F464876

General Info

Members Datasets Scaffolds Average Seq Length
570 348 519 244

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0000041|Ga0496107_0000041_65324_66199
Length 291
Sequence MPCRVLVLRQAQDEDDCAGGSFETLILSLSKDEGFTHYPPNGELKMFDLTGKTALVTGATGGIGGAIAKALHEQGAHVVLSGTRESALSELAAQFGERVSFVAANLSDAAAVDGLVAKAEEAAGAPLDIVIANAGITRDGLIVRMKDEDWDTVIKVNLEGYFRLSRAAAKGMMKRRSGRIIGITSIVGVTGNPGQTNYAASKAGMIGFSKALAQELASRNVTVNCVAPGFIASPMTDALNEQQKAGILSTIPAGRLGEGSDIAAACVYLASDQGGYVTGQTLHVNGGMAMI

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
17 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
18 2738541295 Bacillus sp. OK085 Isolate Unclassified
19 2738543010 Bacillus sp. YR335 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2842682962 Bacillus sp. R-72492 Isolate Unclassified
25 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
26 2849139964 Bacillus sp. R-71875 Isolate Unclassified
27 2849560528 Caulobacter zeae 410 Isolate Unclassified
28 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
29 2851153111 Caulobacter radicis 736 Isolate Unclassified
30 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
31 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
32 2857581216 Bacillus sp. R-71922 Isolate Unclassified
33 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
34 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
35 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
36 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
37 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
38 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
39 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
40 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
41 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
42 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
43 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
44 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
45 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
46 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
47 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
48 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
49 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
50 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
286 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
305 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
306 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
328 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
329 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
330 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
339 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
345 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
346 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.79
Metatranscriptomes 5.26
Isolates 8.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.84
Nodule 0.18
Rhizoplane 5.09
Rhizosphere 67.37
Stem 0
Stem Tuber 0
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1006021 3300003578 Bacteria 3710
2 Ga0055526_1036160 3300003771 Bacteria 1316
3 Ga0055537_1002952 3300003773 Bacteria 5398
4 Ga0055524_1033508 3300003775 Bacteria 1436
5 Ga0055536_1000478 3300003781 Bacteria 27802
6 Ga0055536_1005309 3300003781 Bacteria 6337
7 Ga0055536_1006045 3300003781 Bacteria 5740
8 Ga0055528_1008440 3300003790 Bacteria 4415
9 Ga0055528_1021094 3300003790 Bacteria 2082
10 Ga0055530_10014825 3300003791 Bacteria 2575
11 Ga0055530_10017903 3300003791 Bacteria 2203
12 Ga0055531_10001093 3300003794 Bacteria 21245
13 Ga0055531_10003069 3300003794 Bacteria 10803
14 Ga0055531_10003487 3300003794 Bacteria 10004
15 Ga0065165_1001045 3300005262 Bacteria 33371
16 Ga0065715_10185097 3300005293 Bacteria 1444
17 Ga0070658_10000001 3300005327 Bacteria 856789
18 Ga0070658_10004249 3300005327 Bacteria 11711
19 Ga0070670_100216330 3300005331 Bacteria 1667
20 Ga0070680_100000264 3300005336 Bacteria 34683
21 Ga0070660_100001280 3300005339 Bacteria 17152
22 Ga0070660_100639238 3300005339 Bacteria 891
23 Ga0070689_100691165 3300005340 Bacteria 890
24 Ga0070668_100003297 3300005347 Bacteria 11910
25 Ga0070668_100021693 3300005347 Bacteria 4852
26 Ga0070668_100093507 3300005347 Bacteria 2373
27 Ga0070668_100371606 3300005347 Bacteria 1215
28 Ga0070668_100426046 3300005347 Bacteria 1137
29 Ga0070669_100018715 3300005353 Bacteria 4950
30 Ga0070671_100000479 3300005355 Bacteria 27800
31 Ga0070671_100019977 3300005355 Bacteria 5457
32 Ga0070688_100018458 3300005365 Bacteria 4025
33 Ga0070659_100015232 3300005366 Bacteria 5755
34 Ga0070667_100002158 3300005367 Bacteria 17328
35 Ga0070667_100021993 3300005367 Bacteria 5292
36 Ga0070667_100076986 3300005367 Bacteria 2848
37 Ga0070713_100085475 3300005436 Bacteria 2702
38 Ga0070710_10115372 3300005437 Bacteria 1619
39 Ga0070711_100369595 3300005439 Bacteria 1157
40 Ga0070663_100468703 3300005455 Bacteria 1041
41 Ga0070678_100237023 3300005456 Bacteria 1523
42 Ga0070662_100489754 3300005457 Bacteria 1024
43 Ga0070681_10000213 3300005458 Bacteria 45271
44 Ga0070679_100242218 3300005530 Bacteria 1761
45 Ga0068853_100178507 3300005539 Bacteria 1925
46 Ga0070693_100291452 3300005547 Bacteria 1097
47 Ga0070665_100000940 3300005548 Bacteria 37209
48 Ga0070665_100001410 3300005548 Bacteria 28253
49 Ga0070665_100010051 3300005548 Bacteria 9574
50 Ga0068855_100001693 3300005563 Bacteria 27587
51 Ga0068855_100214207 3300005563 Bacteria 2163
52 Ga0070664_100449815 3300005564 Bacteria 1182
53 Ga0068856_100056115 3300005614 Bacteria 3886
54 Ga0068856_100201468 3300005614 Bacteria 2005
55 Ga0068856_100990431 3300005614 Bacteria 859
56 Ga0068859_100000999 3300005617 Bacteria 28968
57 Ga0068859_100469516 3300005617 Bacteria 1354
58 Ga0068864_100003837 3300005618 Bacteria 12390
59 Ga0068864_100016985 3300005618 Bacteria 6064
60 Ga0068864_100168894 3300005618 Bacteria 1993
61 Ga0068864_100620802 3300005618 Bacteria 1050
62 Ga0068864_100797002 3300005618 Bacteria 928
63 Ga0068861_100318426 3300005719 Bacteria 1354
64 Ga0068863_100006162 3300005841 Bacteria 11760
65 Ga0068863_100007149 3300005841 Bacteria 10951
66 Ga0068858_100014500 3300005842 Bacteria 7426
67 Ga0068858_100054499 3300005842 Bacteria 3697
68 Ga0068858_100064743 3300005842 Bacteria 3384
69 Ga0068860_100001370 3300005843 Bacteria 26465
70 Ga0068860_100012979 3300005843 Bacteria 8183
71 Ga0068860_100111046 3300005843 Bacteria 2621
72 Ga0068862_100004692 3300005844 Bacteria 11510
73 Ga0068862_100146975 3300005844 Bacteria 2095
74 Ga0068862_100420817 3300005844 Bacteria 1254
75 Ga0081455_10094409 3300005937 Bacteria 2416
76 Ga0081455_10184193 3300005937 Bacteria 1578
77 Ga0075365_10002352 3300006038 Bacteria 9218
78 Ga0075368_10000471 3300006042 Bacteria 11930
79 Ga0075363_100008842 3300006048 Bacteria 4712
80 Ga0075363_100072890 3300006048 Bacteria 1868
81 Ga0070712_100099696 3300006175 Bacteria 2144
82 Ga0075362_10035447 3300006177 Bacteria 2178
83 Ga0075367_10020160 3300006178 Bacteria 3709
84 Ga0075369_10010780 3300006186 Bacteria 3581
85 Ga0075366_10037719 3300006195 Bacteria 2854
86 Ga0075370_10075248 3300006353 Bacteria 1936
87 Ga0075428_100032742 3300006844 Bacteria 5741
88 Ga0075431_100021443 3300006847 Bacteria 6607
89 Ga0097620_100000999 3300006931 Bacteria 28968
90 Ga0097620_100469435 3300006931 Bacteria 1354
91 Ga0099795_10000521 3300007788 Bacteria 7219
92 Ga0105244_10066915 3300009036 Bacteria 1798
93 Ga0105240_10003426 3300009093 Bacteria 24643
94 Ga0105240_10099371 3300009093 Bacteria 3542
95 Ga0105240_10399768 3300009093 Bacteria 1548
96 Ga0105245_10039365 3300009098 Bacteria 4207
97 Ga0105245_10131745 3300009098 Bacteria 2346
98 Ga0114129_10063020 3300009147 Bacteria 5179
99 Ga0105242_10120391 3300009176 Bacteria 2251
100 Ga0105248_10000001 3300009177 Bacteria 1881304
101 Ga0105248_10000685 3300009177 Bacteria 38290
102 Ga0105248_10012881 3300009177 Bacteria 9223
103 Ga0105248_10044544 3300009177 Bacteria 4976
104 Ga0105248_10070680 3300009177 Bacteria 3920
105 Ga0105248_10201991 3300009177 Bacteria 2239
106 Ga0105248_10604118 3300009177 Bacteria 1238
107 Ga0105238_10020646 3300009551 Bacteria 6709
108 Ga0105238_10331880 3300009551 Bacteria 1508
109 Ga0105249_10000818 3300009553 Bacteria 28052
110 Ga0105249_10384626 3300009553 Bacteria 1430
111 Ga0099796_10000086 3300010159 Bacteria 15528
112 Ga0099796_10107096 3300010159 Bacteria 1060
113 Ga0157371_10107495 3300013102 Bacteria 1980
114 Ga0157369_10023976 3300013105 Bacteria 6789
115 Ga0163162_10018748 3300013306 Bacteria 6782
116 Ga0163162_10202233 3300013306 Bacteria 2115
117 Ga0163162_10436117 3300013306 Bacteria 1442
118 Ga0163163_10014204 3300014325 Bacteria 7315
119 Ga0163163_10070984 3300014325 Bacteria 3469
120 Ga0163163_10562593 3300014325 Bacteria 1203
121 Ga0157380_10035915 3300014326 Bacteria 3831
122 Ga0157380_10129517 3300014326 Bacteria 2150
123 Ga0157380_10275785 3300014326 Bacteria 1536
124 Ga0157379_10064313 3300014968 Bacteria 3278
125 Ga0157379_10305330 3300014968 Bacteria 1451
126 Ga0213874_10027254 3300021377 Bacteria 1624
127 Ga0224572_1003965 3300024225 Bacteria 2539
128 Ga0224572_1021452 3300024225 Bacteria 1239
129 Ga0228598_1046721 3300024227 Bacteria 857
130 Ga0209233_1024480 3300025261 Bacteria 1509
131 Ga0209565_1000127 3300025263 Bacteria 109900
132 Ga0209675_1010000 3300025291 Bacteria 3285
133 Ga0209676_1000046 3300025292 Bacteria 409173
134 Ga0209676_1000336 3300025292 Bacteria 89848
135 Ga0209676_1000476 3300025292 Bacteria 66212
136 Ga0209676_1001278 3300025292 Bacteria 26066
137 Ga0209025_1028141 3300025294 Bacteria 2764
138 Ga0209564_1005120 3300025295 Bacteria 7627
139 Ga0209564_1023284 3300025295 Bacteria 2158
140 Ga0209758_1000450 3300025297 Bacteria 68773
141 Ga0209758_1008106 3300025297 Bacteria 6916
142 Ga0209050_1000506 3300025298 Bacteria 66220
143 Ga0209050_1007979 3300025298 Bacteria 5780
144 Ga0209050_1018460 3300025298 Bacteria 2709
145 Ga0209050_1019830 3300025298 Bacteria 2534
146 Ga0209256_1016565 3300025299 Bacteria 2503
147 Ga0209256_1019956 3300025299 Bacteria 2112
148 Ga0209051_1057178 3300025303 Bacteria 1251
149 Ga0209257_1000159 3300025304 Bacteria 178767
150 Ga0209257_1000481 3300025304 Bacteria 72432
151 Ga0209257_1008528 3300025304 Bacteria 5792
152 Ga0209257_1028172 3300025304 Bacteria 1854
153 Ga0207680_10035160 3300025903 Bacteria 2874
154 Ga0207705_10000002 3300025909 Bacteria 2046852
155 Ga0207705_10024662 3300025909 Bacteria 4292
156 Ga0207705_10253309 3300025909 Bacteria 1343
157 Ga0207695_10003143 3300025913 Bacteria 23591
158 Ga0207695_10070156 3300025913 Bacteria 3584
159 Ga0207695_10453733 3300025913 Bacteria 1165
160 Ga0207671_10168372 3300025914 Bacteria 1700
161 Ga0207693_10063121 3300025915 Bacteria 2902
162 Ga0207663_10054697 3300025916 Bacteria 2501
163 Ga0207660_10003027 3300025917 Bacteria 11000
164 Ga0207657_10003354 3300025919 Bacteria 17131
165 Ga0207657_10528620 3300025919 Bacteria 923
166 Ga0207652_10006822 3300025921 Bacteria 9200
167 Ga0207652_10115724 3300025921 Bacteria 2382
168 Ga0207681_10009686 3300025923 Bacteria 5896
169 Ga0207694_10032403 3300025924 Bacteria 4000
170 Ga0207694_10410747 3300025924 Bacteria 1127
171 Ga0207650_10000201 3300025925 Bacteria 69058
172 Ga0207650_10122435 3300025925 Bacteria 2027
173 Ga0207687_10079794 3300025927 Bacteria 2360
174 Ga0207700_10063843 3300025928 Bacteria 2802
175 Ga0207644_10004836 3300025931 Bacteria 8766
176 Ga0207644_10089321 3300025931 Bacteria 2293
177 Ga0207644_10105354 3300025931 Bacteria 2124
178 Ga0207690_10003860 3300025932 Bacteria 8859
179 Ga0207706_10062708 3300025933 Bacteria 3273
180 Ga0207706_10494750 3300025933 Bacteria 1056
181 Ga0207711_10000002 3300025941 Bacteria 1228676
182 Ga0207711_10001954 3300025941 Bacteria 18716
183 Ga0207711_10006432 3300025941 Bacteria 9891
184 Ga0207711_10013682 3300025941 Bacteria 6737
185 Ga0207711_10025045 3300025941 Bacteria 5006
186 Ga0207711_10203374 3300025941 Bacteria 1808
187 Ga0207711_10325958 3300025941 Bacteria 1420
188 Ga0207679_10008351 3300025945 Bacteria 6591
189 Ga0207679_10070393 3300025945 Bacteria 2636
190 Ga0207667_10029154 3300025949 Bacteria 5986
191 Ga0207667_10357388 3300025949 Unclassified 1489
192 Ga0207651_10043707 3300025960 Bacteria 2993
193 Ga0207651_10229855 3300025960 Bacteria 1505
194 Ga0207712_10118548 3300025961 Bacteria 1998
195 Ga0207712_10386918 3300025961 Bacteria 1172
196 Ga0207668_10000007 3300025972 Bacteria 190613
197 Ga0207668_10000247 3300025972 Bacteria 36155
198 Ga0207668_10025099 3300025972 Bacteria 3853
199 Ga0207668_10356001 3300025972 Bacteria 1225
200 Ga0207658_10000052 3300025986 Bacteria 128748
201 Ga0207658_10000985 3300025986 Bacteria 23486
202 Ga0207658_10001933 3300025986 Bacteria 15458
203 Ga0207658_10013527 3300025986 Bacteria 5578
204 Ga0207658_10036009 3300025986 Bacteria 3548
205 Ga0207658_10640297 3300025986 Bacteria 958
206 Ga0207703_10002468 3300026035 Bacteria 16038
207 Ga0207703_10049425 3300026035 Bacteria 3400
208 Ga0207678_10324071 3300026067 Bacteria 1326
209 Ga0207702_10023453 3300026078 Bacteria 5118
210 Ga0207702_10098159 3300026078 Bacteria 2580
211 Ga0207641_10087617 3300026088 Bacteria 2716
212 Ga0207641_10267706 3300026088 Bacteria 1602
213 Ga0207676_10001242 3300026095 Bacteria 18975
214 Ga0207676_10012779 3300026095 Bacteria 6024
215 Ga0207676_10094198 3300026095 Bacteria 2467
216 Ga0207676_10186538 3300026095 Bacteria 1821
217 Ga0207676_10334476 3300026095 Bacteria 1395
218 Ga0207675_100139166 3300026118 Bacteria 2305
219 Ga0207675_100154745 3300026118 Bacteria 2184
220 Ga0207675_100923487 3300026118 Bacteria 889
221 Ga0207683_10099258 3300026121 Bacteria 2598
222 Ga0207698_10023739 3300026142 Bacteria 4290
223 Ga0209813_10000616 3300027866 Bacteria 8299
224 Ga0209974_10034907 3300027876 Bacteria 1670
225 Ga0209974_10039696 3300027876 Bacteria 1566
226 Ga0268266_10001205 3300028379 Bacteria 31898
227 Ga0268266_10010417 3300028379 Bacteria 8124
228 Ga0268266_10011789 3300028379 Bacteria 7579
229 Ga0268266_10581886 3300028379 Bacteria 1074
230 Ga0268265_10002350 3300028380 Bacteria 14338
231 Ga0268265_10091103 3300028380 Bacteria 2437
232 Ga0268265_10134907 3300028380 Bacteria 2057
233 Ga0268264_10000684 3300028381 Bacteria 39491
234 Ga0268264_10018738 3300028381 Bacteria 5659
235 Ga0268264_10210953 3300028381 Bacteria 1783
236 Ga0268264_10236140 3300028381 Bacteria 1691
237 Ga0268264_10638747 3300028381 Bacteria 1052
238 Ga0307517_10001029 3300028786 Bacteria 47353
239 Ga0307517_10115170 3300028786 Bacteria 2019
240 Ga0307515_10066696 3300028794 Bacteria 4980
241 Ga0307515_10067676 3300028794 Bacteria 4921
242 Ga0307515_10315002 3300028794 Bacteria 1236
243 Ga0265773_1000596 3300031018 Bacteria 1559
244 Ga0265327_10000220 3300031251 Bacteria 115886
245 Ga0265327_10152209 3300031251 Bacteria 1073
246 Ga0307513_10000082 3300031456 Bacteria 131779
247 Ga0307513_10001006 3300031456 Bacteria 40812
248 Ga0307513_10002226 3300031456 Bacteria 27088
249 Ga0307408_100282071 3300031548 Bacteria 1384
250 Ga0265313_10008177 3300031595 Bacteria 6992
251 Ga0307405_10030398 3300031731 Bacteria 3167
252 Ga0307413_10021312 3300031824 Bacteria 3467
253 Ga0307413_10060092 3300031824 Bacteria 2338
254 Ga0307413_10405389 3300031824 Bacteria 1069
255 Ga0307410_10070753 3300031852 Bacteria 2417
256 Ga0307410_10213633 3300031852 Bacteria 1479
257 Ga0307406_10006321 3300031901 Bacteria 6534
258 Ga0307407_10097113 3300031903 Bacteria 1820
259 Ga0307407_10248898 3300031903 Bacteria 1216
260 Ga0307412_10079699 3300031911 Bacteria 2260
261 Ga0307409_100071151 3300031995 Bacteria 2764
262 Ga0307409_100103587 3300031995 Bacteria 2367
263 Ga0307409_100105165 3300031995 Bacteria 2353
264 Ga0307409_100155825 3300031995 Bacteria 1990
265 Ga0307416_100208507 3300032002 Bacteria 1862
266 Ga0307416_100355940 3300032002 Bacteria 1484
267 Ga0307416_100689512 3300032002 Bacteria 1110
268 Ga0307414_10047374 3300032004 Bacteria 2957
269 Ga0307414_10061855 3300032004 Bacteria 2653
270 Ga0307414_10162131 3300032004 Bacteria 1777
271 Ga0307414_10205516 3300032004 Bacteria 1605
272 Ga0307411_10046571 3300032005 Bacteria 2797
273 Ga0307411_10160596 3300032005 Bacteria 1682
274 Ga0307415_100078895 3300032126 Bacteria 2343
275 Ga0373924_0031367 3300035410 Bacteria 2137
276 Ga0373931_0022704 3300035691 Bacteria 3160
277 Ga0373933_0090001 3300035724 Bacteria 1892
278 Ga0373947_0195926 3300035725 Bacteria 1320
279 Ga0373937_0147549 3300036401 Bacteria 2202
280 Ga0373925_0053200 3300037068 Bacteria 3026
281 Ga0395899_0006527 3300037312 Bacteria 9039
282 Ga0395899_0042865 3300037312 Bacteria 3376
283 Ga0395900_0002429 3300037418 Bacteria 20525
284 Ga0395900_0459504 3300037418 Bacteria 1228
285 Ga0395900_0568185 3300037418 Bacteria 1077
286 Ga0395898_0008060 3300037466 Bacteria 11165
287 Ga0395898_0227526 3300037466 Unclassified 1779
288 Ga0395905_0007649 3300037471 Bacteria 10724
289 Ga0395905_0016314 3300037471 Bacteria 7058
290 Ga0395905_0214420 3300037471 Bacteria 1803
291 Ga0395905_0317642 3300037471 Bacteria 1447
292 Ga0395905_0514689 3300037471 Bacteria 1097
293 Ga0395901_0000007 3300038443 Bacteria 497408
294 Ga0395901_0013125 3300038443 Bacteria 8409
295 Ga0395901_0084333 3300038443 Bacteria 3321
296 Ga0395901_0086637 3300038443 Bacteria 3275
297 Ga0400483_231819 3300039062 Bacteria 3760
298 Ga0436365_1145221 3300039437 Bacteria 3665
299 Ga0436365_1645730 3300039437 Bacteria 1319
300 Ga0436363_1269293 3300039450 Bacteria 1993
301 Ga0436363_1621007 3300039450 Bacteria 1629
302 Ga0436362_0176928 3300039453 Bacteria 3764
303 Ga0436362_1255974 3300039453 Bacteria 1125
304 Ga0439453_0015104 3300041408 Bacteria 1332
305 Ga0439435_0014277 3300042436 Bacteria 1961
306 Ga0451577_0480131 3300042876 Bacteria 1128
307 Ga0466969_0000677 3300044656 Bacteria 18515
308 Ga0466966_0055079 3300044684 Bacteria 2518
309 Ga0466961_0006897 3300044693 Bacteria 7226
310 Ga0453684_0027798 3300044712 Bacteria 8096
311 Ga0466971_0002075 3300044719 Bacteria 8493
312 Ga0466957_0006824 3300044842 Bacteria 6450
313 Ga0466957_0381957 3300044842 Bacteria 961
314 Ga0466959_0001525 3300045049 Bacteria 14225
315 Ga0466958_0077815 3300045836 Bacteria 2037
316 Ga0495627_000269 3300046453 Bacteria 52989
317 Ga0495590_0000439 3300046457 Bacteria 20685
318 Ga0495629_0216516 3300046459 Bacteria 1322
319 Ga0495638_0000347 3300046460 Bacteria 58280
320 Ga0495638_0000492 3300046460 Bacteria 47203
321 Ga0495651_0216004 3300046462 Bacteria 1331
322 Ga0495650_0000007 3300046471 Bacteria 718072
323 Ga0495585_0018627 3300046492 Bacteria 4004
324 Ga0495585_0167170 3300046492 Bacteria 1138
325 Ga0495607_0090228 3300046501 Bacteria 1662
326 Ga0495583_0000037 3300046506 Bacteria 244437
327 Ga0495583_0024449 3300046506 Bacteria 3035
328 Ga0495606_0005657 3300046507 Bacteria 11846
329 Ga0495610_0001339 3300046512 Bacteria 21852
330 Ga0495610_0002423 3300046512 Bacteria 15702
331 Ga0495610_0010802 3300046512 Bacteria 5642
332 Ga0495616_0000112 3300046513 Bacteria 71263
333 Ga0495631_0003776 3300046518 Bacteria 8240
334 Ga0495632_0023018 3300046519 Bacteria 3332
335 Ga0495637_0008992 3300046520 Bacteria 4884
336 Ga0495637_0021760 3300046520 Bacteria 2934
337 Ga0495648_0000105 3300046524 Bacteria 105677
338 Ga0495663_0000375 3300046525 Bacteria 16564
339 Ga0495642_0013236 3300046528 Bacteria 3188
340 Ga0495654_0000054 3300046530 Bacteria 144303
341 Ga0495654_0022462 3300046530 Bacteria 3276
342 Ga0495621_0146330 3300046539 Bacteria 927
343 Ga0495597_0043187 3300046542 Bacteria 2008
344 Ga0495597_0146615 3300046542 Bacteria 970
345 Ga0495633_0004403 3300046558 Bacteria 8971
346 Ga0495668_0000252 3300046616 Bacteria 76175
347 Ga0495668_0037195 3300046616 Bacteria 2724
348 Ga0495668_0063745 3300046616 Bacteria 2029
349 Ga0495668_0157644 3300046616 Bacteria 1243
350 Ga0495668_0185403 3300046616 Bacteria 1140
351 Ga0495611_0145282 3300046648 Bacteria 1107
352 Ga0495625_0000415 3300046660 Bacteria 64352
353 Ga0495625_0030568 3300046660 Bacteria 4016
354 Ga0495625_0070115 3300046660 Bacteria 2461
355 Ga0495625_0120956 3300046660 Bacteria 1781
356 Ga0495635_0091482 3300046663 Bacteria 2081
357 Ga0495661_0111076 3300046665 Bacteria 1528
358 Ga0495669_0050164 3300046684 Bacteria 1871
359 Ga0495613_0000964 3300046689 Bacteria 22013
360 Ga0495670_0075951 3300046691 Bacteria 1706
361 Ga0495589_0152905 3300046794 Bacteria 1101
362 Ga0495660_0046650 3300046810 Bacteria 2375
363 Ga0495660_0049606 3300046810 Bacteria 2290
364 Ga0495672_0007870 3300047320 Bacteria 7957
365 Ga0495672_0024032 3300047320 Bacteria 3933
366 Ga0495677_0047193 3300047445 Bacteria 1581
367 Ga0495679_026121 3300047446 Bacteria 1943
368 Ga0495673_0000402 3300047469 Bacteria 50662
369 Ga0495673_0001079 3300047469 Bacteria 23944
370 Ga0495681_0066352 3300047470 Bacteria 1647
371 Ga0495686_0000572 3300047472 Bacteria 52381
372 Ga0495686_0004508 3300047472 Bacteria 11427
373 Ga0495686_0029609 3300047472 Bacteria 3561
374 Ga0495602_0141478 3300048088 Bacteria 1904
375 Ga0496100_0168768 3300048903 Bacteria 1574
376 Ga0496102_0108686 3300048905 Bacteria 2583
377 Ga0496102_0146564 3300048905 Bacteria 2216
378 Ga0496103_0000643 3300048906 Bacteria 26435
379 Ga0496103_0234389 3300048906 Bacteria 1181
380 Ga0496103_0262147 3300048906 Bacteria 1112
381 Ga0496104_0000088 3300048907 Bacteria 88904
382 Ga0496105_0018470 3300048908 Bacteria 5605
383 Ga0496106_0221842 3300048909 Bacteria 1508
384 Ga0496106_0449602 3300048909 Bacteria 1035
385 Ga0496107_0000041 3300048910 Bacteria 75059
386 Ga0496108_0353042 3300048911 Bacteria 1283
387 Ga0496109_0020688 3300048912 Bacteria 5812
388 Ga0496110_0001538 3300048913 Bacteria 16773
389 Ga0496110_0001919 3300048913 Bacteria 15380
390 Ga0496110_0063478 3300048913 Bacteria 3264
391 Ga0496110_0679637 3300048913 Bacteria 930
392 Ga0496111_0010025 3300048914 Bacteria 6339
393 Ga0496111_0013661 3300048914 Bacteria 5532
394 Ga0496112_0031566 3300048915 Bacteria 5140
395 Ga0496113_0002054 3300048916 Bacteria 11566
396 Ga0496113_0074106 3300048916 Bacteria 2595
397 Ga0496113_0639734 3300048916 Bacteria 851
398 Ga0496114_0750784 3300048917 Bacteria 853
399 Ga0496115_0004136 3300048918 Bacteria 10475
400 Ga0496115_0005514 3300048918 Bacteria 9210
401 Ga0496115_0088679 3300048918 Bacteria 2526
402 Ga0496115_0154511 3300048918 Bacteria 1895
403 Ga0496115_0184285 3300048918 Bacteria 1725
404 Ga0496116_0003801 3300048919 Bacteria 14758
405 Ga0496116_0011628 3300048919 Bacteria 7263
406 Ga0496117_0005240 3300048920 Bacteria 13757
407 Ga0496117_0043782 3300048920 Bacteria 3250
408 Ga0496118_0013510 3300048921 Bacteria 7715
409 Ga0496118_0020836 3300048921 Bacteria 5800
410 Ga0496119_0013609 3300048922 Bacteria 6459
411 Ga0496121_0000009 3300048924 Bacteria 836971
412 Ga0496121_0000802 3300048924 Bacteria 57240
413 Ga0496122_0001009 3300048925 Bacteria 49846
414 Ga0496123_0000529 3300048926 Bacteria 65639
415 Ga0496123_0120554 3300048926 Bacteria 1477
416 Ga0496124_0010701 3300048927 Bacteria 9254
417 Ga0496125_0004025 3300048928 Bacteria 17251
418 Ga0496126_0000898 3300048929 Bacteria 51758
419 Ga0501306_010800 3300049127 Bacteria 1155
420 Ga0501343_000260 3300049132 Bacteria 2864
421 Ga0501343_002377 3300049132 Bacteria 1337
422 Ga0501345_01131 3300049134 Bacteria 994
423 Ga0501305_000807 3300049161 Bacteria 2772
424 Ga0501305_005425 3300049161 Bacteria 1544
425 Ga0495678_009288 3300049459 Bacteria 4879
426 Ga0501300_006030 3300049523 Bacteria 1787
427 Ga0501312_000649 3300049528 Bacteria 2955
428 Ga0501312_007154 3300049528 Bacteria 1414
429 Ga0501313_025817 3300049529 Bacteria 745
430 Ga0501315_000169 3300049531 Bacteria 3753
431 Ga0501315_006190 3300049531 Bacteria 1324
432 Ga0501315_012383 3300049531 Bacteria 1054
433 Ga0501316_000492 3300049532 Bacteria 2747
434 Ga0501316_003134 3300049532 Bacteria 1585
435 Ga0501316_003754 3300049532 Bacteria 1493
436 Ga0501317_001797 3300049533 Bacteria 1922
437 Ga0501317_005610 3300049533 Bacteria 1351
438 Ga0501321_005095 3300049537 Bacteria 1286
439 Ga0501323_002103 3300049539 Bacteria 1890
440 Ga0501323_003065 3300049539 Bacteria 1678
441 Ga0501332_04546 3300049548 Bacteria 829
442 Ga0501334_05980 3300049550 Bacteria 812
443 Ga0501335_000078 3300049551 Bacteria 4264
444 Ga0501335_002159 3300049551 Bacteria 1580
445 Ga0501336_000175 3300049552 Bacteria 2707
446 Ga0501336_001783 3300049552 Bacteria 1326
447 Ga0501337_001125 3300049553 Bacteria 1480
448 Ga0501340_001753 3300049556 Bacteria 1202
449 Ga0501034_0003612 3300049571 Bacteria 17554
450 Ga0501034_0105274 3300049571 Bacteria 2814
451 Ga0501037_0004262 3300049573 Bacteria 10367
452 Ga0501037_0125228 3300049573 Bacteria 1845
453 Ga0501043_0067793 3300049579 Bacteria 2802
454 Ga0501047_0022683 3300049581 Bacteria 6026
455 Ga0501077_0078320 3300049593 Bacteria 2095
456 Ga0501224_005887 3300049664 Bacteria 1769
457 Ga0501235_029139 3300049669 Bacteria 1242
458 Ga0501235_044340 3300049669 Bacteria 1021
459 Ga0501238_003244 3300049671 Bacteria 1992
460 Ga0501249_051635 3300049679 Bacteria 944
461 Ga0501035_0012956 3300049822 Bacteria 7696
462 Ga0501044_0276978 3300049823 Bacteria 1612
463 Ga0501044_0287161 3300049823 Bacteria 1577
464 Ga0501212_014440 3300049851 Bacteria 1169
465 nmdc:mga03683_196481_c1 3300050489 Bacteria 924
466 nmdc:mga03n38_262152_c1 3300050490 Bacteria 916
467 nmdc:mga00v17_23834_c1 3300050491 Bacteria 3544
468 nmdc:mga0k408_11232_c1 3300050493 Bacteria 4869
469 nmdc:mga06z11_11792_c1 3300050494 Bacteria 3780
470 nmdc:mga06z11_19246_c1 3300050494 Bacteria 3135
471 nmdc:mga06z11_307_c1 3300050494 Bacteria 18616
472 nmdc:mga04h51_425_c1 3300050495 Bacteria 8670
473 nmdc:mga07m45_169047_c1 3300050496 Bacteria 1270
474 nmdc:mga05p37_48785_c1 3300050507 Bacteria 5206
475 nmdc:mga09592_298761_c1 3300050508 Bacteria 1396
476 nmdc:mga06r32_474880_c1 3300050510 Bacteria 1229
477 Ga0495595_0090252 3300053084 Bacteria 1469
478 Ga0500578_0000665 3300053086 Bacteria 41170
479 Ga0500643_008397 3300053087 Bacteria 4061
480 Ga0500643_021059 3300053087 Bacteria 2119
481 Ga0500643_035455 3300053087 Bacteria 1495
482 Ga0500644_0000004 3300053088 Bacteria 173652
483 Ga0500644_0000692 3300053088 Bacteria 12174
484 Ga0500644_0050571 3300053088 Bacteria 1423
485 Ga0500647_0024726 3300053091 Bacteria 2826
486 Ga0500641_0022665 3300053096 Bacteria 2408
487 Ga0500556_0017078 3300053104 Bacteria 2268
488 Ga0500556_0020396 3300053104 Bacteria 2120
489 Ga0500556_0039757 3300053104 Bacteria 1650
490 Ga0500562_000610 3300053108 Bacteria 8621
491 Ga0500562_003889 3300053108 Bacteria 3765
492 Ga0500572_000606 3300053111 Bacteria 12073
493 Ga0500592_000198 3300053116 Bacteria 11379
494 Ga0500594_0000160 3300053118 Bacteria 17428
495 Ga0500595_015303 3300053119 Bacteria 2883
496 Ga0500608_000026 3300053122 Bacteria 68633
497 Ga0500618_000043 3300053125 Bacteria 110342
498 Ga0500642_0186117 3300053130 Bacteria 970
499 Ga0500658_0012169 3300053134 Bacteria 3168
500 Ga0500559_0000008 3300053136 Bacteria 182182
501 Ga0500559_0000227 3300053136 Bacteria 44722
502 Ga0500559_0005346 3300053136 Bacteria 5914
503 Ga0500564_000017 3300053138 Bacteria 52534
504 Ga0500577_0014091 3300053142 Bacteria 2462
505 Ga0500616_0012088 3300053153 Bacteria 5065
506 Ga0500616_0039570 3300053153 Bacteria 2541
507 Ga0500619_002977 3300053154 Bacteria 3378
508 Ga0500622_0000047 3300053156 Bacteria 149427
509 Ga0500622_0003357 3300053156 Bacteria 10782
510 Ga0500622_0003947 3300053156 Bacteria 9581
511 Ga0500622_0019739 3300053156 Bacteria 3578
512 Ga0500627_0030053 3300053158 Bacteria 2271
513 Ga0500636_0044897 3300053177 Bacteria 2607
514 Ga0500645_008084 3300053730 Bacteria 3621
515 Ga0500645_009720 3300053730 Bacteria 3219
516 Ga0500645_080426 3300053730 Bacteria 930
517 Ga0500609_000721 3300053731 Bacteria 4970
518 Ga0501082_0420817 3300060353 Bacteria 1167
519 Ga0501082_0507006 3300060353 Bacteria 1055

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10405389 Ga0307413_104053891 201
2 3300031903 Ga0307407_10248898 Ga0307407_102488982 201
3 3300031995 Ga0307409_100103587 Ga0307409_1001035872 201
4 3300032005 Ga0307411_10160596 Ga0307411_101605962 201
5 3300032126 Ga0307415_100078895 Ga0307415_1000788952 201
6 3300049529 Ga0501313_025817 Ga0501313_025817_24_629 201
7 3300049669 Ga0501235_044340 Ga0501235_044340_246_983 201
8 3300049679 Ga0501249_051635 Ga0501249_051635_54_791 201
9 3300046810 Ga0495660_0049606 Ga0495660_0049606_570_1313 221
10 3300025916 Ga0207663_10054697 Ga0207663_100546972 222
11 3300048903 Ga0496100_0168768 Ga0496100_0168768_411_1154 223
12 3300048909 Ga0496106_0221842 Ga0496106_0221842_626_1369 223
13 3300046665 Ga0495661_0111076 Ga0495661_0111076_309_1052 224
14 3300049528 Ga0501312_000649 Ga0501312_000649_1767_2510 225
15 3300049532 Ga0501316_003754 Ga0501316_003754_257_1000 225
16 3300046530 Ga0495654_0022462 Ga0495654_0022462_1278_2015 227
17 3300049664 Ga0501224_005887 Ga0501224_005887_217_936 227
18 3300053116 Ga0500592_000198 Ga0500592_000198_9518_10255 227
19 3300053158 Ga0500627_0030053 Ga0500627_0030053_1387_2124 227
20 3300041408 Ga0439453_0015104 Ga0439453_0015104_123_863 228
21 3300042876 Ga0451577_0480131 Ga0451577_0480131_154_897 229
22 3300049132 Ga0501343_002377 Ga0501343_002377_248_991 229
23 3300053156 Ga0500622_0003357 Ga0500622_0003357_2001_2738 229
24 3300053730 Ga0500645_080426 Ga0500645_080426_108_845 229
25 3300046492 Ga0495585_0018627 Ga0495585_0018627_1953_2693 230
26 3300046513 Ga0495616_0000112 Ga0495616_0000112_67747_68487 230
27 3300053731 Ga0500609_000721 Ga0500609_000721_2818_3558 230
28 3300005436 Ga0070713_100085475 Ga0070713_1000854752 231
29 3300005437 Ga0070710_10115372 Ga0070710_101153722 231
30 3300006175 Ga0070712_100099696 Ga0070712_1000996961 231
31 3300010159 Ga0099796_10107096 Ga0099796_101070961 231
32 3300025915 Ga0207693_10063121 Ga0207693_100631213 231
33 3300025928 Ga0207700_10063843 Ga0207700_100638433 231
34 3300039437 Ga0436365_1645730 Ga0436365_1645730_51_788 231
35 3300039450 Ga0436363_1269293 Ga0436363_1269293_262_999 231
36 3300039453 Ga0436362_1255974 Ga0436362_1255974_299_1036 231
37 3300060353 Ga0501082_0507006 Ga0501082_0507006_35_769 231
38 3300005347 Ga0070668_100021693 Ga0070668_1000216937 232
39 3300005353 Ga0070669_100018715 Ga0070669_1000187153 232
40 3300005355 Ga0070671_100000479 Ga0070671_1000004798 232
41 3300005617 Ga0068859_100000999 Ga0068859_10000099911 232
42 3300005841 Ga0068863_100007149 Ga0068863_1000071497 232
43 3300005842 Ga0068858_100014500 Ga0068858_1000145003 232
44 3300005843 Ga0068860_100012979 Ga0068860_1000129791 232
45 3300005937 Ga0081455_10094409 Ga0081455_100944093 232
46 3300006931 Ga0097620_100000999 Ga0097620_10000099911 232
47 3300009177 Ga0105248_10012881 Ga0105248_100128817 232
48 3300013306 Ga0163162_10018748 Ga0163162_100187487 232
49 3300014325 Ga0163163_10014204 Ga0163163_100142049 232
50 3300014968 Ga0157379_10064313 Ga0157379_100643132 232
51 3300021377 Ga0213874_10027254 Ga0213874_100272542 232
52 3300025923 Ga0207681_10009686 Ga0207681_100096867 232
53 3300025931 Ga0207644_10004836 Ga0207644_100048367 232
54 3300025941 Ga0207711_10013682 Ga0207711_100136822 232
55 3300025972 Ga0207668_10025099 Ga0207668_100250996 232
56 3300025986 Ga0207658_10013527 Ga0207658_100135273 232
57 3300026035 Ga0207703_10002468 Ga0207703_1000246813 232
58 3300026088 Ga0207641_10087617 Ga0207641_100876173 232
59 3300026095 Ga0207676_10186538 Ga0207676_101865382 232
60 3300027876 Ga0209974_10039696 Ga0209974_100396961 232
61 3300028379 Ga0268266_10581886 Ga0268266_105818862 232
62 3300028381 Ga0268264_10018738 Ga0268264_100187387 232
63 3300031852 Ga0307410_10070753 Ga0307410_100707532 232
64 3300039450 Ga0436363_1621007 Ga0436363_1621007_490_1230 232
65 3300039453 Ga0436362_0176928 Ga0436362_0176928_915_1655 232
66 3300005293 Ga0065715_10185097 Ga0065715_101850972 233
67 3300005439 Ga0070711_100369595 Ga0070711_1003695951 233
68 3300014326 Ga0157380_10035915 Ga0157380_100359153 233
69 3300036401 Ga0373937_0147549 Ga0373937_0147549_439_1182 233
70 3300046462 Ga0495651_0216004 Ga0495651_0216004_64_807 233
71 3300048088 Ga0495602_0141478 Ga0495602_0141478_510_1253 233
72 3300005327 Ga0070658_10000001 Ga0070658_10000001307 234
73 3300005339 Ga0070660_100001280 Ga0070660_10000128012 234
74 3300005366 Ga0070659_100015232 Ga0070659_1000152326 234
75 3300025909 Ga0207705_10000002 Ga0207705_100000021572 234
76 3300025919 Ga0207657_10003354 Ga0207657_100033549 234
77 3300025932 Ga0207690_10003860 Ga0207690_1000386010 234
78 3300031731 Ga0307405_10030398 Ga0307405_100303984 235
79 3300031995 Ga0307409_100071151 Ga0307409_1000711512 235
80 3300049161 Ga0501305_000807 Ga0501305_000807_1585_2328 235
81 3300049523 Ga0501300_006030 Ga0501300_006030_286_1029 235
82 3300049531 Ga0501315_000169 Ga0501315_000169_2565_3308 235
83 3300049532 Ga0501316_000492 Ga0501316_000492_1445_2188 235
84 3300049551 Ga0501335_000078 Ga0501335_000078_2121_2864 235
85 3300049552 Ga0501336_000175 Ga0501336_000175_973_1716 235
86 3300049669 Ga0501235_029139 Ga0501235_029139_271_1014 235
87 3300049851 Ga0501212_014440 Ga0501212_014440_188_931 235
88 3300009036 Ga0105244_10066915 Ga0105244_100669152 236
89 3300009098 Ga0105245_10039365 Ga0105245_100393651 236
90 3300025261 Ga0209233_1024480 Ga0209233_10244802 237
91 3300032002 Ga0307416_100208507 Ga0307416_1002085072 237
92 3300005563 Ga0068855_100214207 Ga0068855_1002142073 238
93 3300025949 Ga0207667_10357388 Ga0207667_103573881 238
94 3300037312 Ga0395899_0042865 Ga0395899_0042865_1810_2535 238
95 3300037418 Ga0395900_0568185 Ga0395900_0568185_65_790 238
96 3300037466 Ga0395898_0227526 Ga0395898_0227526_77_802 238
97 3300038443 Ga0395901_0084333 Ga0395901_0084333_1879_2604 238
98 3300049531 Ga0501315_012383 Ga0501315_012383_255_998 238
99 3300049533 Ga0501317_001797 Ga0501317_001797_1123_1866 238
100 iso_pu_bacteria 2513237087 2513590212 238
101 3300044842 Ga0466957_0381957 Ga0466957_0381957_14_757 239
102 iso_pu_bacteria 2510917020 2511124126 239
103 iso_pu_bacteria 2582581279 2585149518 239
104 iso_pu_bacteria 2582581280 2585154087 239
105 iso_pu_bacteria 2582581293 2585197483 239
106 iso_pu_bacteria 2585428106 2587916248 239
107 iso_pu_bacteria 2643221545 2643747562 239
108 iso_pu_bacteria 2643221552 2643778599 239
109 iso_pu_bacteria 2643221574 2643883603 239
110 iso_pu_bacteria 2643221583 2643925006 239
111 iso_pu_bacteria 2643221584 2643931246 239
112 iso_pu_bacteria 2643221640 2644226246 239
113 iso_pu_bacteria 2643221642 2644235734 239
114 iso_pu_bacteria 2643221663 2644354258 239
115 iso_pu_bacteria 2643221691 2644509442 239
116 iso_pu_bacteria 2643221699 2644551860 239
117 iso_pu_bacteria 2643221699 2644553107 239
118 iso_pu_bacteria 2791355048 2792460558 239
119 iso_pu_bacteria 2818991435 2819538763 239
120 iso_pu_bacteria 2818991454 2819648608 239
121 iso_pu_bacteria 2843744320 2843747841 239
122 iso_pu_bacteria 2849560528 2849560530 239
123 iso_pu_bacteria 2849573788 2849577104 239
124 iso_pu_bacteria 2851153111 2851153740 239
125 iso_pu_bacteria 2857504554 2857506451 239
126 iso_pu_bacteria 2884960567 2884964367 239
127 iso_pu_bacteria 2898329390 2898329586 239
128 iso_pu_bacteria 2928531327 2928533609 239
129 iso_pu_bacteria 2928972540 2928975215 239
130 iso_pu_bacteria 2941485952 2941487286 239
131 iso_pu_bacteria 2977240413 2977241791 239
132 3300044712 Ga0453684_0027798 Ga0453684_0027798_3835_4569 240
133 3300005367 Ga0070667_100002158 Ga0070667_10000215811 241
134 3300005548 Ga0070665_100010051 Ga0070665_1000100512 241
135 3300005842 Ga0068858_100054499 Ga0068858_1000544992 241
136 3300025986 Ga0207658_10000985 Ga0207658_1000098510 241
137 3300025986 Ga0207658_10640297 Ga0207658_106402971 241
138 3300028379 Ga0268266_10010417 Ga0268266_100104172 241
139 3300031595 Ga0265313_10008177 Ga0265313_100081775 241
140 3300044656 Ga0466969_0000677 Ga0466969_0000677_4372_5109 241
141 3300044693 Ga0466961_0006897 Ga0466961_0006897_5070_5807 241
142 3300044719 Ga0466971_0002075 Ga0466971_0002075_1066_1803 241
143 3300044842 Ga0466957_0006824 Ga0466957_0006824_3435_4172 241
144 3300045049 Ga0466959_0001525 Ga0466959_0001525_8001_8738 241
145 3300045836 Ga0466958_0077815 Ga0466958_0077815_133_870 241
146 3300046525 Ga0495663_0000375 Ga0495663_0000375_6669_7406 241
147 3300049579 Ga0501043_0067793 Ga0501043_0067793_1717_2454 241
148 3300049822 Ga0501035_0012956 Ga0501035_0012956_3128_3865 241
149 3300053087 Ga0500643_035455 Ga0500643_035455_646_1383 241
150 3300053104 Ga0500556_0020396 Ga0500556_0020396_937_1674 241
151 3300053153 Ga0500616_0012088 Ga0500616_0012088_1771_2508 241
152 3300053730 Ga0500645_008084 Ga0500645_008084_1458_2195 241
153 3300003771 Ga0055526_1036160 Ga0055526_10361602 242
154 3300003773 Ga0055537_1002952 Ga0055537_10029525 242
155 3300003775 Ga0055524_1033508 Ga0055524_10335082 242
156 3300003781 Ga0055536_1000478 Ga0055536_100047822 242
157 3300003781 Ga0055536_1005309 Ga0055536_10053091 242
158 3300003781 Ga0055536_1006045 Ga0055536_10060451 242
159 3300003790 Ga0055528_1008440 Ga0055528_10084404 242
160 3300003790 Ga0055528_1021094 Ga0055528_10210942 242
161 3300003791 Ga0055530_10014825 Ga0055530_100148251 242
162 3300003791 Ga0055530_10017903 Ga0055530_100179031 242
163 3300003794 Ga0055531_10001093 Ga0055531_100010938 242
164 3300003794 Ga0055531_10003069 Ga0055531_100030696 242
165 3300003794 Ga0055531_10003487 Ga0055531_1000348711 242
166 3300005262 Ga0065165_1001045 Ga0065165_10010455 242
167 3300005327 Ga0070658_10004249 Ga0070658_100042495 242
168 3300005331 Ga0070670_100216330 Ga0070670_1002163302 242
169 3300005336 Ga0070680_100000264 Ga0070680_10000026428 242
170 3300005339 Ga0070660_100639238 Ga0070660_1006392381 242
171 3300005340 Ga0070689_100691165 Ga0070689_1006911651 242
172 3300005347 Ga0070668_100003297 Ga0070668_10000329710 242
173 3300005347 Ga0070668_100093507 Ga0070668_1000935073 242
174 3300005347 Ga0070668_100371606 Ga0070668_1003716062 242
175 3300005347 Ga0070668_100426046 Ga0070668_1004260462 242
176 3300005355 Ga0070671_100019977 Ga0070671_1000199772 242
177 3300005365 Ga0070688_100018458 Ga0070688_1000184583 242
178 3300005367 Ga0070667_100021993 Ga0070667_1000219933 242
179 3300005367 Ga0070667_100076986 Ga0070667_1000769861 242
180 3300005455 Ga0070663_100468703 Ga0070663_1004687032 242
181 3300005456 Ga0070678_100237023 Ga0070678_1002370232 242
182 3300005457 Ga0070662_100489754 Ga0070662_1004897542 242
183 3300005458 Ga0070681_10000213 Ga0070681_1000021328 242
184 3300005530 Ga0070679_100242218 Ga0070679_1002422182 242
185 3300005539 Ga0068853_100178507 Ga0068853_1001785073 242
186 3300005547 Ga0070693_100291452 Ga0070693_1002914522 242
187 3300005548 Ga0070665_100000940 Ga0070665_10000094028 242
188 3300005548 Ga0070665_100001410 Ga0070665_1000014107 242
189 3300005563 Ga0068855_100001693 Ga0068855_10000169329 242
190 3300005564 Ga0070664_100449815 Ga0070664_1004498152 242
191 3300005614 Ga0068856_100056115 Ga0068856_1000561156 242
192 3300005614 Ga0068856_100201468 Ga0068856_1002014683 242
193 3300005614 Ga0068856_100990431 Ga0068856_1009904311 242
194 3300005617 Ga0068859_100469516 Ga0068859_1004695162 242
195 3300005618 Ga0068864_100003837 Ga0068864_10000383713 242
196 3300005618 Ga0068864_100016985 Ga0068864_1000169853 242
197 3300005618 Ga0068864_100168894 Ga0068864_1001688942 242
198 3300005618 Ga0068864_100620802 Ga0068864_1006208021 242
199 3300005618 Ga0068864_100797002 Ga0068864_1007970021 242
200 3300005719 Ga0068861_100318426 Ga0068861_1003184262 242
201 3300005841 Ga0068863_100006162 Ga0068863_1000061623 242
202 3300005842 Ga0068858_100064743 Ga0068858_1000647435 242
203 3300005843 Ga0068860_100001370 Ga0068860_10000137027 242
204 3300005843 Ga0068860_100111046 Ga0068860_1001110463 242
205 3300005844 Ga0068862_100004692 Ga0068862_10000469213 242
206 3300005844 Ga0068862_100146975 Ga0068862_1001469752 242
207 3300005844 Ga0068862_100420817 Ga0068862_1004208171 242
208 3300005937 Ga0081455_10184193 Ga0081455_101841932 242
209 3300006038 Ga0075365_10002352 Ga0075365_100023525 242
210 3300006042 Ga0075368_10000471 Ga0075368_100004713 242
211 3300006048 Ga0075363_100008842 Ga0075363_1000088424 242
212 3300006048 Ga0075363_100072890 Ga0075363_1000728902 242
213 3300006177 Ga0075362_10035447 Ga0075362_100354472 242
214 3300006178 Ga0075367_10020160 Ga0075367_100201603 242
215 3300006186 Ga0075369_10010780 Ga0075369_100107802 242
216 3300006195 Ga0075366_10037719 Ga0075366_100377192 242
217 3300006353 Ga0075370_10075248 Ga0075370_100752483 242
218 3300006844 Ga0075428_100032742 Ga0075428_1000327425 242
219 3300006847 Ga0075431_100021443 Ga0075431_1000214436 242
220 3300006931 Ga0097620_100469435 Ga0097620_1004694352 242
221 3300007788 Ga0099795_10000521 Ga0099795_100005217 242
222 3300009093 Ga0105240_10003426 Ga0105240_1000342618 242
223 3300009093 Ga0105240_10099371 Ga0105240_100993713 242
224 3300009093 Ga0105240_10399768 Ga0105240_103997682 242
225 3300009147 Ga0114129_10063020 Ga0114129_100630203 242
226 3300009176 Ga0105242_10120391 Ga0105242_101203913 242
227 3300009177 Ga0105248_10000001 Ga0105248_10000001189 242
228 3300009177 Ga0105248_10000685 Ga0105248_100006852 242
229 3300009177 Ga0105248_10044544 Ga0105248_100445444 242
230 3300009177 Ga0105248_10070680 Ga0105248_100706803 242
231 3300009177 Ga0105248_10201991 Ga0105248_102019912 242
232 3300009177 Ga0105248_10604118 Ga0105248_106041182 242
233 3300009551 Ga0105238_10020646 Ga0105238_100206465 242
234 3300009551 Ga0105238_10331880 Ga0105238_103318803 242
235 3300009553 Ga0105249_10000818 Ga0105249_1000081833 242
236 3300009553 Ga0105249_10384626 Ga0105249_103846262 242
237 3300010159 Ga0099796_10000086 Ga0099796_100000868 242
238 3300013105 Ga0157369_10023976 Ga0157369_100239764 242
239 3300013306 Ga0163162_10202233 Ga0163162_102022332 242
240 3300013306 Ga0163162_10436117 Ga0163162_104361172 242
241 3300014325 Ga0163163_10070984 Ga0163163_100709843 242
242 3300014325 Ga0163163_10562593 Ga0163163_105625931 242
243 3300014326 Ga0157380_10129517 Ga0157380_101295172 242
244 3300014326 Ga0157380_10275785 Ga0157380_102757852 242
245 3300014968 Ga0157379_10305330 Ga0157379_103053302 242
246 3300024225 Ga0224572_1003965 Ga0224572_10039653 242
247 3300024225 Ga0224572_1021452 Ga0224572_10214521 242
248 3300024227 Ga0228598_1046721 Ga0228598_10467211 242
249 3300025263 Ga0209565_1000127 Ga0209565_100012720 242
250 3300025291 Ga0209675_1010000 Ga0209675_10100001 242
251 3300025292 Ga0209676_1000046 Ga0209676_1000046168 242
252 3300025292 Ga0209676_1000336 Ga0209676_100033660 242
253 3300025292 Ga0209676_1000476 Ga0209676_100047656 242
254 3300025292 Ga0209676_1001278 Ga0209676_10012784 242
255 3300025295 Ga0209564_1005120 Ga0209564_10051203 242
256 3300025295 Ga0209564_1023284 Ga0209564_10232842 242
257 3300025297 Ga0209758_1000450 Ga0209758_100045056 242
258 3300025297 Ga0209758_1008106 Ga0209758_10081062 242
259 3300025298 Ga0209050_1000506 Ga0209050_100050656 242
260 3300025298 Ga0209050_1007979 Ga0209050_10079792 242
261 3300025298 Ga0209050_1018460 Ga0209050_10184602 242
262 3300025298 Ga0209050_1019830 Ga0209050_10198303 242
263 3300025299 Ga0209256_1016565 Ga0209256_10165652 242
264 3300025299 Ga0209256_1019956 Ga0209256_10199562 242
265 3300025303 Ga0209051_1057178 Ga0209051_10571782 242
266 3300025304 Ga0209257_1000159 Ga0209257_1000159107 242
267 3300025304 Ga0209257_1000481 Ga0209257_100048165 242
268 3300025304 Ga0209257_1008528 Ga0209257_10085287 242
269 3300025304 Ga0209257_1028172 Ga0209257_10281722 242
270 3300025903 Ga0207680_10035160 Ga0207680_100351603 242
271 3300025909 Ga0207705_10024662 Ga0207705_100246622 242
272 3300025909 Ga0207705_10253309 Ga0207705_102533091 242
273 3300025913 Ga0207695_10003143 Ga0207695_1000314314 242
274 3300025913 Ga0207695_10070156 Ga0207695_100701564 242
275 3300025913 Ga0207695_10453733 Ga0207695_104537332 242
276 3300025914 Ga0207671_10168372 Ga0207671_101683723 242
277 3300025917 Ga0207660_10003027 Ga0207660_100030277 242
278 3300025919 Ga0207657_10528620 Ga0207657_105286202 242
279 3300025921 Ga0207652_10006822 Ga0207652_100068225 242
280 3300025921 Ga0207652_10115724 Ga0207652_101157242 242
281 3300025924 Ga0207694_10032403 Ga0207694_100324035 242
282 3300025924 Ga0207694_10410747 Ga0207694_104107471 242
283 3300025925 Ga0207650_10000201 Ga0207650_1000020113 242
284 3300025925 Ga0207650_10122435 Ga0207650_101224352 242
285 3300025931 Ga0207644_10089321 Ga0207644_100893212 242
286 3300025931 Ga0207644_10105354 Ga0207644_101053541 242
287 3300025933 Ga0207706_10062708 Ga0207706_100627084 242
288 3300025933 Ga0207706_10494750 Ga0207706_104947501 242
289 3300025941 Ga0207711_10000002 Ga0207711_10000002890 242
290 3300025941 Ga0207711_10001954 Ga0207711_100019547 242
291 3300025941 Ga0207711_10006432 Ga0207711_100064322 242
292 3300025941 Ga0207711_10025045 Ga0207711_100250454 242
293 3300025941 Ga0207711_10203374 Ga0207711_102033743 242
294 3300025941 Ga0207711_10325958 Ga0207711_103259582 242
295 3300025945 Ga0207679_10008351 Ga0207679_100083515 242
296 3300025945 Ga0207679_10070393 Ga0207679_100703931 242
297 3300025949 Ga0207667_10029154 Ga0207667_100291545 242
298 3300025960 Ga0207651_10043707 Ga0207651_100437072 242
299 3300025960 Ga0207651_10229855 Ga0207651_102298552 242
300 3300025961 Ga0207712_10118548 Ga0207712_101185483 242
301 3300025961 Ga0207712_10386918 Ga0207712_103869182 242
302 3300025972 Ga0207668_10000007 Ga0207668_1000000748 242
303 3300025972 Ga0207668_10000247 Ga0207668_1000024741 242
304 3300025972 Ga0207668_10356001 Ga0207668_103560012 242
305 3300025986 Ga0207658_10000052 Ga0207658_1000005271 242
306 3300025986 Ga0207658_10001933 Ga0207658_1000193310 242
307 3300025986 Ga0207658_10036009 Ga0207658_100360093 242
308 3300026035 Ga0207703_10049425 Ga0207703_100494251 242
309 3300026067 Ga0207678_10324071 Ga0207678_103240712 242
310 3300026078 Ga0207702_10023453 Ga0207702_100234532 242
311 3300026078 Ga0207702_10098159 Ga0207702_100981592 242
312 3300026088 Ga0207641_10267706 Ga0207641_102677062 242
313 3300026095 Ga0207676_10001242 Ga0207676_1000124213 242
314 3300026095 Ga0207676_10012779 Ga0207676_100127793 242
315 3300026095 Ga0207676_10094198 Ga0207676_100941983 242
316 3300026095 Ga0207676_10334476 Ga0207676_103344762 242
317 3300026118 Ga0207675_100139166 Ga0207675_1001391662 242
318 3300026118 Ga0207675_100154745 Ga0207675_1001547453 242
319 3300026118 Ga0207675_100923487 Ga0207675_1009234871 242
320 3300026121 Ga0207683_10099258 Ga0207683_100992582 242
321 3300026142 Ga0207698_10023739 Ga0207698_100237393 242
322 3300027866 Ga0209813_10000616 Ga0209813_100006161 242
323 3300028379 Ga0268266_10001205 Ga0268266_1000120516 242
324 3300028379 Ga0268266_10011789 Ga0268266_100117893 242
325 3300028380 Ga0268265_10002350 Ga0268265_100023509 242
326 3300028380 Ga0268265_10091103 Ga0268265_100911033 242
327 3300028380 Ga0268265_10134907 Ga0268265_101349073 242
328 3300028381 Ga0268264_10000684 Ga0268264_100006846 242
329 3300028381 Ga0268264_10210953 Ga0268264_102109532 242
330 3300028381 Ga0268264_10236140 Ga0268264_102361402 242
331 3300028381 Ga0268264_10638747 Ga0268264_106387471 242
332 3300028786 Ga0307517_10001029 Ga0307517_1000102921 242
333 3300028786 Ga0307517_10115170 Ga0307517_101151702 242
334 3300028794 Ga0307515_10066696 Ga0307515_100666963 242
335 3300028794 Ga0307515_10067676 Ga0307515_100676766 242
336 3300028794 Ga0307515_10315002 Ga0307515_103150022 242
337 3300031018 Ga0265773_1000596 Ga0265773_10005962 242
338 3300031251 Ga0265327_10000220 Ga0265327_1000022079 242
339 3300031251 Ga0265327_10152209 Ga0265327_101522092 242
340 3300031456 Ga0307513_10000082 Ga0307513_10000082100 242
341 3300031456 Ga0307513_10001006 Ga0307513_1000100627 242
342 3300031456 Ga0307513_10002226 Ga0307513_1000222615 242
343 3300031824 Ga0307413_10021312 Ga0307413_100213123 242
344 3300031824 Ga0307413_10060092 Ga0307413_100600922 242
345 3300031852 Ga0307410_10213633 Ga0307410_102136333 242
346 3300031901 Ga0307406_10006321 Ga0307406_100063217 242
347 3300031903 Ga0307407_10097113 Ga0307407_100971133 242
348 3300031911 Ga0307412_10079699 Ga0307412_100796993 242
349 3300031995 Ga0307409_100155825 Ga0307409_1001558253 242
350 3300032002 Ga0307416_100355940 Ga0307416_1003559402 242
351 3300032002 Ga0307416_100689512 Ga0307416_1006895121 242
352 3300032004 Ga0307414_10047374 Ga0307414_100473742 242
353 3300032004 Ga0307414_10061855 Ga0307414_100618551 242
354 3300032004 Ga0307414_10162131 Ga0307414_101621312 242
355 3300032004 Ga0307414_10205516 Ga0307414_102055161 242
356 3300032005 Ga0307411_10046571 Ga0307411_100465712 242
357 3300035410 Ga0373924_0031367 Ga0373924_0031367_423_1166 242
358 3300035691 Ga0373931_0022704 Ga0373931_0022704_1864_2604 242
359 3300035724 Ga0373933_0090001 Ga0373933_0090001_632_1375 242
360 3300035725 Ga0373947_0195926 Ga0373947_0195926_527_1267 242
361 3300037068 Ga0373925_0053200 Ga0373925_0053200_2165_2905 242
362 3300037312 Ga0395899_0006527 Ga0395899_0006527_5063_5803 242
363 3300037418 Ga0395900_0002429 Ga0395900_0002429_17036_17776 242
364 3300037418 Ga0395900_0459504 Ga0395900_0459504_240_980 242
365 3300037466 Ga0395898_0008060 Ga0395898_0008060_7370_8110 242
366 3300037471 Ga0395905_0007649 Ga0395905_0007649_4824_5564 242
367 3300037471 Ga0395905_0016314 Ga0395905_0016314_2546_3286 242
368 3300037471 Ga0395905_0214420 Ga0395905_0214420_66_806 242
369 3300037471 Ga0395905_0317642 Ga0395905_0317642_425_1165 242
370 3300037471 Ga0395905_0514689 Ga0395905_0514689_254_994 242
371 3300038443 Ga0395901_0000007 Ga0395901_0000007_54608_55348 242
372 3300038443 Ga0395901_0013125 Ga0395901_0013125_3996_4736 242
373 3300038443 Ga0395901_0086637 Ga0395901_0086637_2474_3214 242
374 3300039062 Ga0400483_231819 Ga0400483_231819_329_1075 242
375 3300039437 Ga0436365_1145221 Ga0436365_1145221_79_819 242
376 3300042436 Ga0439435_0014277 Ga0439435_0014277_1048_1788 242
377 3300044684 Ga0466966_0055079 Ga0466966_0055079_688_1428 242
378 3300046453 Ga0495627_000269 Ga0495627_000269_5518_6258 242
379 3300046457 Ga0495590_0000439 Ga0495590_0000439_9600_10340 242
380 3300046459 Ga0495629_0216516 Ga0495629_0216516_262_999 242
381 3300046460 Ga0495638_0000347 Ga0495638_0000347_10118_10858 242
382 3300046460 Ga0495638_0000492 Ga0495638_0000492_6512_7252 242
383 3300046471 Ga0495650_0000007 Ga0495650_0000007_244273_245013 242
384 3300046492 Ga0495585_0167170 Ga0495585_0167170_277_1017 242
385 3300046501 Ga0495607_0090228 Ga0495607_0090228_312_1052 242
386 3300046506 Ga0495583_0000037 Ga0495583_0000037_148430_149170 242
387 3300046506 Ga0495583_0024449 Ga0495583_0024449_28_768 242
388 3300046507 Ga0495606_0005657 Ga0495606_0005657_10964_11803 242
389 3300046512 Ga0495610_0001339 Ga0495610_0001339_6690_7430 242
390 3300046512 Ga0495610_0002423 Ga0495610_0002423_4286_5026 242
391 3300046512 Ga0495610_0010802 Ga0495610_0010802_541_1284 242
392 3300046518 Ga0495631_0003776 Ga0495631_0003776_3994_4734 242
393 3300046519 Ga0495632_0023018 Ga0495632_0023018_2535_3275 242
394 3300046520 Ga0495637_0008992 Ga0495637_0008992_3147_3887 242
395 3300046520 Ga0495637_0021760 Ga0495637_0021760_1811_2551 242
396 3300046524 Ga0495648_0000105 Ga0495648_0000105_1962_2702 242
397 3300046528 Ga0495642_0013236 Ga0495642_0013236_928_1668 242
398 3300046530 Ga0495654_0000054 Ga0495654_0000054_3988_4728 242
399 3300046539 Ga0495621_0146330 Ga0495621_0146330_100_840 242
400 3300046542 Ga0495597_0043187 Ga0495597_0043187_667_1407 242
401 3300046542 Ga0495597_0146615 Ga0495597_0146615_49_789 242
402 3300046558 Ga0495633_0004403 Ga0495633_0004403_4005_4745 242
403 3300046616 Ga0495668_0000252 Ga0495668_0000252_70652_71392 242
404 3300046616 Ga0495668_0037195 Ga0495668_0037195_158_901 242
405 3300046616 Ga0495668_0063745 Ga0495668_0063745_1116_1856 242
406 3300046616 Ga0495668_0157644 Ga0495668_0157644_465_1205 242
407 3300046616 Ga0495668_0185403 Ga0495668_0185403_128_868 242
408 3300046648 Ga0495611_0145282 Ga0495611_0145282_268_1008 242
409 3300046660 Ga0495625_0000415 Ga0495625_0000415_36313_37053 242
410 3300046660 Ga0495625_0030568 Ga0495625_0030568_2391_3131 242
411 3300046660 Ga0495625_0070115 Ga0495625_0070115_534_1274 242
412 3300046660 Ga0495625_0120956 Ga0495625_0120956_775_1515 242
413 3300046663 Ga0495635_0091482 Ga0495635_0091482_753_1496 242
414 3300046684 Ga0495669_0050164 Ga0495669_0050164_413_1153 242
415 3300046689 Ga0495613_0000964 Ga0495613_0000964_10884_11624 242
416 3300046691 Ga0495670_0075951 Ga0495670_0075951_75_815 242
417 3300046794 Ga0495589_0152905 Ga0495589_0152905_127_867 242
418 3300046810 Ga0495660_0046650 Ga0495660_0046650_997_1737 242
419 3300047320 Ga0495672_0007870 Ga0495672_0007870_5134_5874 242
420 3300047320 Ga0495672_0024032 Ga0495672_0024032_2714_3454 242
421 3300047445 Ga0495677_0047193 Ga0495677_0047193_563_1303 242
422 3300047446 Ga0495679_026121 Ga0495679_026121_313_1053 242
423 3300047469 Ga0495673_0000402 Ga0495673_0000402_44049_44789 242
424 3300047469 Ga0495673_0001079 Ga0495673_0001079_5892_6632 242
425 3300047470 Ga0495681_0066352 Ga0495681_0066352_360_1100 242
426 3300047472 Ga0495686_0000572 Ga0495686_0000572_41482_42222 242
427 3300047472 Ga0495686_0004508 Ga0495686_0004508_10238_10978 242
428 3300047472 Ga0495686_0029609 Ga0495686_0029609_2721_3461 242
429 3300048905 Ga0496102_0108686 Ga0496102_0108686_1742_2482 242
430 3300048905 Ga0496102_0146564 Ga0496102_0146564_1023_1763 242
431 3300048906 Ga0496103_0000643 Ga0496103_0000643_7077_7817 242
432 3300048906 Ga0496103_0234389 Ga0496103_0234389_143_883 242
433 3300048906 Ga0496103_0262147 Ga0496103_0262147_251_991 242
434 3300048907 Ga0496104_0000088 Ga0496104_0000088_62824_63567 242
435 3300048908 Ga0496105_0018470 Ga0496105_0018470_4646_5389 242
436 3300048910 Ga0496107_0000041 Ga0496107_0000041_65324_66199 242
437 3300048912 Ga0496109_0020688 Ga0496109_0020688_814_1554 242
438 3300048913 Ga0496110_0001919 Ga0496110_0001919_935_1678 242
439 3300048913 Ga0496110_0679637 Ga0496110_0679637_126_863 242
440 3300048914 Ga0496111_0013661 Ga0496111_0013661_1921_2664 242
441 3300048915 Ga0496112_0031566 Ga0496112_0031566_870_1613 242
442 3300048916 Ga0496113_0002054 Ga0496113_0002054_10182_10925 242
443 3300048916 Ga0496113_0074106 Ga0496113_0074106_1048_1788 242
444 3300048916 Ga0496113_0639734 Ga0496113_0639734_84_824 242
445 3300048917 Ga0496114_0750784 Ga0496114_0750784_34_786 242
446 3300048918 Ga0496115_0004136 Ga0496115_0004136_9353_10093 242
447 3300048918 Ga0496115_0005514 Ga0496115_0005514_6008_6748 242
448 3300048918 Ga0496115_0088679 Ga0496115_0088679_1139_1879 242
449 3300048918 Ga0496115_0154511 Ga0496115_0154511_1083_1835 242
450 3300048918 Ga0496115_0184285 Ga0496115_0184285_755_1495 242
451 3300048919 Ga0496116_0003801 Ga0496116_0003801_12796_13536 242
452 3300048919 Ga0496116_0011628 Ga0496116_0011628_4620_5360 242
453 3300048920 Ga0496117_0005240 Ga0496117_0005240_6254_6994 242
454 3300048920 Ga0496117_0043782 Ga0496117_0043782_206_946 242
455 3300048921 Ga0496118_0013510 Ga0496118_0013510_5710_6450 242
456 3300048921 Ga0496118_0020836 Ga0496118_0020836_2590_3330 242
457 3300048922 Ga0496119_0013609 Ga0496119_0013609_1768_2508 242
458 3300048924 Ga0496121_0000009 Ga0496121_0000009_563620_564360 242
459 3300048924 Ga0496121_0000802 Ga0496121_0000802_4905_5780 242
460 3300048925 Ga0496122_0001009 Ga0496122_0001009_1353_2093 242
461 3300048926 Ga0496123_0000529 Ga0496123_0000529_64366_65106 242
462 3300048926 Ga0496123_0120554 Ga0496123_0120554_626_1366 242
463 3300048927 Ga0496124_0010701 Ga0496124_0010701_2622_3362 242
464 3300048928 Ga0496125_0004025 Ga0496125_0004025_14301_15041 242
465 3300048929 Ga0496126_0000898 Ga0496126_0000898_45100_45840 242
466 3300049459 Ga0495678_009288 Ga0495678_009288_463_1203 242
467 3300049571 Ga0501034_0003612 Ga0501034_0003612_5266_6006 242
468 3300049571 Ga0501034_0105274 Ga0501034_0105274_487_1227 242
469 3300049573 Ga0501037_0004262 Ga0501037_0004262_2289_3029 242
470 3300049573 Ga0501037_0125228 Ga0501037_0125228_324_1064 242
471 3300049581 Ga0501047_0022683 Ga0501047_0022683_4132_4872 242
472 3300049593 Ga0501077_0078320 Ga0501077_0078320_855_1598 242
473 3300049671 Ga0501238_003244 Ga0501238_003244_147_887 242
474 3300049823 Ga0501044_0276978 Ga0501044_0276978_705_1445 242
475 3300049823 Ga0501044_0287161 Ga0501044_0287161_585_1325 242
476 3300050489 nmdc:mga03683_196481_c1 nmdc:mga03683_196481_c1_44_784 242
477 3300050490 nmdc:mga03n38_262152_c1 nmdc:mga03n38_262152_c1_159_899 242
478 3300050491 nmdc:mga00v17_23834_c1 nmdc:mga00v17_23834_c1_2116_2859 242
479 3300050493 nmdc:mga0k408_11232_c1 nmdc:mga0k408_11232_c1_1172_1912 242
480 3300050494 nmdc:mga06z11_11792_c1 nmdc:mga06z11_11792_c1_84_827 242
481 3300050494 nmdc:mga06z11_19246_c1 nmdc:mga06z11_19246_c1_270_1013 242
482 3300050494 nmdc:mga06z11_307_c1 nmdc:mga06z11_307_c1_1739_2482 242
483 3300050495 nmdc:mga04h51_425_c1 nmdc:mga04h51_425_c1_7597_8340 242
484 3300050496 nmdc:mga07m45_169047_c1 nmdc:mga07m45_169047_c1_297_1037 242
485 3300050507 nmdc:mga05p37_48785_c1 nmdc:mga05p37_48785_c1_2698_3441 242
486 3300050508 nmdc:mga09592_298761_c1 nmdc:mga09592_298761_c1_90_833 242
487 3300050510 nmdc:mga06r32_474880_c1 nmdc:mga06r32_474880_c1_51_794 242
488 3300053084 Ga0495595_0090252 Ga0495595_0090252_44_787 242
489 3300053086 Ga0500578_0000665 Ga0500578_0000665_3882_4622 242
490 3300053087 Ga0500643_008397 Ga0500643_008397_1415_2155 242
491 3300053087 Ga0500643_021059 Ga0500643_021059_699_1439 242
492 3300053088 Ga0500644_0000004 Ga0500644_0000004_172671_173411 242
493 3300053088 Ga0500644_0000692 Ga0500644_0000692_9746_10486 242
494 3300053088 Ga0500644_0050571 Ga0500644_0050571_302_1042 242
495 3300053091 Ga0500647_0024726 Ga0500647_0024726_1307_2047 242
496 3300053096 Ga0500641_0022665 Ga0500641_0022665_613_1353 242
497 3300053104 Ga0500556_0017078 Ga0500556_0017078_333_1073 242
498 3300053104 Ga0500556_0039757 Ga0500556_0039757_269_1009 242
499 3300053108 Ga0500562_000610 Ga0500562_000610_7742_8482 242
500 3300053108 Ga0500562_003889 Ga0500562_003889_72_812 242
501 3300053111 Ga0500572_000606 Ga0500572_000606_9922_10662 242
502 3300053118 Ga0500594_0000160 Ga0500594_0000160_10451_11191 242
503 3300053119 Ga0500595_015303 Ga0500595_015303_1704_2456 242
504 3300053122 Ga0500608_000026 Ga0500608_000026_19308_20048 242
505 3300053125 Ga0500618_000043 Ga0500618_000043_63665_64405 242
506 3300053130 Ga0500642_0186117 Ga0500642_0186117_114_854 242
507 3300053134 Ga0500658_0012169 Ga0500658_0012169_996_1736 242
508 3300053136 Ga0500559_0000008 Ga0500559_0000008_281_1021 242
509 3300053136 Ga0500559_0000227 Ga0500559_0000227_5570_6310 242
510 3300053136 Ga0500559_0005346 Ga0500559_0005346_359_1099 242
511 3300053138 Ga0500564_000017 Ga0500564_000017_17296_18036 242
512 3300053142 Ga0500577_0014091 Ga0500577_0014091_239_979 242
513 3300053153 Ga0500616_0039570 Ga0500616_0039570_124_864 242
514 3300053154 Ga0500619_002977 Ga0500619_002977_2318_3058 242
515 3300053156 Ga0500622_0000047 Ga0500622_0000047_41501_42241 242
516 3300053156 Ga0500622_0003947 Ga0500622_0003947_93_833 242
517 3300053156 Ga0500622_0019739 Ga0500622_0019739_2641_3381 242
518 3300053177 Ga0500636_0044897 Ga0500636_0044897_573_1313 242
519 3300053730 Ga0500645_009720 Ga0500645_009720_551_1291 242
520 3300060353 Ga0501082_0420817 Ga0501082_0420817_279_1016 242
521 iso_pu_bacteria 2738543010 2739231289 242
522 iso_pu_bacteria 2929206907 2929210394 242
523 iso_pu_bacteria 2956897341 2956901343 242
524 iso_pu_bacteria 2671180330 2672335070 243
525 iso_pu_bacteria 2738541295 2738812885 243
526 iso_pu_bacteria 2816332186 2816863947 243
527 iso_pu_bacteria 2842682962 2842685157 243
528 iso_pu_bacteria 2849139964 2849140861 243
529 iso_pu_bacteria 2857581216 2857584295 243
530 iso_pu_bacteria 2919414237 2919414608 243
531 iso_pu_bacteria 2936361878 2936365240 243
532 iso_pu_bacteria 2977254563 2977258342 243
533 iso_pu_bacteria 2990275345 2990279373 243
534 iso_pu_bacteria 3001892409 3001893522 243
535 iso_pu_bacteria 3006826541 3006831067 243
536 iso_pu_bacteria 3006969106 3006970673 243
537 iso_pu_bacteria 3006973921 3006974797 243
538 iso_pu_bacteria 8057632132 8057634158 243
539 3300013102 Ga0157371_10107495 Ga0157371_101074952 244
540 iso_pu_bacteria 2852673933 2852674968 244
541 iso_pu_bacteria 2928510474 2928511682 244
542 3300009098 Ga0105245_10131745 Ga0105245_101317452 245
543 3300025927 Ga0207687_10079794 Ga0207687_100797943 245
544 3300027876 Ga0209974_10034907 Ga0209974_100349073 246
545 3300003578 Ga0006562J51391_1006021 Ga0006562J51391_10060213 247
546 3300025294 Ga0209025_1028141 Ga0209025_10281412 247
547 3300031548 Ga0307408_100282071 Ga0307408_1002820712 247
548 3300031995 Ga0307409_100105165 Ga0307409_1001051654 247
549 3300048909 Ga0496106_0449602 Ga0496106_0449602_54_797 247
550 3300048911 Ga0496108_0353042 Ga0496108_0353042_290_1033 247
551 3300048913 Ga0496110_0001538 Ga0496110_0001538_13345_14088 247
552 3300048913 Ga0496110_0063478 Ga0496110_0063478_1608_2351 247
553 3300048914 Ga0496111_0010025 Ga0496111_0010025_2427_3170 247
554 3300049127 Ga0501306_010800 Ga0501306_010800_362_1105 247
555 3300049132 Ga0501343_000260 Ga0501343_000260_439_1182 247
556 3300049134 Ga0501345_01131 Ga0501345_01131_26_769 247
557 3300049161 Ga0501305_005425 Ga0501305_005425_490_1233 247
558 3300049528 Ga0501312_007154 Ga0501312_007154_187_930 247
559 3300049531 Ga0501315_006190 Ga0501315_006190_456_1199 247
560 3300049532 Ga0501316_003134 Ga0501316_003134_485_1228 247
561 3300049533 Ga0501317_005610 Ga0501317_005610_179_922 247
562 3300049537 Ga0501321_005095 Ga0501321_005095_123_866 247
563 3300049539 Ga0501323_002103 Ga0501323_002103_123_866 247
564 3300049539 Ga0501323_003065 Ga0501323_003065_371_1114 247
565 3300049548 Ga0501332_04546 Ga0501332_04546_64_807 247
566 3300049550 Ga0501334_05980 Ga0501334_05980_22_765 247
567 3300049551 Ga0501335_002159 Ga0501335_002159_490_1233 247
568 3300049552 Ga0501336_001783 Ga0501336_001783_69_812 247
569 3300049553 Ga0501337_001125 Ga0501337_001125_485_1228 247
570 3300049556 Ga0501340_001753 Ga0501340_001753_112_855 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

244

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

289

0.97

PF08659

KR

KR domain

52

233

0.88

PF23441

46

291

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

58

273

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

54

226

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9955 6 247
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9943 1 247
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9935 1 247
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.991 1 247
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.991 4 247
ID Description Score Start End Superfamily
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9941 6 247 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9939 82 247 3.40.50.720
af_A0A1D6J5I0_53_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9886 3 247 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9827 3 247 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.982 6 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A850V1U6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 1 166 247
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9986 85 247 GO:0016491
AF-A0A3M1YKC1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9924 1 247 GO:0004316
GO:0006633
GO:0051287
AF-A0A3S8V3A3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9912 99 246 GO:0016491
AF-A0A371GW42-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9898 3 247 GO:0004316
GO:0006633
GO:0009507
GO:0051287

Feature Viewer

pLDDT pTM Quality
96.02 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map