 |
| 125 | Ga0157379_10305330 | 3300014968 | Bacteria | 1451 |
| 126 | Ga0213874_10027254 | 3300021377 | Bacteria | 1624 |
| 127 | Ga0224572_1003965 | 3300024225 | Bacteria | 2539 |
| 128 | Ga0224572_1021452 | 3300024225 | Bacteria | 1239 |
| 129 | Ga0228598_1046721 | 3300024227 | Bacteria | 857 |
| 130 | Ga0209233_1024480 | 3300025261 | Bacteria | 1509 |
| 131 | Ga0209565_1000127 | 3300025263 | Bacteria | 109900 |
| 132 | Ga0209675_1010000 | 3300025291 | Bacteria | 3285 |
| 133 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 134 | Ga0209676_1000336 | 3300025292 | Bacteria | 89848 |
| 135 | Ga0209676_1000476 | 3300025292 | Bacteria | 66212 |
| 136 | Ga0209676_1001278 | 3300025292 | Bacteria | 26066 |
| 137 | Ga0209025_1028141 | 3300025294 | Bacteria | 2764 |
| 138 | Ga0209564_1005120 | 3300025295 | Bacteria | 7627 |
| 139 | Ga0209564_1023284 | 3300025295 | Bacteria | 2158 |
| 140 | Ga0209758_1000450 | 3300025297 | Bacteria | 68773 |
| 141 | Ga0209758_1008106 | 3300025297 | Bacteria | 6916 |
| 142 | Ga0209050_1000506 | 3300025298 | Bacteria | 66220 |
| 143 | Ga0209050_1007979 | 3300025298 | Bacteria | 5780 |
| 144 | Ga0209050_1018460 | 3300025298 | Bacteria | 2709 |
| 145 | Ga0209050_1019830 | 3300025298 | Bacteria | 2534 |
| 146 | Ga0209256_1016565 | 3300025299 | Bacteria | 2503 |
| 147 | Ga0209256_1019956 | 3300025299 | Bacteria | 2112 |
| 148 | Ga0209051_1057178 | 3300025303 | Bacteria | 1251 |
| 149 | Ga0209257_1000159 | 3300025304 | Bacteria | 178767 |
| 150 | Ga0209257_1000481 | 3300025304 | Bacteria | 72432 |
| 151 | Ga0209257_1008528 | 3300025304 | Bacteria | 5792 |
| 152 | Ga0209257_1028172 | 3300025304 | Bacteria | 1854 |
| 153 | Ga0207680_10035160 | 3300025903 | Bacteria | 2874 |
| 154 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 155 | Ga0207705_10024662 | 3300025909 | Bacteria | 4292 |
| 156 | Ga0207705_10253309 | 3300025909 | Bacteria | 1343 |
| 157 | Ga0207695_10003143 | 3300025913 | Bacteria | 23591 |
| 158 | Ga0207695_10070156 | 3300025913 | Bacteria | 3584 |
| 159 | Ga0207695_10453733 | 3300025913 | Bacteria | 1165 |
| 160 | Ga0207671_10168372 | 3300025914 | Bacteria | 1700 |
| 161 | Ga0207693_10063121 | 3300025915 | Bacteria | 2902 |
| 162 | Ga0207663_10054697 | 3300025916 | Bacteria | 2501 |
| 163 | Ga0207660_10003027 | 3300025917 | Bacteria | 11000 |
| 164 | Ga0207657_10003354 | 3300025919 | Bacteria | 17131 |
| 165 | Ga0207657_10528620 | 3300025919 | Bacteria | 923 |
| 166 | Ga0207652_10006822 | 3300025921 | Bacteria | 9200 |
| 167 | Ga0207652_10115724 | 3300025921 | Bacteria | 2382 |
| 168 | Ga0207681_10009686 | 3300025923 | Bacteria | 5896 |
| 169 | Ga0207694_10032403 | 3300025924 | Bacteria | 4000 |
| 170 | Ga0207694_10410747 | 3300025924 | Bacteria | 1127 |
| 171 | Ga0207650_10000201 | 3300025925 | Bacteria | 69058 |
| 172 | Ga0207650_10122435 | 3300025925 | Bacteria | 2027 |
| 173 | Ga0207687_10079794 | 3300025927 | Bacteria | 2360 |
| 174 | Ga0207700_10063843 | 3300025928 | Bacteria | 2802 |
| 175 | Ga0207644_10004836 | 3300025931 | Bacteria | 8766 |
| 176 | Ga0207644_10089321 | 3300025931 | Bacteria | 2293 |
| 177 | Ga0207644_10105354 | 3300025931 | Bacteria | 2124 |
| 178 | Ga0207690_10003860 | 3300025932 | Bacteria | 8859 |
| 179 | Ga0207706_10062708 | 3300025933 | Bacteria | 3273 |
| 180 | Ga0207706_10494750 | 3300025933 | Bacteria | 1056 |
| 181 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 182 | Ga0207711_10001954 | 3300025941 | Bacteria | 18716 |
| 183 | Ga0207711_10006432 | 3300025941 | Bacteria | 9891 |
| 184 | Ga0207711_10013682 | 3300025941 | Bacteria | 6737 |
| 185 | Ga0207711_10025045 | 3300025941 | Bacteria | 5006 |
| 186 | Ga0207711_10203374 | 3300025941 | Bacteria | 1808 |
| 187 | Ga0207711_10325958 | 3300025941 | Bacteria | 1420 |
| 188 | Ga0207679_10008351 | 3300025945 | Bacteria | 6591 |
| 189 | Ga0207679_10070393 | 3300025945 | Bacteria | 2636 |
| 190 | Ga0207667_10029154 | 3300025949 | Bacteria | 5986 |
| 191 | Ga0207667_10357388 | 3300025949 | Unclassified | 1489 |
| 192 | Ga0207651_10043707 | 3300025960 | Bacteria | 2993 |
| 193 | Ga0207651_10229855 | 3300025960 | Bacteria | 1505 |
| 194 | Ga0207712_10118548 | 3300025961 | Bacteria | 1998 |
| 195 | Ga0207712_10386918 | 3300025961 | Bacteria | 1172 |
| 196 | Ga0207668_10000007 | 3300025972 | Bacteria | 190613 |
| 197 | Ga0207668_10000247 | 3300025972 | Bacteria | 36155 |
| 198 | Ga0207668_10025099 | 3300025972 | Bacteria | 3853 |
| 199 | Ga0207668_10356001 | 3300025972 | Bacteria | 1225 |
| 200 | Ga0207658_10000052 | 3300025986 | Bacteria | 128748 |
| 201 | Ga0207658_10000985 | 3300025986 | Bacteria | 23486 |
| 202 | Ga0207658_10001933 | 3300025986 | Bacteria | 15458 |
| 203 | Ga0207658_10013527 | 3300025986 | Bacteria | 5578 |
| 204 | Ga0207658_10036009 | 3300025986 | Bacteria | 3548 |
| 205 | Ga0207658_10640297 | 3300025986 | Bacteria | 958 |
| 206 | Ga0207703_10002468 | 3300026035 | Bacteria | 16038 |
| 207 | Ga0207703_10049425 | 3300026035 | Bacteria | 3400 |
| 208 | Ga0207678_10324071 | 3300026067 | Bacteria | 1326 |
| 209 | Ga0207702_10023453 | 3300026078 | Bacteria | 5118 |
| 210 | Ga0207702_10098159 | 3300026078 | Bacteria | 2580 |
| 211 | Ga0207641_10087617 | 3300026088 | Bacteria | 2716 |
| 212 | Ga0207641_10267706 | 3300026088 | Bacteria | 1602 |
| 213 | Ga0207676_10001242 | 3300026095 | Bacteria | 18975 |
| 214 | Ga0207676_10012779 | 3300026095 | Bacteria | 6024 |
| 215 | Ga0207676_10094198 | 3300026095 | Bacteria | 2467 |
| 216 | Ga0207676_10186538 | 3300026095 | Bacteria | 1821 |
| 217 | Ga0207676_10334476 | 3300026095 | Bacteria | 1395 |
| 218 | Ga0207675_100139166 | 3300026118 | Bacteria | 2305 |
| 219 | Ga0207675_100154745 | 3300026118 | Bacteria | 2184 |
| 220 | Ga0207675_100923487 | 3300026118 | Bacteria | 889 |
| 221 | Ga0207683_10099258 | 3300026121 | Bacteria | 2598 |
| 222 | Ga0207698_10023739 | 3300026142 | Bacteria | 4290 |
| 223 | Ga0209813_10000616 | 3300027866 | Bacteria | 8299 |
| 224 | Ga0209974_10034907 | 3300027876 | Bacteria | 1670 |
| 225 | Ga0209974_10039696 | 3300027876 | Bacteria | 1566 |
| 226 | Ga0268266_10001205 | 3300028379 | Bacteria | 31898 |
| 227 | Ga0268266_10010417 | 3300028379 | Bacteria | 8124 |
| 228 | Ga0268266_10011789 | 3300028379 | Bacteria | 7579 |
| 229 | Ga0268266_10581886 | 3300028379 | Bacteria | 1074 |
| 230 | Ga0268265_10002350 | 3300028380 | Bacteria | 14338 |
| 231 | Ga0268265_10091103 | 3300028380 | Bacteria | 2437 |
| 232 | Ga0268265_10134907 | 3300028380 | Bacteria | 2057 |
| 233 | Ga0268264_10000684 | 3300028381 | Bacteria | 39491 |
| 234 | Ga0268264_10018738 | 3300028381 | Bacteria | 5659 |
| 235 | Ga0268264_10210953 | 3300028381 | Bacteria | 1783 |
| 236 | Ga0268264_10236140 | 3300028381 | Bacteria | 1691 |
| 237 | Ga0268264_10638747 | 3300028381 | Bacteria | 1052 |
| 238 | Ga0307517_10001029 | 3300028786 | Bacteria | 47353 |
| 239 | Ga0307517_10115170 | 3300028786 | Bacteria | 2019 |
| 240 | Ga0307515_10066696 | 3300028794 | Bacteria | 4980 |
| 241 | Ga0307515_10067676 | 3300028794 | Bacteria | 4921 |
| 242 | Ga0307515_10315002 | 3300028794 | Bacteria | 1236 |
| 243 | Ga0265773_1000596 | 3300031018 | Bacteria | 1559 |
| 244 | Ga0265327_10000220 | 3300031251 | Bacteria | 115886 |
| 245 | Ga0265327_10152209 | 3300031251 | Bacteria | 1073 |
| 246 | Ga0307513_10000082 | 3300031456 | Bacteria | 131779 |
| 247 | Ga0307513_10001006 | 3300031456 | Bacteria | 40812 |
| 248 | Ga0307513_10002226 | 3300031456 | Bacteria | 27088 |
| 249 | Ga0307408_100282071 | 3300031548 | Bacteria | 1384 |
| 250 | Ga0265313_10008177 | 3300031595 | Bacteria | 6992 |
| 251 | Ga0307405_10030398 | 3300031731 | Bacteria | 3167 |
| 252 | Ga0307413_10021312 | 3300031824 | Bacteria | 3467 |
| 253 | Ga0307413_10060092 | 3300031824 | Bacteria | 2338 |
| 254 | Ga0307413_10405389 | 3300031824 | Bacteria | 1069 |
| 255 | Ga0307410_10070753 | 3300031852 | Bacteria | 2417 |
| 256 | Ga0307410_10213633 | 3300031852 | Bacteria | 1479 |
| 257 | Ga0307406_10006321 | 3300031901 | Bacteria | 6534 |
| 258 | Ga0307407_10097113 | 3300031903 | Bacteria | 1820 |
| 259 | Ga0307407_10248898 | 3300031903 | Bacteria | 1216 |
| 260 | Ga0307412_10079699 | 3300031911 | Bacteria | 2260 |
| 261 | Ga0307409_100071151 | 3300031995 | Bacteria | 2764 |
| 262 | Ga0307409_100103587 | 3300031995 | Bacteria | 2367 |
| 263 | Ga0307409_100105165 | 3300031995 | Bacteria | 2353 |
| 264 | Ga0307409_100155825 | 3300031995 | Bacteria | 1990 |
| 265 | Ga0307416_100208507 | 3300032002 | Bacteria | 1862 |
| 266 | Ga0307416_100355940 | 3300032002 | Bacteria | 1484 |
| 267 | Ga0307416_100689512 | 3300032002 | Bacteria | 1110 |
| 268 | Ga0307414_10047374 | 3300032004 | Bacteria | 2957 |
| 269 | Ga0307414_10061855 | 3300032004 | Bacteria | 2653 |
| 270 | Ga0307414_10162131 | 3300032004 | Bacteria | 1777 |
| 271 | Ga0307414_10205516 | 3300032004 | Bacteria | 1605 |
| 272 | Ga0307411_10046571 | 3300032005 | Bacteria | 2797 |
| 273 | Ga0307411_10160596 | 3300032005 | Bacteria | 1682 |
| 274 | Ga0307415_100078895 | 3300032126 | Bacteria | 2343 |
| 275 | Ga0373924_0031367 | 3300035410 | Bacteria | 2137 |
| 276 | Ga0373931_0022704 | 3300035691 | Bacteria | 3160 |
| 277 | Ga0373933_0090001 | 3300035724 | Bacteria | 1892 |
| 278 | Ga0373947_0195926 | 3300035725 | Bacteria | 1320 |
| 279 | Ga0373937_0147549 | 3300036401 | Bacteria | 2202 |
| 280 | Ga0373925_0053200 | 3300037068 | Bacteria | 3026 |
| 281 | Ga0395899_0006527 | 3300037312 | Bacteria | 9039 |
| 282 | Ga0395899_0042865 | 3300037312 | Bacteria | 3376 |
| 283 | Ga0395900_0002429 | 3300037418 | Bacteria | 20525 |
| 284 | Ga0395900_0459504 | 3300037418 | Bacteria | 1228 |
| 285 | Ga0395900_0568185 | 3300037418 | Bacteria | 1077 |
| 286 | Ga0395898_0008060 | 3300037466 | Bacteria | 11165 |
| 287 | Ga0395898_0227526 | 3300037466 | Unclassified | 1779 |
| 288 | Ga0395905_0007649 | 3300037471 | Bacteria | 10724 |
| 289 | Ga0395905_0016314 | 3300037471 | Bacteria | 7058 |
| 290 | Ga0395905_0214420 | 3300037471 | Bacteria | 1803 |
| 291 | Ga0395905_0317642 | 3300037471 | Bacteria | 1447 |
| 292 | Ga0395905_0514689 | 3300037471 | Bacteria | 1097 |
| 293 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 294 | Ga0395901_0013125 | 3300038443 | Bacteria | 8409 |
| 295 | Ga0395901_0084333 | 3300038443 | Bacteria | 3321 |
| 296 | Ga0395901_0086637 | 3300038443 | Bacteria | 3275 |
| 297 | Ga0400483_231819 | 3300039062 | Bacteria | 3760 |
| 298 | Ga0436365_1145221 | 3300039437 | Bacteria | 3665 |
| 299 | Ga0436365_1645730 | 3300039437 | Bacteria | 1319 |
| 300 | Ga0436363_1269293 | 3300039450 | Bacteria | 1993 |
| 301 | Ga0436363_1621007 | 3300039450 | Bacteria | 1629 |
| 302 | Ga0436362_0176928 | 3300039453 | Bacteria | 3764 |
| 303 | Ga0436362_1255974 | 3300039453 | Bacteria | 1125 |
| 304 | Ga0439453_0015104 | 3300041408 | Bacteria | 1332 |
| 305 | Ga0439435_0014277 | 3300042436 | Bacteria | 1961 |
| 306 | Ga0451577_0480131 | 3300042876 | Bacteria | 1128 |
| 307 | Ga0466969_0000677 | 3300044656 | Bacteria | 18515 |
| 308 | Ga0466966_0055079 | 3300044684 | Bacteria | 2518 |
| 309 | Ga0466961_0006897 | 3300044693 | Bacteria | 7226 |
| 310 | Ga0453684_0027798 | 3300044712 | Bacteria | 8096 |
| 311 | Ga0466971_0002075 | 3300044719 | Bacteria | 8493 |
| 312 | Ga0466957_0006824 | 3300044842 | Bacteria | 6450 |
| 313 | Ga0466957_0381957 | 3300044842 | Bacteria | 961 |
| 314 | Ga0466959_0001525 | 3300045049 | Bacteria | 14225 |
| 315 | Ga0466958_0077815 | 3300045836 | Bacteria | 2037 |
| 316 | Ga0495627_000269 | 3300046453 | Bacteria | 52989 |
| 317 | Ga0495590_0000439 | 3300046457 | Bacteria | 20685 |
| 318 | Ga0495629_0216516 | 3300046459 | Bacteria | 1322 |
| 319 | Ga0495638_0000347 | 3300046460 | Bacteria | 58280 |
| 320 | Ga0495638_0000492 | 3300046460 | Bacteria | 47203 |
| 321 | Ga0495651_0216004 | 3300046462 | Bacteria | 1331 |
| 322 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 323 | Ga0495585_0018627 | 3300046492 | Bacteria | 4004 |
| 324 | Ga0495585_0167170 | 3300046492 | Bacteria | 1138 |
| 325 | Ga0495607_0090228 | 3300046501 | Bacteria | 1662 |
| 326 | Ga0495583_0000037 | 3300046506 | Bacteria | 244437 |
| 327 | Ga0495583_0024449 | 3300046506 | Bacteria | 3035 |
| 328 | Ga0495606_0005657 | 3300046507 | Bacteria | 11846 |
| 329 | Ga0495610_0001339 | 3300046512 | Bacteria | 21852 |
| 330 | Ga0495610_0002423 | 3300046512 | Bacteria | 15702 |
| 331 | Ga0495610_0010802 | 3300046512 | Bacteria | 5642 |
| 332 | Ga0495616_0000112 | 3300046513 | Bacteria | 71263 |
| 333 | Ga0495631_0003776 | 3300046518 | Bacteria | 8240 |
| 334 | Ga0495632_0023018 | 3300046519 | Bacteria | 3332 |
| 335 | Ga0495637_0008992 | 3300046520 | Bacteria | 4884 |
| 336 | Ga0495637_0021760 | 3300046520 | Bacteria | 2934 |
| 337 | Ga0495648_0000105 | 3300046524 | Bacteria | 105677 |
| 338 | Ga0495663_0000375 | 3300046525 | Bacteria | 16564 |
| 339 | Ga0495642_0013236 | 3300046528 | Bacteria | 3188 |
| 340 | Ga0495654_0000054 | 3300046530 | Bacteria | 144303 |
| 341 | Ga0495654_0022462 | 3300046530 | Bacteria | 3276 |
| 342 | Ga0495621_0146330 | 3300046539 | Bacteria | 927 |
| 343 | Ga0495597_0043187 | 3300046542 | Bacteria | 2008 |
| 344 | Ga0495597_0146615 | 3300046542 | Bacteria | 970 |
| 345 | Ga0495633_0004403 | 3300046558 | Bacteria | 8971 |
| 346 | Ga0495668_0000252 | 3300046616 | Bacteria | 76175 |
| 347 | Ga0495668_0037195 | 3300046616 | Bacteria | 2724 |
| 348 | Ga0495668_0063745 | 3300046616 | Bacteria | 2029 |
| 349 | Ga0495668_0157644 | 3300046616 | Bacteria | 1243 |
| 350 | Ga0495668_0185403 | 3300046616 | Bacteria | 1140 |
| 351 | Ga0495611_0145282 | 3300046648 | Bacteria | 1107 |
| 352 | Ga0495625_0000415 | 3300046660 | Bacteria | 64352 |
| 353 | Ga0495625_0030568 | 3300046660 | Bacteria | 4016 |
| 354 | Ga0495625_0070115 | 3300046660 | Bacteria | 2461 |
| 355 | Ga0495625_0120956 | 3300046660 | Bacteria | 1781 |
| 356 | Ga0495635_0091482 | 3300046663 | Bacteria | 2081 |
| 357 | Ga0495661_0111076 | 3300046665 | Bacteria | 1528 |
| 358 | Ga0495669_0050164 | 3300046684 | Bacteria | 1871 |
| 359 | Ga0495613_0000964 | 3300046689 | Bacteria | 22013 |
| 360 | Ga0495670_0075951 | 3300046691 | Bacteria | 1706 |
| 361 | Ga0495589_0152905 | 3300046794 | Bacteria | 1101 |
| 362 | Ga0495660_0046650 | 3300046810 | Bacteria | 2375 |
| 363 | Ga0495660_0049606 | 3300046810 | Bacteria | 2290 |
| 364 | Ga0495672_0007870 | 3300047320 | Bacteria | 7957 |
| 365 | Ga0495672_0024032 | 3300047320 | Bacteria | 3933 |
| 366 | Ga0495677_0047193 | 3300047445 | Bacteria | 1581 |
| 367 | Ga0495679_026121 | 3300047446 | Bacteria | 1943 |
| 368 | Ga0495673_0000402 | 3300047469 | Bacteria | 50662 |
| 369 | Ga0495673_0001079 | 3300047469 | Bacteria | 23944 |
| 370 | Ga0495681_0066352 | 3300047470 | Bacteria | 1647 |
| 371 | Ga0495686_0000572 | 3300047472 | Bacteria | 52381 |
| 372 | Ga0495686_0004508 | 3300047472 | Bacteria | 11427 |
| 373 | Ga0495686_0029609 | 3300047472 | Bacteria | 3561 |
| 374 | Ga0495602_0141478 | 3300048088 | Bacteria | 1904 |
| 375 | Ga0496100_0168768 | 3300048903 | Bacteria | 1574 |
| 376 | Ga0496102_0108686 | 3300048905 | Bacteria | 2583 |
| 377 | Ga0496102_0146564 | 3300048905 | Bacteria | 2216 |
| 378 | Ga0496103_0000643 | 3300048906 | Bacteria | 26435 |
| 379 | Ga0496103_0234389 | 3300048906 | Bacteria | 1181 |
| 380 | Ga0496103_0262147 | 3300048906 | Bacteria | 1112 |
| 381 | Ga0496104_0000088 | 3300048907 | Bacteria | 88904 |
| 382 | Ga0496105_0018470 | 3300048908 | Bacteria | 5605 |
| 383 | Ga0496106_0221842 | 3300048909 | Bacteria | 1508 |
| 384 | Ga0496106_0449602 | 3300048909 | Bacteria | 1035 |
| 385 | Ga0496107_0000041 | 3300048910 | Bacteria | 75059 |
| 386 | Ga0496108_0353042 | 3300048911 | Bacteria | 1283 |
| 387 | Ga0496109_0020688 | 3300048912 | Bacteria | 5812 |
| 388 | Ga0496110_0001538 | 3300048913 | Bacteria | 16773 |
| 389 | Ga0496110_0001919 | 3300048913 | Bacteria | 15380 |
| 390 | Ga0496110_0063478 | 3300048913 | Bacteria | 3264 |
| 391 | Ga0496110_0679637 | 3300048913 | Bacteria | 930 |
| 392 | Ga0496111_0010025 | 3300048914 | Bacteria | 6339 |
| 393 | Ga0496111_0013661 | 3300048914 | Bacteria | 5532 |
| 394 | Ga0496112_0031566 | 3300048915 | Bacteria | 5140 |
| 395 | Ga0496113_0002054 | 3300048916 | Bacteria | 11566 |
| 396 | Ga0496113_0074106 | 3300048916 | Bacteria | 2595 |
| 397 | Ga0496113_0639734 | 3300048916 | Bacteria | 851 |
| 398 | Ga0496114_0750784 | 3300048917 | Bacteria | 853 |
| 399 | Ga0496115_0004136 | 3300048918 | Bacteria | 10475 |
| 400 | Ga0496115_0005514 | 3300048918 | Bacteria | 9210 |
| 401 | Ga0496115_0088679 | 3300048918 | Bacteria | 2526 |
| 402 | Ga0496115_0154511 | 3300048918 | Bacteria | 1895 |
| 403 | Ga0496115_0184285 | 3300048918 | Bacteria | 1725 |
| 404 | Ga0496116_0003801 | 3300048919 | Bacteria | 14758 |
| 405 | Ga0496116_0011628 | 3300048919 | Bacteria | 7263 |
| 406 | Ga0496117_0005240 | 3300048920 | Bacteria | 13757 |
| 407 | Ga0496117_0043782 | 3300048920 | Bacteria | 3250 |
| 408 | Ga0496118_0013510 | 3300048921 | Bacteria | 7715 |
| 409 | Ga0496118_0020836 | 3300048921 | Bacteria | 5800 |
| 410 | Ga0496119_0013609 | 3300048922 | Bacteria | 6459 |
| 411 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 412 | Ga0496121_0000802 | 3300048924 | Bacteria | 57240 |
| 413 | Ga0496122_0001009 | 3300048925 | Bacteria | 49846 |
| 414 | Ga0496123_0000529 | 3300048926 | Bacteria | 65639 |
| 415 | Ga0496123_0120554 | 3300048926 | Bacteria | 1477 |
| 416 | Ga0496124_0010701 | 3300048927 | Bacteria | 9254 |
| 417 | Ga0496125_0004025 | 3300048928 | Bacteria | 17251 |
| 418 | Ga0496126_0000898 | 3300048929 | Bacteria | 51758 |
| 419 | Ga0501306_010800 | 3300049127 | Bacteria | 1155 |
| 420 | Ga0501343_000260 | 3300049132 | Bacteria | 2864 |
| 421 | Ga0501343_002377 | 3300049132 | Bacteria | 1337 |
| 422 | Ga0501345_01131 | 3300049134 | Bacteria | 994 |
| 423 | Ga0501305_000807 | 3300049161 | Bacteria | 2772 |
| 424 | Ga0501305_005425 | 3300049161 | Bacteria | 1544 |
| 425 | Ga0495678_009288 | 3300049459 | Bacteria | 4879 |
| 426 | Ga0501300_006030 | 3300049523 | Bacteria | 1787 |
| 427 | Ga0501312_000649 | 3300049528 | Bacteria | 2955 |
| 428 | Ga0501312_007154 | 3300049528 | Bacteria | 1414 |
| 429 | Ga0501313_025817 | 3300049529 | Bacteria | 745 |
| 430 | Ga0501315_000169 | 3300049531 | Bacteria | 3753 |
| 431 | Ga0501315_006190 | 3300049531 | Bacteria | 1324 |
| 432 | Ga0501315_012383 | 3300049531 | Bacteria | 1054 |
| 433 | Ga0501316_000492 | 3300049532 | Bacteria | 2747 |
| 434 | Ga0501316_003134 | 3300049532 | Bacteria | 1585 |
| 435 | Ga0501316_003754 | 3300049532 | Bacteria | 1493 |
| 436 | Ga0501317_001797 | 3300049533 | Bacteria | 1922 |
| 437 | Ga0501317_005610 | 3300049533 | Bacteria | 1351 |
| 438 | Ga0501321_005095 | 3300049537 | Bacteria | 1286 |
| 439 | Ga0501323_002103 | 3300049539 | Bacteria | 1890 |
| 440 | Ga0501323_003065 | 3300049539 | Bacteria | 1678 |
| 441 | Ga0501332_04546 | 3300049548 | Bacteria | 829 |
| 442 | Ga0501334_05980 | 3300049550 | Bacteria | 812 |
| 443 | Ga0501335_000078 | 3300049551 | Bacteria | 4264 |
| 444 | Ga0501335_002159 | 3300049551 | Bacteria | 1580 |
| 445 | Ga0501336_000175 | 3300049552 | Bacteria | 2707 |
| 446 | Ga0501336_001783 | 3300049552 | Bacteria | 1326 |
| 447 | Ga0501337_001125 | 3300049553 | Bacteria | 1480 |
| 448 | Ga0501340_001753 | 3300049556 | Bacteria | 1202 |
| 449 | Ga0501034_0003612 | 3300049571 | Bacteria | 17554 |
| 450 | Ga0501034_0105274 | 3300049571 | Bacteria | 2814 |
| 451 | Ga0501037_0004262 | 3300049573 | Bacteria | 10367 |
| 452 | Ga0501037_0125228 | 3300049573 | Bacteria | 1845 |
| 453 | Ga0501043_0067793 | 3300049579 | Bacteria | 2802 |
| 454 | Ga0501047_0022683 | 3300049581 | Bacteria | 6026 |
| 455 | Ga0501077_0078320 | 3300049593 | Bacteria | 2095 |
| 456 | Ga0501224_005887 | 3300049664 | Bacteria | 1769 |
| 457 | Ga0501235_029139 | 3300049669 | Bacteria | 1242 |
| 458 | Ga0501235_044340 | 3300049669 | Bacteria | 1021 |
| 459 | Ga0501238_003244 | 3300049671 | Bacteria | 1992 |
| 460 | Ga0501249_051635 | 3300049679 | Bacteria | 944 |
| 461 | Ga0501035_0012956 | 3300049822 | Bacteria | 7696 |
| 462 | Ga0501044_0276978 | 3300049823 | Bacteria | 1612 |
| 463 | Ga0501044_0287161 | 3300049823 | Bacteria | 1577 |
| 464 | Ga0501212_014440 | 3300049851 | Bacteria | 1169 |
| 465 | nmdc:mga03683_196481_c1 | 3300050489 | Bacteria | 924 |
| 466 | nmdc:mga03n38_262152_c1 | 3300050490 | Bacteria | 916 |
| 467 | nmdc:mga00v17_23834_c1 | 3300050491 | Bacteria | 3544 |
| 468 | nmdc:mga0k408_11232_c1 | 3300050493 | Bacteria | 4869 |
| 469 | nmdc:mga06z11_11792_c1 | 3300050494 | Bacteria | 3780 |
| 470 | nmdc:mga06z11_19246_c1 | 3300050494 | Bacteria | 3135 |
| 471 | nmdc:mga06z11_307_c1 | 3300050494 | Bacteria | 18616 |
| 472 | nmdc:mga04h51_425_c1 | 3300050495 | Bacteria | 8670 |
| 473 | nmdc:mga07m45_169047_c1 | 3300050496 | Bacteria | 1270 |
| 474 | nmdc:mga05p37_48785_c1 | 3300050507 | Bacteria | 5206 |
| 475 | nmdc:mga09592_298761_c1 | 3300050508 | Bacteria | 1396 |
| 476 | nmdc:mga06r32_474880_c1 | 3300050510 | Bacteria | 1229 |
| 477 | Ga0495595_0090252 | 3300053084 | Bacteria | 1469 |
| 478 | Ga0500578_0000665 | 3300053086 | Bacteria | 41170 |
| 479 | Ga0500643_008397 | 3300053087 | Bacteria | 4061 |
| 480 | Ga0500643_021059 | 3300053087 | Bacteria | 2119 |
| 481 | Ga0500643_035455 | 3300053087 | Bacteria | 1495 |
| 482 | Ga0500644_0000004 | 3300053088 | Bacteria | 173652 |
| 483 | Ga0500644_0000692 | 3300053088 | Bacteria | 12174 |
| 484 | Ga0500644_0050571 | 3300053088 | Bacteria | 1423 |
| 485 | Ga0500647_0024726 | 3300053091 | Bacteria | 2826 |
| 486 | Ga0500641_0022665 | 3300053096 | Bacteria | 2408 |
| 487 | Ga0500556_0017078 | 3300053104 | Bacteria | 2268 |
| 488 | Ga0500556_0020396 | 3300053104 | Bacteria | 2120 |
| 489 | Ga0500556_0039757 | 3300053104 | Bacteria | 1650 |
| 490 | Ga0500562_000610 | 3300053108 | Bacteria | 8621 |
| 491 | Ga0500562_003889 | 3300053108 | Bacteria | 3765 |
| 492 | Ga0500572_000606 | 3300053111 | Bacteria | 12073 |
| 493 | Ga0500592_000198 | 3300053116 | Bacteria | 11379 |
| 494 | Ga0500594_0000160 | 3300053118 | Bacteria | 17428 |
| 495 | Ga0500595_015303 | 3300053119 | Bacteria | 2883 |
| 496 | Ga0500608_000026 | 3300053122 | Bacteria | 68633 |
| 497 | Ga0500618_000043 | 3300053125 | Bacteria | 110342 |
| 498 | Ga0500642_0186117 | 3300053130 | Bacteria | 970 |
| 499 | Ga0500658_0012169 | 3300053134 | Bacteria | 3168 |
| 500 | Ga0500559_0000008 | 3300053136 | Bacteria | 182182 |
| 501 | Ga0500559_0000227 | 3300053136 | Bacteria | 44722 |
| 502 | Ga0500559_0005346 | 3300053136 | Bacteria | 5914 |
| 503 | Ga0500564_000017 | 3300053138 | Bacteria | 52534 |
| 504 | Ga0500577_0014091 | 3300053142 | Bacteria | 2462 |
| 505 | Ga0500616_0012088 | 3300053153 | Bacteria | 5065 |
| 506 | Ga0500616_0039570 | 3300053153 | Bacteria | 2541 |
| 507 | Ga0500619_002977 | 3300053154 | Bacteria | 3378 |
| 508 | Ga0500622_0000047 | 3300053156 | Bacteria | 149427 |
| 509 | Ga0500622_0003357 | 3300053156 | Bacteria | 10782 |
| 510 | Ga0500622_0003947 | 3300053156 | Bacteria | 9581 |
| 511 | Ga0500622_0019739 | 3300053156 | Bacteria | 3578 |
| 512 | Ga0500627_0030053 | 3300053158 | Bacteria | 2271 |
| 513 | Ga0500636_0044897 | 3300053177 | Bacteria | 2607 |
| 514 | Ga0500645_008084 | 3300053730 | Bacteria | 3621 |
| 515 | Ga0500645_009720 | 3300053730 | Bacteria | 3219 |
| 516 | Ga0500645_080426 | 3300053730 | Bacteria | 930 |
| 517 | Ga0500609_000721 | 3300053731 | Bacteria | 4970 |
| 518 | Ga0501082_0420817 | 3300060353 | Bacteria | 1167 |
| 519 | Ga0501082_0507006 | 3300060353 | Bacteria | 1055 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10405389 | Ga0307413_104053891 | 201 |
| 2 | 3300031903 | Ga0307407_10248898 | Ga0307407_102488982 | 201 |
| 3 | 3300031995 | Ga0307409_100103587 | Ga0307409_1001035872 | 201 |
| 4 | 3300032005 | Ga0307411_10160596 | Ga0307411_101605962 | 201 |
| 5 | 3300032126 | Ga0307415_100078895 | Ga0307415_1000788952 | 201 |
| 6 | 3300049529 | Ga0501313_025817 | Ga0501313_025817_24_629 | 201 |
| 7 | 3300049669 | Ga0501235_044340 | Ga0501235_044340_246_983 | 201 |
| 8 | 3300049679 | Ga0501249_051635 | Ga0501249_051635_54_791 | 201 |
| 9 | 3300046810 | Ga0495660_0049606 | Ga0495660_0049606_570_1313 | 221 |
| 10 | 3300025916 | Ga0207663_10054697 | Ga0207663_100546972 | 222 |
| 11 | 3300048903 | Ga0496100_0168768 | Ga0496100_0168768_411_1154 | 223 |
| 12 | 3300048909 | Ga0496106_0221842 | Ga0496106_0221842_626_1369 | 223 |
| 13 | 3300046665 | Ga0495661_0111076 | Ga0495661_0111076_309_1052 | 224 |
| 14 | 3300049528 | Ga0501312_000649 | Ga0501312_000649_1767_2510 | 225 |
| 15 | 3300049532 | Ga0501316_003754 | Ga0501316_003754_257_1000 | 225 |
| 16 | 3300046530 | Ga0495654_0022462 | Ga0495654_0022462_1278_2015 | 227 |
| 17 | 3300049664 | Ga0501224_005887 | Ga0501224_005887_217_936 | 227 |
| 18 | 3300053116 | Ga0500592_000198 | Ga0500592_000198_9518_10255 | 227 |
| 19 | 3300053158 | Ga0500627_0030053 | Ga0500627_0030053_1387_2124 | 227 |
| 20 | 3300041408 | Ga0439453_0015104 | Ga0439453_0015104_123_863 | 228 |
| 21 | 3300042876 | Ga0451577_0480131 | Ga0451577_0480131_154_897 | 229 |
| 22 | 3300049132 | Ga0501343_002377 | Ga0501343_002377_248_991 | 229 |
| 23 | 3300053156 | Ga0500622_0003357 | Ga0500622_0003357_2001_2738 | 229 |
| 24 | 3300053730 | Ga0500645_080426 | Ga0500645_080426_108_845 | 229 |
| 25 | 3300046492 | Ga0495585_0018627 | Ga0495585_0018627_1953_2693 | 230 |
| 26 | 3300046513 | Ga0495616_0000112 | Ga0495616_0000112_67747_68487 | 230 |
| 27 | 3300053731 | Ga0500609_000721 | Ga0500609_000721_2818_3558 | 230 |
| 28 | 3300005436 | Ga0070713_100085475 | Ga0070713_1000854752 | 231 |
| 29 | 3300005437 | Ga0070710_10115372 | Ga0070710_101153722 | 231 |
| 30 | 3300006175 | Ga0070712_100099696 | Ga0070712_1000996961 | 231 |
| 31 | 3300010159 | Ga0099796_10107096 | Ga0099796_101070961 | 231 |
| 32 | 3300025915 | Ga0207693_10063121 | Ga0207693_100631213 | 231 |
| 33 | 3300025928 | Ga0207700_10063843 | Ga0207700_100638433 | 231 |
| 34 | 3300039437 | Ga0436365_1645730 | Ga0436365_1645730_51_788 | 231 |
| 35 | 3300039450 | Ga0436363_1269293 | Ga0436363_1269293_262_999 | 231 |
| 36 | 3300039453 | Ga0436362_1255974 | Ga0436362_1255974_299_1036 | 231 |
| 37 | 3300060353 | Ga0501082_0507006 | Ga0501082_0507006_35_769 | 231 |
| 38 | 3300005347 | Ga0070668_100021693 | Ga0070668_1000216937 | 232 |
| 39 | 3300005353 | Ga0070669_100018715 | Ga0070669_1000187153 | 232 |
| 40 | 3300005355 | Ga0070671_100000479 | Ga0070671_1000004798 | 232 |
| 41 | 3300005617 | Ga0068859_100000999 | Ga0068859_10000099911 | 232 |
| 42 | 3300005841 | Ga0068863_100007149 | Ga0068863_1000071497 | 232 |
| 43 | 3300005842 | Ga0068858_100014500 | Ga0068858_1000145003 | 232 |
| 44 | 3300005843 | Ga0068860_100012979 | Ga0068860_1000129791 | 232 |
| 45 | 3300005937 | Ga0081455_10094409 | Ga0081455_100944093 | 232 |
| 46 | 3300006931 | Ga0097620_100000999 | Ga0097620_10000099911 | 232 |
| 47 | 3300009177 | Ga0105248_10012881 | Ga0105248_100128817 | 232 |
| 48 | 3300013306 | Ga0163162_10018748 | Ga0163162_100187487 | 232 |
| 49 | 3300014325 | Ga0163163_10014204 | Ga0163163_100142049 | 232 |
| 50 | 3300014968 | Ga0157379_10064313 | Ga0157379_100643132 | 232 |
| 51 | 3300021377 | Ga0213874_10027254 | Ga0213874_100272542 | 232 |
| 52 | 3300025923 | Ga0207681_10009686 | Ga0207681_100096867 | 232 |
| 53 | 3300025931 | Ga0207644_10004836 | Ga0207644_100048367 | 232 |
| 54 | 3300025941 | Ga0207711_10013682 | Ga0207711_100136822 | 232 |
| 55 | 3300025972 | Ga0207668_10025099 | Ga0207668_100250996 | 232 |
| 56 | 3300025986 | Ga0207658_10013527 | Ga0207658_100135273 | 232 |
| 57 | 3300026035 | Ga0207703_10002468 | Ga0207703_1000246813 | 232 |
| 58 | 3300026088 | Ga0207641_10087617 | Ga0207641_100876173 | 232 |
| 59 | 3300026095 | Ga0207676_10186538 | Ga0207676_101865382 | 232 |
| 60 | 3300027876 | Ga0209974_10039696 | Ga0209974_100396961 | 232 |
| 61 | 3300028379 | Ga0268266_10581886 | Ga0268266_105818862 | 232 |
| 62 | 3300028381 | Ga0268264_10018738 | Ga0268264_100187387 | 232 |
| 63 | 3300031852 | Ga0307410_10070753 | Ga0307410_100707532 | 232 |
| 64 | 3300039450 | Ga0436363_1621007 | Ga0436363_1621007_490_1230 | 232 |
| 65 | 3300039453 | Ga0436362_0176928 | Ga0436362_0176928_915_1655 | 232 |
| 66 | 3300005293 | Ga0065715_10185097 | Ga0065715_101850972 | 233 |
| 67 | 3300005439 | Ga0070711_100369595 | Ga0070711_1003695951 | 233 |
| 68 | 3300014326 | Ga0157380_10035915 | Ga0157380_100359153 | 233 |
| 69 | 3300036401 | Ga0373937_0147549 | Ga0373937_0147549_439_1182 | 233 |
| 70 | 3300046462 | Ga0495651_0216004 | Ga0495651_0216004_64_807 | 233 |
| 71 | 3300048088 | Ga0495602_0141478 | Ga0495602_0141478_510_1253 | 233 |
| 72 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001307 | 234 |
| 73 | 3300005339 | Ga0070660_100001280 | Ga0070660_10000128012 | 234 |
| 74 | 3300005366 | Ga0070659_100015232 | Ga0070659_1000152326 | 234 |
| 75 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021572 | 234 |
| 76 | 3300025919 | Ga0207657_10003354 | Ga0207657_100033549 | 234 |
| 77 | 3300025932 | Ga0207690_10003860 | Ga0207690_1000386010 | 234 |
| 78 | 3300031731 | Ga0307405_10030398 | Ga0307405_100303984 | 235 |
| 79 | 3300031995 | Ga0307409_100071151 | Ga0307409_1000711512 | 235 |
| 80 | 3300049161 | Ga0501305_000807 | Ga0501305_000807_1585_2328 | 235 |
| 81 | 3300049523 | Ga0501300_006030 | Ga0501300_006030_286_1029 | 235 |
| 82 | 3300049531 | Ga0501315_000169 | Ga0501315_000169_2565_3308 | 235 |
| 83 | 3300049532 | Ga0501316_000492 | Ga0501316_000492_1445_2188 | 235 |
| 84 | 3300049551 | Ga0501335_000078 | Ga0501335_000078_2121_2864 | 235 |
| 85 | 3300049552 | Ga0501336_000175 | Ga0501336_000175_973_1716 | 235 |
| 86 | 3300049669 | Ga0501235_029139 | Ga0501235_029139_271_1014 | 235 |
| 87 | 3300049851 | Ga0501212_014440 | Ga0501212_014440_188_931 | 235 |
| 88 | 3300009036 | Ga0105244_10066915 | Ga0105244_100669152 | 236 |
| 89 | 3300009098 | Ga0105245_10039365 | Ga0105245_100393651 | 236 |
| 90 | 3300025261 | Ga0209233_1024480 | Ga0209233_10244802 | 237 |
| 91 | 3300032002 | Ga0307416_100208507 | Ga0307416_1002085072 | 237 |
| 92 | 3300005563 | Ga0068855_100214207 | Ga0068855_1002142073 | 238 |
| 93 | 3300025949 | Ga0207667_10357388 | Ga0207667_103573881 | 238 |
| 94 | 3300037312 | Ga0395899_0042865 | Ga0395899_0042865_1810_2535 | 238 |
| 95 | 3300037418 | Ga0395900_0568185 | Ga0395900_0568185_65_790 | 238 |
| 96 | 3300037466 | Ga0395898_0227526 | Ga0395898_0227526_77_802 | 238 |
| 97 | 3300038443 | Ga0395901_0084333 | Ga0395901_0084333_1879_2604 | 238 |
| 98 | 3300049531 | Ga0501315_012383 | Ga0501315_012383_255_998 | 238 |
| 99 | 3300049533 | Ga0501317_001797 | Ga0501317_001797_1123_1866 | 238 |
| 100 | iso_pu_bacteria | 2513237087 | 2513590212 | 238 |
| 101 | 3300044842 | Ga0466957_0381957 | Ga0466957_0381957_14_757 | 239 |
| 102 | iso_pu_bacteria | 2510917020 | 2511124126 | 239 |
| 103 | iso_pu_bacteria | 2582581279 | 2585149518 | 239 |
| 104 | iso_pu_bacteria | 2582581280 | 2585154087 | 239 |
| 105 | iso_pu_bacteria | 2582581293 | 2585197483 | 239 |
| 106 | iso_pu_bacteria | 2585428106 | 2587916248 | 239 |
| 107 | iso_pu_bacteria | 2643221545 | 2643747562 | 239 |
| 108 | iso_pu_bacteria | 2643221552 | 2643778599 | 239 |
| 109 | iso_pu_bacteria | 2643221574 | 2643883603 | 239 |
| 110 | iso_pu_bacteria | 2643221583 | 2643925006 | 239 |
| 111 | iso_pu_bacteria | 2643221584 | 2643931246 | 239 |
| 112 | iso_pu_bacteria | 2643221640 | 2644226246 | 239 |
| 113 | iso_pu_bacteria | 2643221642 | 2644235734 | 239 |
| 114 | iso_pu_bacteria | 2643221663 | 2644354258 | 239 |
| 115 | iso_pu_bacteria | 2643221691 | 2644509442 | 239 |
| 116 | iso_pu_bacteria | 2643221699 | 2644551860 | 239 |
| 117 | iso_pu_bacteria | 2643221699 | 2644553107 | 239 |
| 118 | iso_pu_bacteria | 2791355048 | 2792460558 | 239 |
| 119 | iso_pu_bacteria | 2818991435 | 2819538763 | 239 |
| 120 | iso_pu_bacteria | 2818991454 | 2819648608 | 239 |
| 121 | iso_pu_bacteria | 2843744320 | 2843747841 | 239 |
| 122 | iso_pu_bacteria | 2849560528 | 2849560530 | 239 |
| 123 | iso_pu_bacteria | 2849573788 | 2849577104 | 239 |
| 124 | iso_pu_bacteria | 2851153111 | 2851153740 | 239 |
| 125 | iso_pu_bacteria | 2857504554 | 2857506451 | 239 |
| 126 | iso_pu_bacteria | 2884960567 | 2884964367 | 239 |
| 127 | iso_pu_bacteria | 2898329390 | 2898329586 | 239 |
| 128 | iso_pu_bacteria | 2928531327 | 2928533609 | 239 |
| 129 | iso_pu_bacteria | 2928972540 | 2928975215 | 239 |
| 130 | iso_pu_bacteria | 2941485952 | 2941487286 | 239 |
| 131 | iso_pu_bacteria | 2977240413 | 2977241791 | 239 |
| 132 | 3300044712 | Ga0453684_0027798 | Ga0453684_0027798_3835_4569 | 240 |
| 133 | 3300005367 | Ga0070667_100002158 | Ga0070667_10000215811 | 241 |
| 134 | 3300005548 | Ga0070665_100010051 | Ga0070665_1000100512 | 241 |
| 135 | 3300005842 | Ga0068858_100054499 | Ga0068858_1000544992 | 241 |
| 136 | 3300025986 | Ga0207658_10000985 | Ga0207658_1000098510 | 241 |
| 137 | 3300025986 | Ga0207658_10640297 | Ga0207658_106402971 | 241 |
| 138 | 3300028379 | Ga0268266_10010417 | Ga0268266_100104172 | 241 |
| 139 | 3300031595 | Ga0265313_10008177 | Ga0265313_100081775 | 241 |
| 140 | 3300044656 | Ga0466969_0000677 | Ga0466969_0000677_4372_5109 | 241 |
| 141 | 3300044693 | Ga0466961_0006897 | Ga0466961_0006897_5070_5807 | 241 |
| 142 | 3300044719 | Ga0466971_0002075 | Ga0466971_0002075_1066_1803 | 241 |
| 143 | 3300044842 | Ga0466957_0006824 | Ga0466957_0006824_3435_4172 | 241 |
| 144 | 3300045049 | Ga0466959_0001525 | Ga0466959_0001525_8001_8738 | 241 |
| 145 | 3300045836 | Ga0466958_0077815 | Ga0466958_0077815_133_870 | 241 |
| 146 | 3300046525 | Ga0495663_0000375 | Ga0495663_0000375_6669_7406 | 241 |
| 147 | 3300049579 | Ga0501043_0067793 | Ga0501043_0067793_1717_2454 | 241 |
| 148 | 3300049822 | Ga0501035_0012956 | Ga0501035_0012956_3128_3865 | 241 |
| 149 | 3300053087 | Ga0500643_035455 | Ga0500643_035455_646_1383 | 241 |
| 150 | 3300053104 | Ga0500556_0020396 | Ga0500556_0020396_937_1674 | 241 |
| 151 | 3300053153 | Ga0500616_0012088 | Ga0500616_0012088_1771_2508 | 241 |
| 152 | 3300053730 | Ga0500645_008084 | Ga0500645_008084_1458_2195 | 241 |
| 153 | 3300003771 | Ga0055526_1036160 | Ga0055526_10361602 | 242 |
| 154 | 3300003773 | Ga0055537_1002952 | Ga0055537_10029525 | 242 |
| 155 | 3300003775 | Ga0055524_1033508 | Ga0055524_10335082 | 242 |
| 156 | 3300003781 | Ga0055536_1000478 | Ga0055536_100047822 | 242 |
| 157 | 3300003781 | Ga0055536_1005309 | Ga0055536_10053091 | 242 |
| 158 | 3300003781 | Ga0055536_1006045 | Ga0055536_10060451 | 242 |
| 159 | 3300003790 | Ga0055528_1008440 | Ga0055528_10084404 | 242 |
| 160 | 3300003790 | Ga0055528_1021094 | Ga0055528_10210942 | 242 |
| 161 | 3300003791 | Ga0055530_10014825 | Ga0055530_100148251 | 242 |
| 162 | 3300003791 | Ga0055530_10017903 | Ga0055530_100179031 | 242 |
| 163 | 3300003794 | Ga0055531_10001093 | Ga0055531_100010938 | 242 |
| 164 | 3300003794 | Ga0055531_10003069 | Ga0055531_100030696 | 242 |
| 165 | 3300003794 | Ga0055531_10003487 | Ga0055531_1000348711 | 242 |
| 166 | 3300005262 | Ga0065165_1001045 | Ga0065165_10010455 | 242 |
| 167 | 3300005327 | Ga0070658_10004249 | Ga0070658_100042495 | 242 |
| 168 | 3300005331 | Ga0070670_100216330 | Ga0070670_1002163302 | 242 |
| 169 | 3300005336 | Ga0070680_100000264 | Ga0070680_10000026428 | 242 |
| 170 | 3300005339 | Ga0070660_100639238 | Ga0070660_1006392381 | 242 |
| 171 | 3300005340 | Ga0070689_100691165 | Ga0070689_1006911651 | 242 |
| 172 | 3300005347 | Ga0070668_100003297 | Ga0070668_10000329710 | 242 |
| 173 | 3300005347 | Ga0070668_100093507 | Ga0070668_1000935073 | 242 |
| 174 | 3300005347 | Ga0070668_100371606 | Ga0070668_1003716062 | 242 |
| 175 | 3300005347 | Ga0070668_100426046 | Ga0070668_1004260462 | 242 |
| 176 | 3300005355 | Ga0070671_100019977 | Ga0070671_1000199772 | 242 |
| 177 | 3300005365 | Ga0070688_100018458 | Ga0070688_1000184583 | 242 |
| 178 | 3300005367 | Ga0070667_100021993 | Ga0070667_1000219933 | 242 |
| 179 | 3300005367 | Ga0070667_100076986 | Ga0070667_1000769861 | 242 |
| 180 | 3300005455 | Ga0070663_100468703 | Ga0070663_1004687032 | 242 |
| 181 | 3300005456 | Ga0070678_100237023 | Ga0070678_1002370232 | 242 |
| 182 | 3300005457 | Ga0070662_100489754 | Ga0070662_1004897542 | 242 |
| 183 | 3300005458 | Ga0070681_10000213 | Ga0070681_1000021328 | 242 |
| 184 | 3300005530 | Ga0070679_100242218 | Ga0070679_1002422182 | 242 |
| 185 | 3300005539 | Ga0068853_100178507 | Ga0068853_1001785073 | 242 |
| 186 | 3300005547 | Ga0070693_100291452 | Ga0070693_1002914522 | 242 |
| 187 | 3300005548 | Ga0070665_100000940 | Ga0070665_10000094028 | 242 |
| 188 | 3300005548 | Ga0070665_100001410 | Ga0070665_1000014107 | 242 |
| 189 | 3300005563 | Ga0068855_100001693 | Ga0068855_10000169329 | 242 |
| 190 | 3300005564 | Ga0070664_100449815 | Ga0070664_1004498152 | 242 |
| 191 | 3300005614 | Ga0068856_100056115 | Ga0068856_1000561156 | 242 |
| 192 | 3300005614 | Ga0068856_100201468 | Ga0068856_1002014683 | 242 |
| 193 | 3300005614 | Ga0068856_100990431 | Ga0068856_1009904311 | 242 |
| 194 | 3300005617 | Ga0068859_100469516 | Ga0068859_1004695162 | 242 |
| 195 | 3300005618 | Ga0068864_100003837 | Ga0068864_10000383713 | 242 |
| 196 | 3300005618 | Ga0068864_100016985 | Ga0068864_1000169853 | 242 |
| 197 | 3300005618 | Ga0068864_100168894 | Ga0068864_1001688942 | 242 |
| 198 | 3300005618 | Ga0068864_100620802 | Ga0068864_1006208021 | 242 |
| 199 | 3300005618 | Ga0068864_100797002 | Ga0068864_1007970021 | 242 |
| 200 | 3300005719 | Ga0068861_100318426 | Ga0068861_1003184262 | 242 |
| 201 | 3300005841 | Ga0068863_100006162 | Ga0068863_1000061623 | 242 |
| 202 | 3300005842 | Ga0068858_100064743 | Ga0068858_1000647435 | 242 |
| 203 | 3300005843 | Ga0068860_100001370 | Ga0068860_10000137027 | 242 |
| 204 | 3300005843 | Ga0068860_100111046 | Ga0068860_1001110463 | 242 |
| 205 | 3300005844 | Ga0068862_100004692 | Ga0068862_10000469213 | 242 |
| 206 | 3300005844 | Ga0068862_100146975 | Ga0068862_1001469752 | 242 |
| 207 | 3300005844 | Ga0068862_100420817 | Ga0068862_1004208171 | 242 |
| 208 | 3300005937 | Ga0081455_10184193 | Ga0081455_101841932 | 242 |
| 209 | 3300006038 | Ga0075365_10002352 | Ga0075365_100023525 | 242 |
| 210 | 3300006042 | Ga0075368_10000471 | Ga0075368_100004713 | 242 |
| 211 | 3300006048 | Ga0075363_100008842 | Ga0075363_1000088424 | 242 |
| 212 | 3300006048 | Ga0075363_100072890 | Ga0075363_1000728902 | 242 |
| 213 | 3300006177 | Ga0075362_10035447 | Ga0075362_100354472 | 242 |
| 214 | 3300006178 | Ga0075367_10020160 | Ga0075367_100201603 | 242 |
| 215 | 3300006186 | Ga0075369_10010780 | Ga0075369_100107802 | 242 |
| 216 | 3300006195 | Ga0075366_10037719 | Ga0075366_100377192 | 242 |
| 217 | 3300006353 | Ga0075370_10075248 | Ga0075370_100752483 | 242 |
| 218 | 3300006844 | Ga0075428_100032742 | Ga0075428_1000327425 | 242 |
| 219 | 3300006847 | Ga0075431_100021443 | Ga0075431_1000214436 | 242 |
| 220 | 3300006931 | Ga0097620_100469435 | Ga0097620_1004694352 | 242 |
| 221 | 3300007788 | Ga0099795_10000521 | Ga0099795_100005217 | 242 |
| 222 | 3300009093 | Ga0105240_10003426 | Ga0105240_1000342618 | 242 |
| 223 | 3300009093 | Ga0105240_10099371 | Ga0105240_100993713 | 242 |
| 224 | 3300009093 | Ga0105240_10399768 | Ga0105240_103997682 | 242 |
| 225 | 3300009147 | Ga0114129_10063020 | Ga0114129_100630203 | 242 |
| 226 | 3300009176 | Ga0105242_10120391 | Ga0105242_101203913 | 242 |
| 227 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001189 | 242 |
| 228 | 3300009177 | Ga0105248_10000685 | Ga0105248_100006852 | 242 |
| 229 | 3300009177 | Ga0105248_10044544 | Ga0105248_100445444 | 242 |
| 230 | 3300009177 | Ga0105248_10070680 | Ga0105248_100706803 | 242 |
| 231 | 3300009177 | Ga0105248_10201991 | Ga0105248_102019912 | 242 |
| 232 | 3300009177 | Ga0105248_10604118 | Ga0105248_106041182 | 242 |
| 233 | 3300009551 | Ga0105238_10020646 | Ga0105238_100206465 | 242 |
| 234 | 3300009551 | Ga0105238_10331880 | Ga0105238_103318803 | 242 |
| 235 | 3300009553 | Ga0105249_10000818 | Ga0105249_1000081833 | 242 |
| 236 | 3300009553 | Ga0105249_10384626 | Ga0105249_103846262 | 242 |
| 237 | 3300010159 | Ga0099796_10000086 | Ga0099796_100000868 | 242 |
| 238 | 3300013105 | Ga0157369_10023976 | Ga0157369_100239764 | 242 |
| 239 | 3300013306 | Ga0163162_10202233 | Ga0163162_102022332 | 242 |
| 240 | 3300013306 | Ga0163162_10436117 | Ga0163162_104361172 | 242 |
| 241 | 3300014325 | Ga0163163_10070984 | Ga0163163_100709843 | 242 |
| 242 | 3300014325 | Ga0163163_10562593 | Ga0163163_105625931 | 242 |
| 243 | 3300014326 | Ga0157380_10129517 | Ga0157380_101295172 | 242 |
| 244 | 3300014326 | Ga0157380_10275785 | Ga0157380_102757852 | 242 |
| 245 | 3300014968 | Ga0157379_10305330 | Ga0157379_103053302 | 242 |
| 246 | 3300024225 | Ga0224572_1003965 | Ga0224572_10039653 | 242 |
| 247 | 3300024225 | Ga0224572_1021452 | Ga0224572_10214521 | 242 |
| 248 | 3300024227 | Ga0228598_1046721 | Ga0228598_10467211 | 242 |
| 249 | 3300025263 | Ga0209565_1000127 | Ga0209565_100012720 | 242 |
| 250 | 3300025291 | Ga0209675_1010000 | Ga0209675_10100001 | 242 |
| 251 | 3300025292 | Ga0209676_1000046 | Ga0209676_1000046168 | 242 |
| 252 | 3300025292 | Ga0209676_1000336 | Ga0209676_100033660 | 242 |
| 253 | 3300025292 | Ga0209676_1000476 | Ga0209676_100047656 | 242 |
| 254 | 3300025292 | Ga0209676_1001278 | Ga0209676_10012784 | 242 |
| 255 | 3300025295 | Ga0209564_1005120 | Ga0209564_10051203 | 242 |
| 256 | 3300025295 | Ga0209564_1023284 | Ga0209564_10232842 | 242 |
| 257 | 3300025297 | Ga0209758_1000450 | Ga0209758_100045056 | 242 |
| 258 | 3300025297 | Ga0209758_1008106 | Ga0209758_10081062 | 242 |
| 259 | 3300025298 | Ga0209050_1000506 | Ga0209050_100050656 | 242 |
| 260 | 3300025298 | Ga0209050_1007979 | Ga0209050_10079792 | 242 |
| 261 | 3300025298 | Ga0209050_1018460 | Ga0209050_10184602 | 242 |
| 262 | 3300025298 | Ga0209050_1019830 | Ga0209050_10198303 | 242 |
| 263 | 3300025299 | Ga0209256_1016565 | Ga0209256_10165652 | 242 |
| 264 | 3300025299 | Ga0209256_1019956 | Ga0209256_10199562 | 242 |
| 265 | 3300025303 | Ga0209051_1057178 | Ga0209051_10571782 | 242 |
| 266 | 3300025304 | Ga0209257_1000159 | Ga0209257_1000159107 | 242 |
| 267 | 3300025304 | Ga0209257_1000481 | Ga0209257_100048165 | 242 |
| 268 | 3300025304 | Ga0209257_1008528 | Ga0209257_10085287 | 242 |
| 269 | 3300025304 | Ga0209257_1028172 | Ga0209257_10281722 | 242 |
| 270 | 3300025903 | Ga0207680_10035160 | Ga0207680_100351603 | 242 |
| 271 | 3300025909 | Ga0207705_10024662 | Ga0207705_100246622 | 242 |
| 272 | 3300025909 | Ga0207705_10253309 | Ga0207705_102533091 | 242 |
| 273 | 3300025913 | Ga0207695_10003143 | Ga0207695_1000314314 | 242 |
| 274 | 3300025913 | Ga0207695_10070156 | Ga0207695_100701564 | 242 |
| 275 | 3300025913 | Ga0207695_10453733 | Ga0207695_104537332 | 242 |
| 276 | 3300025914 | Ga0207671_10168372 | Ga0207671_101683723 | 242 |
| 277 | 3300025917 | Ga0207660_10003027 | Ga0207660_100030277 | 242 |
| 278 | 3300025919 | Ga0207657_10528620 | Ga0207657_105286202 | 242 |
| 279 | 3300025921 | Ga0207652_10006822 | Ga0207652_100068225 | 242 |
| 280 | 3300025921 | Ga0207652_10115724 | Ga0207652_101157242 | 242 |
| 281 | 3300025924 | Ga0207694_10032403 | Ga0207694_100324035 | 242 |
| 282 | 3300025924 | Ga0207694_10410747 | Ga0207694_104107471 | 242 |
| 283 | 3300025925 | Ga0207650_10000201 | Ga0207650_1000020113 | 242 |
| 284 | 3300025925 | Ga0207650_10122435 | Ga0207650_101224352 | 242 |
| 285 | 3300025931 | Ga0207644_10089321 | Ga0207644_100893212 | 242 |
| 286 | 3300025931 | Ga0207644_10105354 | Ga0207644_101053541 | 242 |
| 287 | 3300025933 | Ga0207706_10062708 | Ga0207706_100627084 | 242 |
| 288 | 3300025933 | Ga0207706_10494750 | Ga0207706_104947501 | 242 |
| 289 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002890 | 242 |
| 290 | 3300025941 | Ga0207711_10001954 | Ga0207711_100019547 | 242 |
| 291 | 3300025941 | Ga0207711_10006432 | Ga0207711_100064322 | 242 |
| 292 | 3300025941 | Ga0207711_10025045 | Ga0207711_100250454 | 242 |
| 293 | 3300025941 | Ga0207711_10203374 | Ga0207711_102033743 | 242 |
| 294 | 3300025941 | Ga0207711_10325958 | Ga0207711_103259582 | 242 |
| 295 | 3300025945 | Ga0207679_10008351 | Ga0207679_100083515 | 242 |
| 296 | 3300025945 | Ga0207679_10070393 | Ga0207679_100703931 | 242 |
| 297 | 3300025949 | Ga0207667_10029154 | Ga0207667_100291545 | 242 |
| 298 | 3300025960 | Ga0207651_10043707 | Ga0207651_100437072 | 242 |
| 299 | 3300025960 | Ga0207651_10229855 | Ga0207651_102298552 | 242 |
| 300 | 3300025961 | Ga0207712_10118548 | Ga0207712_101185483 | 242 |
| 301 | 3300025961 | Ga0207712_10386918 | Ga0207712_103869182 | 242 |
| 302 | 3300025972 | Ga0207668_10000007 | Ga0207668_1000000748 | 242 |
| 303 | 3300025972 | Ga0207668_10000247 | Ga0207668_1000024741 | 242 |
| 304 | 3300025972 | Ga0207668_10356001 | Ga0207668_103560012 | 242 |
| 305 | 3300025986 | Ga0207658_10000052 | Ga0207658_1000005271 | 242 |
| 306 | 3300025986 | Ga0207658_10001933 | Ga0207658_1000193310 | 242 |
| 307 | 3300025986 | Ga0207658_10036009 | Ga0207658_100360093 | 242 |
| 308 | 3300026035 | Ga0207703_10049425 | Ga0207703_100494251 | 242 |
| 309 | 3300026067 | Ga0207678_10324071 | Ga0207678_103240712 | 242 |
| 310 | 3300026078 | Ga0207702_10023453 | Ga0207702_100234532 | 242 |
| 311 | 3300026078 | Ga0207702_10098159 | Ga0207702_100981592 | 242 |
| 312 | 3300026088 | Ga0207641_10267706 | Ga0207641_102677062 | 242 |
| 313 | 3300026095 | Ga0207676_10001242 | Ga0207676_1000124213 | 242 |
| 314 | 3300026095 | Ga0207676_10012779 | Ga0207676_100127793 | 242 |
| 315 | 3300026095 | Ga0207676_10094198 | Ga0207676_100941983 | 242 |
| 316 | 3300026095 | Ga0207676_10334476 | Ga0207676_103344762 | 242 |
| 317 | 3300026118 | Ga0207675_100139166 | Ga0207675_1001391662 | 242 |
| 318 | 3300026118 | Ga0207675_100154745 | Ga0207675_1001547453 | 242 |
| 319 | 3300026118 | Ga0207675_100923487 | Ga0207675_1009234871 | 242 |
| 320 | 3300026121 | Ga0207683_10099258 | Ga0207683_100992582 | 242 |
| 321 | 3300026142 | Ga0207698_10023739 | Ga0207698_100237393 | 242 |
| 322 | 3300027866 | Ga0209813_10000616 | Ga0209813_100006161 | 242 |
| 323 | 3300028379 | Ga0268266_10001205 | Ga0268266_1000120516 | 242 |
| 324 | 3300028379 | Ga0268266_10011789 | Ga0268266_100117893 | 242 |
| 325 | 3300028380 | Ga0268265_10002350 | Ga0268265_100023509 | 242 |
| 326 | 3300028380 | Ga0268265_10091103 | Ga0268265_100911033 | 242 |
| 327 | 3300028380 | Ga0268265_10134907 | Ga0268265_101349073 | 242 |
| 328 | 3300028381 | Ga0268264_10000684 | Ga0268264_100006846 | 242 |
| 329 | 3300028381 | Ga0268264_10210953 | Ga0268264_102109532 | 242 |
| 330 | 3300028381 | Ga0268264_10236140 | Ga0268264_102361402 | 242 |
| 331 | 3300028381 | Ga0268264_10638747 | Ga0268264_106387471 | 242 |
| 332 | 3300028786 | Ga0307517_10001029 | Ga0307517_1000102921 | 242 |
| 333 | 3300028786 | Ga0307517_10115170 | Ga0307517_101151702 | 242 |
| 334 | 3300028794 | Ga0307515_10066696 | Ga0307515_100666963 | 242 |
| 335 | 3300028794 | Ga0307515_10067676 | Ga0307515_100676766 | 242 |
| 336 | 3300028794 | Ga0307515_10315002 | Ga0307515_103150022 | 242 |
| 337 | 3300031018 | Ga0265773_1000596 | Ga0265773_10005962 | 242 |
| 338 | 3300031251 | Ga0265327_10000220 | Ga0265327_1000022079 | 242 |
| 339 | 3300031251 | Ga0265327_10152209 | Ga0265327_101522092 | 242 |
| 340 | 3300031456 | Ga0307513_10000082 | Ga0307513_10000082100 | 242 |
| 341 | 3300031456 | Ga0307513_10001006 | Ga0307513_1000100627 | 242 |
| 342 | 3300031456 | Ga0307513_10002226 | Ga0307513_1000222615 | 242 |
| 343 | 3300031824 | Ga0307413_10021312 | Ga0307413_100213123 | 242 |
| 344 | 3300031824 | Ga0307413_10060092 | Ga0307413_100600922 | 242 |
| 345 | 3300031852 | Ga0307410_10213633 | Ga0307410_102136333 | 242 |
| 346 | 3300031901 | Ga0307406_10006321 | Ga0307406_100063217 | 242 |
| 347 | 3300031903 | Ga0307407_10097113 | Ga0307407_100971133 | 242 |
| 348 | 3300031911 | Ga0307412_10079699 | Ga0307412_100796993 | 242 |
| 349 | 3300031995 | Ga0307409_100155825 | Ga0307409_1001558253 | 242 |
| 350 | 3300032002 | Ga0307416_100355940 | Ga0307416_1003559402 | 242 |
| 351 | 3300032002 | Ga0307416_100689512 | Ga0307416_1006895121 | 242 |
| 352 | 3300032004 | Ga0307414_10047374 | Ga0307414_100473742 | 242 |
| 353 | 3300032004 | Ga0307414_10061855 | Ga0307414_100618551 | 242 |
| 354 | 3300032004 | Ga0307414_10162131 | Ga0307414_101621312 | 242 |
| 355 | 3300032004 | Ga0307414_10205516 | Ga0307414_102055161 | 242 |
| 356 | 3300032005 | Ga0307411_10046571 | Ga0307411_100465712 | 242 |
| 357 | 3300035410 | Ga0373924_0031367 | Ga0373924_0031367_423_1166 | 242 |
| 358 | 3300035691 | Ga0373931_0022704 | Ga0373931_0022704_1864_2604 | 242 |
| 359 | 3300035724 | Ga0373933_0090001 | Ga0373933_0090001_632_1375 | 242 |
| 360 | 3300035725 | Ga0373947_0195926 | Ga0373947_0195926_527_1267 | 242 |
| 361 | 3300037068 | Ga0373925_0053200 | Ga0373925_0053200_2165_2905 | 242 |
| 362 | 3300037312 | Ga0395899_0006527 | Ga0395899_0006527_5063_5803 | 242 |
| 363 | 3300037418 | Ga0395900_0002429 | Ga0395900_0002429_17036_17776 | 242 |
| 364 | 3300037418 | Ga0395900_0459504 | Ga0395900_0459504_240_980 | 242 |
| 365 | 3300037466 | Ga0395898_0008060 | Ga0395898_0008060_7370_8110 | 242 |
| 366 | 3300037471 | Ga0395905_0007649 | Ga0395905_0007649_4824_5564 | 242 |
| 367 | 3300037471 | Ga0395905_0016314 | Ga0395905_0016314_2546_3286 | 242 |
| 368 | 3300037471 | Ga0395905_0214420 | Ga0395905_0214420_66_806 | 242 |
| 369 | 3300037471 | Ga0395905_0317642 | Ga0395905_0317642_425_1165 | 242 |
| 370 | 3300037471 | Ga0395905_0514689 | Ga0395905_0514689_254_994 | 242 |
| 371 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_54608_55348 | 242 |
| 372 | 3300038443 | Ga0395901_0013125 | Ga0395901_0013125_3996_4736 | 242 |
| 373 | 3300038443 | Ga0395901_0086637 | Ga0395901_0086637_2474_3214 | 242 |
| 374 | 3300039062 | Ga0400483_231819 | Ga0400483_231819_329_1075 | 242 |
| 375 | 3300039437 | Ga0436365_1145221 | Ga0436365_1145221_79_819 | 242 |
| 376 | 3300042436 | Ga0439435_0014277 | Ga0439435_0014277_1048_1788 | 242 |
| 377 | 3300044684 | Ga0466966_0055079 | Ga0466966_0055079_688_1428 | 242 |
| 378 | 3300046453 | Ga0495627_000269 | Ga0495627_000269_5518_6258 | 242 |
| 379 | 3300046457 | Ga0495590_0000439 | Ga0495590_0000439_9600_10340 | 242 |
| 380 | 3300046459 | Ga0495629_0216516 | Ga0495629_0216516_262_999 | 242 |
| 381 | 3300046460 | Ga0495638_0000347 | Ga0495638_0000347_10118_10858 | 242 |
| 382 | 3300046460 | Ga0495638_0000492 | Ga0495638_0000492_6512_7252 | 242 |
| 383 | 3300046471 | Ga0495650_0000007 | Ga0495650_0000007_244273_245013 | 242 |
| 384 | 3300046492 | Ga0495585_0167170 | Ga0495585_0167170_277_1017 | 242 |
| 385 | 3300046501 | Ga0495607_0090228 | Ga0495607_0090228_312_1052 | 242 |
| 386 | 3300046506 | Ga0495583_0000037 | Ga0495583_0000037_148430_149170 | 242 |
| 387 | 3300046506 | Ga0495583_0024449 | Ga0495583_0024449_28_768 | 242 |
| 388 | 3300046507 | Ga0495606_0005657 | Ga0495606_0005657_10964_11803 | 242 |
| 389 | 3300046512 | Ga0495610_0001339 | Ga0495610_0001339_6690_7430 | 242 |
| 390 | 3300046512 | Ga0495610_0002423 | Ga0495610_0002423_4286_5026 | 242 |
| 391 | 3300046512 | Ga0495610_0010802 | Ga0495610_0010802_541_1284 | 242 |
| 392 | 3300046518 | Ga0495631_0003776 | Ga0495631_0003776_3994_4734 | 242 |
| 393 | 3300046519 | Ga0495632_0023018 | Ga0495632_0023018_2535_3275 | 242 |
| 394 | 3300046520 | Ga0495637_0008992 | Ga0495637_0008992_3147_3887 | 242 |
| 395 | 3300046520 | Ga0495637_0021760 | Ga0495637_0021760_1811_2551 | 242 |
| 396 | 3300046524 | Ga0495648_0000105 | Ga0495648_0000105_1962_2702 | 242 |
| 397 | 3300046528 | Ga0495642_0013236 | Ga0495642_0013236_928_1668 | 242 |
| 398 | 3300046530 | Ga0495654_0000054 | Ga0495654_0000054_3988_4728 | 242 |
| 399 | 3300046539 | Ga0495621_0146330 | Ga0495621_0146330_100_840 | 242 |
| 400 | 3300046542 | Ga0495597_0043187 | Ga0495597_0043187_667_1407 | 242 |
| 401 | 3300046542 | Ga0495597_0146615 | Ga0495597_0146615_49_789 | 242 |
| 402 | 3300046558 | Ga0495633_0004403 | Ga0495633_0004403_4005_4745 | 242 |
| 403 | 3300046616 | Ga0495668_0000252 | Ga0495668_0000252_70652_71392 | 242 |
| 404 | 3300046616 | Ga0495668_0037195 | Ga0495668_0037195_158_901 | 242 |
| 405 | 3300046616 | Ga0495668_0063745 | Ga0495668_0063745_1116_1856 | 242 |
| 406 | 3300046616 | Ga0495668_0157644 | Ga0495668_0157644_465_1205 | 242 |
| 407 | 3300046616 | Ga0495668_0185403 | Ga0495668_0185403_128_868 | 242 |
| 408 | 3300046648 | Ga0495611_0145282 | Ga0495611_0145282_268_1008 | 242 |
| 409 | 3300046660 | Ga0495625_0000415 | Ga0495625_0000415_36313_37053 | 242 |
| 410 | 3300046660 | Ga0495625_0030568 | Ga0495625_0030568_2391_3131 | 242 |
| 411 | 3300046660 | Ga0495625_0070115 | Ga0495625_0070115_534_1274 | 242 |
| 412 | 3300046660 | Ga0495625_0120956 | Ga0495625_0120956_775_1515 | 242 |
| 413 | 3300046663 | Ga0495635_0091482 | Ga0495635_0091482_753_1496 | 242 |
| 414 | 3300046684 | Ga0495669_0050164 | Ga0495669_0050164_413_1153 | 242 |
| 415 | 3300046689 | Ga0495613_0000964 | Ga0495613_0000964_10884_11624 | 242 |
| 416 | 3300046691 | Ga0495670_0075951 | Ga0495670_0075951_75_815 | 242 |
| 417 | 3300046794 | Ga0495589_0152905 | Ga0495589_0152905_127_867 | 242 |
| 418 | 3300046810 | Ga0495660_0046650 | Ga0495660_0046650_997_1737 | 242 |
| 419 | 3300047320 | Ga0495672_0007870 | Ga0495672_0007870_5134_5874 | 242 |
| 420 | 3300047320 | Ga0495672_0024032 | Ga0495672_0024032_2714_3454 | 242 |
| 421 | 3300047445 | Ga0495677_0047193 | Ga0495677_0047193_563_1303 | 242 |
| 422 | 3300047446 | Ga0495679_026121 | Ga0495679_026121_313_1053 | 242 |
| 423 | 3300047469 | Ga0495673_0000402 | Ga0495673_0000402_44049_44789 | 242 |
| 424 | 3300047469 | Ga0495673_0001079 | Ga0495673_0001079_5892_6632 | 242 |
| 425 | 3300047470 | Ga0495681_0066352 | Ga0495681_0066352_360_1100 | 242 |
| 426 | 3300047472 | Ga0495686_0000572 | Ga0495686_0000572_41482_42222 | 242 |
| 427 | 3300047472 | Ga0495686_0004508 | Ga0495686_0004508_10238_10978 | 242 |
| 428 | 3300047472 | Ga0495686_0029609 | Ga0495686_0029609_2721_3461 | 242 |
| 429 | 3300048905 | Ga0496102_0108686 | Ga0496102_0108686_1742_2482 | 242 |
| 430 | 3300048905 | Ga0496102_0146564 | Ga0496102_0146564_1023_1763 | 242 |
| 431 | 3300048906 | Ga0496103_0000643 | Ga0496103_0000643_7077_7817 | 242 |
| 432 | 3300048906 | Ga0496103_0234389 | Ga0496103_0234389_143_883 | 242 |
| 433 | 3300048906 | Ga0496103_0262147 | Ga0496103_0262147_251_991 | 242 |
| 434 | 3300048907 | Ga0496104_0000088 | Ga0496104_0000088_62824_63567 | 242 |
| 435 | 3300048908 | Ga0496105_0018470 | Ga0496105_0018470_4646_5389 | 242 |
| 436 | 3300048910 | Ga0496107_0000041 | Ga0496107_0000041_65324_66199 | 242 |
| 437 | 3300048912 | Ga0496109_0020688 | Ga0496109_0020688_814_1554 | 242 |
| 438 | 3300048913 | Ga0496110_0001919 | Ga0496110_0001919_935_1678 | 242 |
| 439 | 3300048913 | Ga0496110_0679637 | Ga0496110_0679637_126_863 | 242 |
| 440 | 3300048914 | Ga0496111_0013661 | Ga0496111_0013661_1921_2664 | 242 |
| 441 | 3300048915 | Ga0496112_0031566 | Ga0496112_0031566_870_1613 | 242 |
| 442 | 3300048916 | Ga0496113_0002054 | Ga0496113_0002054_10182_10925 | 242 |
| 443 | 3300048916 | Ga0496113_0074106 | Ga0496113_0074106_1048_1788 | 242 |
| 444 | 3300048916 | Ga0496113_0639734 | Ga0496113_0639734_84_824 | 242 |
| 445 | 3300048917 | Ga0496114_0750784 | Ga0496114_0750784_34_786 | 242 |
| 446 | 3300048918 | Ga0496115_0004136 | Ga0496115_0004136_9353_10093 | 242 |
| 447 | 3300048918 | Ga0496115_0005514 | Ga0496115_0005514_6008_6748 | 242 |
| 448 | 3300048918 | Ga0496115_0088679 | Ga0496115_0088679_1139_1879 | 242 |
| 449 | 3300048918 | Ga0496115_0154511 | Ga0496115_0154511_1083_1835 | 242 |
| 450 | 3300048918 | Ga0496115_0184285 | Ga0496115_0184285_755_1495 | 242 |
| 451 | 3300048919 | Ga0496116_0003801 | Ga0496116_0003801_12796_13536 | 242 |
| 452 | 3300048919 | Ga0496116_0011628 | Ga0496116_0011628_4620_5360 | 242 |
| 453 | 3300048920 | Ga0496117_0005240 | Ga0496117_0005240_6254_6994 | 242 |
| 454 | 3300048920 | Ga0496117_0043782 | Ga0496117_0043782_206_946 | 242 |
| 455 | 3300048921 | Ga0496118_0013510 | Ga0496118_0013510_5710_6450 | 242 |
| 456 | 3300048921 | Ga0496118_0020836 | Ga0496118_0020836_2590_3330 | 242 |
| 457 | 3300048922 | Ga0496119_0013609 | Ga0496119_0013609_1768_2508 | 242 |
| 458 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_563620_564360 | 242 |
| 459 | 3300048924 | Ga0496121_0000802 | Ga0496121_0000802_4905_5780 | 242 |
| 460 | 3300048925 | Ga0496122_0001009 | Ga0496122_0001009_1353_2093 | 242 |
| 461 | 3300048926 | Ga0496123_0000529 | Ga0496123_0000529_64366_65106 | 242 |
| 462 | 3300048926 | Ga0496123_0120554 | Ga0496123_0120554_626_1366 | 242 |
| 463 | 3300048927 | Ga0496124_0010701 | Ga0496124_0010701_2622_3362 | 242 |
| 464 | 3300048928 | Ga0496125_0004025 | Ga0496125_0004025_14301_15041 | 242 |
| 465 | 3300048929 | Ga0496126_0000898 | Ga0496126_0000898_45100_45840 | 242 |
| 466 | 3300049459 | Ga0495678_009288 | Ga0495678_009288_463_1203 | 242 |
| 467 | 3300049571 | Ga0501034_0003612 | Ga0501034_0003612_5266_6006 | 242 |
| 468 | 3300049571 | Ga0501034_0105274 | Ga0501034_0105274_487_1227 | 242 |
| 469 | 3300049573 | Ga0501037_0004262 | Ga0501037_0004262_2289_3029 | 242 |
| 470 | 3300049573 | Ga0501037_0125228 | Ga0501037_0125228_324_1064 | 242 |
| 471 | 3300049581 | Ga0501047_0022683 | Ga0501047_0022683_4132_4872 | 242 |
| 472 | 3300049593 | Ga0501077_0078320 | Ga0501077_0078320_855_1598 | 242 |
| 473 | 3300049671 | Ga0501238_003244 | Ga0501238_003244_147_887 | 242 |
| 474 | 3300049823 | Ga0501044_0276978 | Ga0501044_0276978_705_1445 | 242 |
| 475 | 3300049823 | Ga0501044_0287161 | Ga0501044_0287161_585_1325 | 242 |
| 476 | 3300050489 | nmdc:mga03683_196481_c1 | nmdc:mga03683_196481_c1_44_784 | 242 |
| 477 | 3300050490 | nmdc:mga03n38_262152_c1 | nmdc:mga03n38_262152_c1_159_899 | 242 |
| 478 | 3300050491 | nmdc:mga00v17_23834_c1 | nmdc:mga00v17_23834_c1_2116_2859 | 242 |
| 479 | 3300050493 | nmdc:mga0k408_11232_c1 | nmdc:mga0k408_11232_c1_1172_1912 | 242 |
| 480 | 3300050494 | nmdc:mga06z11_11792_c1 | nmdc:mga06z11_11792_c1_84_827 | 242 |
| 481 | 3300050494 | nmdc:mga06z11_19246_c1 | nmdc:mga06z11_19246_c1_270_1013 | 242 |
| 482 | 3300050494 | nmdc:mga06z11_307_c1 | nmdc:mga06z11_307_c1_1739_2482 | 242 |
| 483 | 3300050495 | nmdc:mga04h51_425_c1 | nmdc:mga04h51_425_c1_7597_8340 | 242 |
| 484 | 3300050496 | nmdc:mga07m45_169047_c1 | nmdc:mga07m45_169047_c1_297_1037 | 242 |
| 485 | 3300050507 | nmdc:mga05p37_48785_c1 | nmdc:mga05p37_48785_c1_2698_3441 | 242 |
| 486 | 3300050508 | nmdc:mga09592_298761_c1 | nmdc:mga09592_298761_c1_90_833 | 242 |
| 487 | 3300050510 | nmdc:mga06r32_474880_c1 | nmdc:mga06r32_474880_c1_51_794 | 242 |
| 488 | 3300053084 | Ga0495595_0090252 | Ga0495595_0090252_44_787 | 242 |
| 489 | 3300053086 | Ga0500578_0000665 | Ga0500578_0000665_3882_4622 | 242 |
| 490 | 3300053087 | Ga0500643_008397 | Ga0500643_008397_1415_2155 | 242 |
| 491 | 3300053087 | Ga0500643_021059 | Ga0500643_021059_699_1439 | 242 |
| 492 | 3300053088 | Ga0500644_0000004 | Ga0500644_0000004_172671_173411 | 242 |
| 493 | 3300053088 | Ga0500644_0000692 | Ga0500644_0000692_9746_10486 | 242 |
| 494 | 3300053088 | Ga0500644_0050571 | Ga0500644_0050571_302_1042 | 242 |
| 495 | 3300053091 | Ga0500647_0024726 | Ga0500647_0024726_1307_2047 | 242 |
| 496 | 3300053096 | Ga0500641_0022665 | Ga0500641_0022665_613_1353 | 242 |
| 497 | 3300053104 | Ga0500556_0017078 | Ga0500556_0017078_333_1073 | 242 |
| 498 | 3300053104 | Ga0500556_0039757 | Ga0500556_0039757_269_1009 | 242 |
| 499 | 3300053108 | Ga0500562_000610 | Ga0500562_000610_7742_8482 | 242 |
| 500 | 3300053108 | Ga0500562_003889 | Ga0500562_003889_72_812 | 242 |
| 501 | 3300053111 | Ga0500572_000606 | Ga0500572_000606_9922_10662 | 242 |
| 502 | 3300053118 | Ga0500594_0000160 | Ga0500594_0000160_10451_11191 | 242 |
| 503 | 3300053119 | Ga0500595_015303 | Ga0500595_015303_1704_2456 | 242 |
| 504 | 3300053122 | Ga0500608_000026 | Ga0500608_000026_19308_20048 | 242 |
| 505 | 3300053125 | Ga0500618_000043 | Ga0500618_000043_63665_64405 | 242 |
| 506 | 3300053130 | Ga0500642_0186117 | Ga0500642_0186117_114_854 | 242 |
| 507 | 3300053134 | Ga0500658_0012169 | Ga0500658_0012169_996_1736 | 242 |
| 508 | 3300053136 | Ga0500559_0000008 | Ga0500559_0000008_281_1021 | 242 |
| 509 | 3300053136 | Ga0500559_0000227 | Ga0500559_0000227_5570_6310 | 242 |
| 510 | 3300053136 | Ga0500559_0005346 | Ga0500559_0005346_359_1099 | 242 |
| 511 | 3300053138 | Ga0500564_000017 | Ga0500564_000017_17296_18036 | 242 |
| 512 | 3300053142 | Ga0500577_0014091 | Ga0500577_0014091_239_979 | 242 |
| 513 | 3300053153 | Ga0500616_0039570 | Ga0500616_0039570_124_864 | 242 |
| 514 | 3300053154 | Ga0500619_002977 | Ga0500619_002977_2318_3058 | 242 |
| 515 | 3300053156 | Ga0500622_0000047 | Ga0500622_0000047_41501_42241 | 242 |
| 516 | 3300053156 | Ga0500622_0003947 | Ga0500622_0003947_93_833 | 242 |
| 517 | 3300053156 | Ga0500622_0019739 | Ga0500622_0019739_2641_3381 | 242 |
| 518 | 3300053177 | Ga0500636_0044897 | Ga0500636_0044897_573_1313 | 242 |
| 519 | 3300053730 | Ga0500645_009720 | Ga0500645_009720_551_1291 | 242 |
| 520 | 3300060353 | Ga0501082_0420817 | Ga0501082_0420817_279_1016 | 242 |
| 521 | iso_pu_bacteria | 2738543010 | 2739231289 | 242 |
| 522 | iso_pu_bacteria | 2929206907 | 2929210394 | 242 |
| 523 | iso_pu_bacteria | 2956897341 | 2956901343 | 242 |
| 524 | iso_pu_bacteria | 2671180330 | 2672335070 | 243 |
| 525 | iso_pu_bacteria | 2738541295 | 2738812885 | 243 |
| 526 | iso_pu_bacteria | 2816332186 | 2816863947 | 243 |
| 527 | iso_pu_bacteria | 2842682962 | 2842685157 | 243 |
| 528 | iso_pu_bacteria | 2849139964 | 2849140861 | 243 |
| 529 | iso_pu_bacteria | 2857581216 | 2857584295 | 243 |
| 530 | iso_pu_bacteria | 2919414237 | 2919414608 | 243 |
| 531 | iso_pu_bacteria | 2936361878 | 2936365240 | 243 |
| 532 | iso_pu_bacteria | 2977254563 | 2977258342 | 243 |
| 533 | iso_pu_bacteria | 2990275345 | 2990279373 | 243 |
| 534 | iso_pu_bacteria | 3001892409 | 3001893522 | 243 |
| 535 | iso_pu_bacteria | 3006826541 | 3006831067 | 243 |
| 536 | iso_pu_bacteria | 3006969106 | 3006970673 | 243 |
| 537 | iso_pu_bacteria | 3006973921 | 3006974797 | 243 |
| 538 | iso_pu_bacteria | 8057632132 | 8057634158 | 243 |
| 539 | 3300013102 | Ga0157371_10107495 | Ga0157371_101074952 | 244 |
| 540 | iso_pu_bacteria | 2852673933 | 2852674968 | 244 |
| 541 | iso_pu_bacteria | 2928510474 | 2928511682 | 244 |
| 542 | 3300009098 | Ga0105245_10131745 | Ga0105245_101317452 | 245 |
| 543 | 3300025927 | Ga0207687_10079794 | Ga0207687_100797943 | 245 |
| 544 | 3300027876 | Ga0209974_10034907 | Ga0209974_100349073 | 246 |
| 545 | 3300003578 | Ga0006562J51391_1006021 | Ga0006562J51391_10060213 | 247 |
| 546 | 3300025294 | Ga0209025_1028141 | Ga0209025_10281412 | 247 |
| 547 | 3300031548 | Ga0307408_100282071 | Ga0307408_1002820712 | 247 |
| 548 | 3300031995 | Ga0307409_100105165 | Ga0307409_1001051654 | 247 |
| 549 | 3300048909 | Ga0496106_0449602 | Ga0496106_0449602_54_797 | 247 |
| 550 | 3300048911 | Ga0496108_0353042 | Ga0496108_0353042_290_1033 | 247 |
| 551 | 3300048913 | Ga0496110_0001538 | Ga0496110_0001538_13345_14088 | 247 |
| 552 | 3300048913 | Ga0496110_0063478 | Ga0496110_0063478_1608_2351 | 247 |
| 553 | 3300048914 | Ga0496111_0010025 | Ga0496111_0010025_2427_3170 | 247 |
| 554 | 3300049127 | Ga0501306_010800 | Ga0501306_010800_362_1105 | 247 |
| 555 | 3300049132 | Ga0501343_000260 | Ga0501343_000260_439_1182 | 247 |
| 556 | 3300049134 | Ga0501345_01131 | Ga0501345_01131_26_769 | 247 |
| 557 | 3300049161 | Ga0501305_005425 | Ga0501305_005425_490_1233 | 247 |
| 558 | 3300049528 | Ga0501312_007154 | Ga0501312_007154_187_930 | 247 |
| 559 | 3300049531 | Ga0501315_006190 | Ga0501315_006190_456_1199 | 247 |
| 560 | 3300049532 | Ga0501316_003134 | Ga0501316_003134_485_1228 | 247 |
| 561 | 3300049533 | Ga0501317_005610 | Ga0501317_005610_179_922 | 247 |
| 562 | 3300049537 | Ga0501321_005095 | Ga0501321_005095_123_866 | 247 |
| 563 | 3300049539 | Ga0501323_002103 | Ga0501323_002103_123_866 | 247 |
| 564 | 3300049539 | Ga0501323_003065 | Ga0501323_003065_371_1114 | 247 |
| 565 | 3300049548 | Ga0501332_04546 | Ga0501332_04546_64_807 | 247 |
| 566 | 3300049550 | Ga0501334_05980 | Ga0501334_05980_22_765 | 247 |
| 567 | 3300049551 | Ga0501335_002159 | Ga0501335_002159_490_1233 | 247 |
| 568 | 3300049552 | Ga0501336_001783 | Ga0501336_001783_69_812 | 247 |
| 569 | 3300049553 | Ga0501337_001125 | Ga0501337_001125_485_1228 | 247 |
| 570 | 3300049556 | Ga0501340_001753 | Ga0501340_001753_112_855 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sj7-assembly1.cif.gz_B-2 | structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph | 0.9955 | 6 | 247 |
| 4jro-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9943 | 1 | 247 |
| 4jro-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9935 | 1 | 247 |
| 4jro-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.991 | 1 | 247 |
| 3osu-assembly1.cif.gz_A | crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus | 0.991 | 4 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9941 | 6 | 247 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9939 | 82 | 247 | 3.40.50.720 |
| af_A0A1D6J5I0_53_326_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9886 | 3 | 247 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9827 | 3 | 247 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.982 | 6 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850V1U6-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 1 | 166 | 247 |
|
| AF-A0A2S5MFR3-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9986 | 85 | 247 |
GO:0016491
|
| AF-A0A3M1YKC1-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9924 | 1 | 247 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A3S8V3A3-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9912 | 99 | 246 |
GO:0016491
|
| AF-A0A371GW42-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9898 | 3 | 247 |
GO:0004316
GO:0006633 GO:0009507 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar