F464597

General Info

Members Datasets Scaffolds Average Seq Length
568 359 1136 218

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100523957|Ga0070668_1005239572
Length 249
Sequence MPAVRRYHAHRRIIRKTLTVQEYQRTFIDLAMSRTALRFGSFKLKSGRESPYFFNAGLFNDGEAIAVLGQCYAAALTRSGLEFDMLFGPAYKGIPLATTTAVALAEHHHRSVPWAFNRKEAKEHGEGGNIVGAPLRGRVVIIDDVITAGTAIRESVEIIRAAGATPAGVALALDRQERGQGTQSAVQEVSAQFGLRCVSILTLADLIETFAQASGDAVRISREQFVALQSYQREWGIGAVSGGAKAGAE

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
80 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
81 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
82 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
174 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
186 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
260 2547132181 Kosakonia sacchari SP1 Isolate Stem
261 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
262 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
263 2561511199 Enterobacter sp. R4-368 Isolate Nodule
264 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
265 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
266 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
267 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
268 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
269 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
270 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
271 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
272 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
273 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
274 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
275 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
276 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
277 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
278 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
279 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
280 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
281 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
282 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
283 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
284 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
285 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
286 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
287 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
288 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
289 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
290 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
291 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
292 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
293 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
294 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
295 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
296 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
297 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
298 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
299 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
300 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
301 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
302 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
303 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
304 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
305 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
306 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
307 2636415599 Klebsiella variicola DX120E Isolate Unclassified
308 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
309 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
310 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
311 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
312 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
313 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
314 2751185917 Enterobacter sp. HK169 Isolate Unclassified
315 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
316 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
317 2775507074 Klebsiella sp. D5A Isolate Unclassified
318 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
319 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
320 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
321 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
322 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
323 2821118458 Enterobacter asburiae 609 Isolate Unclassified
324 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
325 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
326 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
327 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
328 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
329 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
330 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
331 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
332 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
333 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
334 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
335 2932406140 Serratia sp. 2723 Isolate Rhizosphere
336 2937539931 Pantoea sp. LS15 Isolate Unclassified
337 2937967321 Serratia sp. YC16 Isolate Unclassified
338 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
339 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
340 2939577877 Serratia sp. 509 Isolate Rhizosphere
341 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
342 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
343 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
344 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
345 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
346 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
347 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
348 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
349 640753048 Serratia proteamaculans 568 Isolate Endosphere
350 8004592986 Serratia sp. S119 Isolate Unclassified
351 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
352 8018221730 Enterobacter sp. CM29 Isolate Unclassified
353 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
354 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
355 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
356 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
357 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
358 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
359 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.04
Metatranscriptomes 0.18
Isolates 17.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 0.7
Nodule 4.05
Rhizoplane 12.32
Rhizosphere 70.77
Stem 0.18
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100523957 3300005347 Bacteria 1029
2 SwRhRL2b_contig_138772 2162886007 Bacteria 1560
3 SwRhRL2b_contig_1625696 2162886007 Bacteria 2164
4 JGI25406J46586_10008309 3300003203 Bacteria 4709
5 rootH2_10109502 3300003320 Bacteria 8002
6 Ga0065704_10001283 3300005289 Bacteria 9882
7 Ga0065704_10012633 3300005289 Bacteria 2172
8 Ga0065704_10075026 3300005289 Bacteria 5837
9 Ga0070658_10105779 3300005327 Bacteria 2328
10 Ga0070683_100189701 3300005329 Bacteria 1952
11 Ga0068869_100505600 3300005334 Bacteria 1009
12 Ga0068869_100910467 3300005334 Bacteria 761
13 Ga0070682_100039357 3300005337 Bacteria 2905
14 Ga0070682_100074768 3300005337 Bacteria 2177
15 Ga0070689_100003519 3300005340 Bacteria 10415
16 Ga0070689_100181862 3300005340 Unclassified 1708
17 Ga0070675_100082050 3300005354 Bacteria 2690
18 Ga0070675_100198100 3300005354 Bacteria 1742
19 Ga0070674_100016438 3300005356 Bacteria 4637
20 Ga0070674_100036337 3300005356 Bacteria 3306
21 Ga0070674_100076188 3300005356 Bacteria 2384
22 Ga0070673_100043782 3300005364 Bacteria 3462
23 Ga0070673_100103506 3300005364 Bacteria 2349
24 Ga0070688_100070540 3300005365 Bacteria 2234
25 Ga0070688_100301355 3300005365 Bacteria 1159
26 Ga0070659_100145185 3300005366 Bacteria 1933
27 Ga0070667_100328813 3300005367 Bacteria 1380
28 Ga0070709_10011208 3300005434 Bacteria 4987
29 Ga0070709_10053297 3300005434 Bacteria 2547
30 Ga0070709_10370140 3300005434 Bacteria 1063
31 Ga0070714_100003407 3300005435 Bacteria 11847
32 Ga0070713_100038259 3300005436 Bacteria 3885
33 Ga0070710_10048425 3300005437 Bacteria 2374
34 Ga0070710_10074426 3300005437 Bacteria 1966
35 Ga0070705_100421206 3300005440 Bacteria 994
36 Ga0070700_100058918 3300005441 Bacteria 2415
37 Ga0070694_100462604 3300005444 Bacteria 1003
38 Ga0070678_100162233 3300005456 Bacteria 1812
39 Ga0070678_100184247 3300005456 Bacteria 1712
40 Ga0070681_10006040 3300005458 Bacteria 11739
41 Ga0070681_10372730 3300005458 Bacteria 1338
42 Ga0068867_100031599 3300005459 Bacteria 3824
43 Ga0070685_10017897 3300005466 Bacteria 3803
44 Ga0070679_100108954 3300005530 Bacteria 2756
45 Ga0070679_100615864 3300005530 Bacteria 1029
46 Ga0070684_100067734 3300005535 Bacteria 3137
47 Ga0070672_100034454 3300005543 Unclassified 3842
48 Ga0070672_100038891 3300005543 Bacteria 3639
49 Ga0070672_100069426 3300005543 Bacteria 2797
50 Ga0070672_100191720 3300005543 Bacteria 1707
51 Ga0070686_100145648 3300005544 Bacteria 1654
52 Ga0070686_100203412 3300005544 Bacteria 1421
53 Ga0070696_100442106 3300005546 Bacteria 1025
54 Ga0070665_100012223 3300005548 Bacteria 8655
55 Ga0070665_100012353 3300005548 Bacteria 8606
56 Ga0070665_100237810 3300005548 Unclassified 1822
57 Ga0070664_100170115 3300005564 Bacteria 1933
58 Ga0070664_100445025 3300005564 Bacteria 1189
59 Ga0068857_100000119 3300005577 Bacteria 46982
60 Ga0068857_100087304 3300005577 Bacteria 2790
61 Ga0068856_100022706 3300005614 Bacteria 6100
62 Ga0070702_100327145 3300005615 Bacteria 1070
63 Ga0068859_100058480 3300005617 Bacteria 3884
64 Ga0068861_100018605 3300005719 Bacteria 4950
65 Ga0068861_100026530 3300005719 Bacteria 4212
66 Ga0068861_100082872 3300005719 Bacteria 2515
67 Ga0068851_10008063 3300005834 Bacteria 4861
68 Ga0068870_10012786 3300005840 Bacteria 3931
69 Ga0068870_10090122 3300005840 Bacteria 1713
70 Ga0068863_100070361 3300005841 Bacteria 3309
71 Ga0068863_100100424 3300005841 Bacteria 2750
72 Ga0068863_100834291 3300005841 Bacteria 920
73 Ga0068860_100168512 3300005843 Bacteria 2115
74 Ga0068862_100095382 3300005844 Bacteria 2595
75 Ga0068862_100248680 3300005844 Bacteria 1620
76 Ga0081455_10004966 3300005937 Bacteria 14710
77 Ga0081539_10000006 3300005985 Bacteria 534555
78 Ga0070717_10063537 3300006028 Bacteria 3064
79 Ga0070717_10358494 3300006028 Bacteria 1305
80 Ga0075364_10017489 3300006051 Bacteria 4479
81 Ga0070712_100096010 3300006175 Bacteria 2182
82 Ga0075369_10017052 3300006186 Bacteria 2939
83 Ga0097621_100016215 3300006237 Bacteria 5627
84 Ga0097621_100183090 3300006237 Bacteria 1811
85 Ga0097621_100198169 3300006237 Bacteria 1742
86 Ga0097621_100236744 3300006237 Bacteria 1595
87 Ga0097621_101055462 3300006237 Bacteria 761
88 Ga0068871_100073743 3300006358 Bacteria 2814
89 Ga0075430_100046800 3300006846 Bacteria 3653
90 Ga0068865_100015466 3300006881 Bacteria 4867
91 Ga0068865_100198418 3300006881 Bacteria 1556
92 Ga0097620_100058478 3300006931 Bacteria 3884
93 Ga0079104_1000882 3300006946 Bacteria 24635
94 Ga0079104_1001818 3300006946 Bacteria 13151
95 Ga0079104_1002035 3300006946 Bacteria 11766
96 Ga0079104_1002480 3300006946 Bacteria 9885
97 Ga0079104_1002590 3300006946 Bacteria 9498
98 Ga0079104_1003177 3300006946 Bacteria 7953
99 Ga0079104_1003908 3300006946 Bacteria 6658
100 Ga0079104_1004351 3300006946 Bacteria 6109
101 Ga0079104_1043133 3300006946 Bacteria 1040
102 Ga0079104_1058442 3300006946 Bacteria 837
103 Ga0105251_10014579 3300009011 Bacteria 4335
104 Ga0105251_10014635 3300009011 Bacteria 4325
105 Ga0105251_10016687 3300009011 Bacteria 3959
106 Ga0105251_10043971 3300009011 Bacteria 2160
107 Ga0105244_10000036 3300009036 Bacteria 166889
108 Ga0105244_10003383 3300009036 Bacteria 11412
109 Ga0105244_10004353 3300009036 Bacteria 9769
110 Ga0105244_10004450 3300009036 Bacteria 9628
111 Ga0105244_10033391 3300009036 Bacteria 2713
112 Ga0105244_10049998 3300009036 Bacteria 2133
113 Ga0105244_10065619 3300009036 Bacteria 1818
114 Ga0105250_10000451 3300009092 Bacteria 29579
115 Ga0105250_10002326 3300009092 Bacteria 9629
116 Ga0105250_10017868 3300009092 Bacteria 2879
117 Ga0105250_10030028 3300009092 Bacteria 2186
118 Ga0105250_10037152 3300009092 Bacteria 1954
119 Ga0105240_10015747 3300009093 Bacteria 10261
120 Ga0111539_10032114 3300009094 Bacteria 6378
121 Ga0111539_10103705 3300009094 Bacteria 3337
122 Ga0105247_10453317 3300009101 Bacteria 925
123 Ga0105243_10000220 3300009148 Bacteria 66484
124 Ga0105243_10480642 3300009148 Bacteria 1172
125 Ga0105241_10000030 3300009174 Bacteria 123241
126 Ga0105249_10104287 3300009553 Bacteria 2672
127 Ga0105249_10707136 3300009553 Bacteria 1068
128 Ga0105246_10026082 3300011119 Bacteria 3813
129 Ga0157373_10001500 3300013100 Bacteria 17806
130 Ga0157370_10822670 3300013104 Bacteria 845
131 Ga0157374_10298193 3300013296 Bacteria 1594
132 Ga0163162_10086236 3300013306 Bacteria 3217
133 Ga0157372_10048090 3300013307 Bacteria 4741
134 Ga0157375_10013879 3300013308 Bacteria 7183
135 Ga0163163_10287629 3300014325 Bacteria 1696
136 Ga0157380_10012001 3300014326 Bacteria 6270
137 Ga0157380_10069002 3300014326 Bacteria 2851
138 Ga0157380_10105470 3300014326 Bacteria 2356
139 Ga0182008_10002484 3300014497 Bacteria 11525
140 Ga0157377_10461257 3300014745 Bacteria 879
141 Ga0157379_10091048 3300014968 Bacteria 2736
142 Ga0182006_1000009 3300015261 Bacteria 438243
143 Ga0183366_1004 3300015679 Bacteria 252597
144 Ga0183370_1004 3300015680 Bacteria 252597
145 Ga0183369_1010 3300015685 Bacteria 252581
146 Ga0183368_1008 3300015687 Bacteria 252581
147 Ga0163161_10095946 3300017792 Bacteria 2200
148 Ga0163161_10542232 3300017792 Bacteria 952
149 Ga0206356_10837035 3300020070 Bacteria 2972
150 Ga0213874_10000277 3300021377 Bacteria 9962
151 Ga0207656_10064528 3300025321 Bacteria 1614
152 Ga0207696_1000092 3300025711 Bacteria 185473
153 Ga0207696_1000320 3300025711 Bacteria 51662
154 Ga0207696_1000508 3300025711 Bacteria 32470
155 Ga0207696_1005866 3300025711 Bacteria 5038
156 Ga0207696_1006562 3300025711 Bacteria 4673
157 Ga0207655_1000067 3300025728 Bacteria 245484
158 Ga0207655_1000099 3300025728 Bacteria 188494
159 Ga0207655_1000122 3300025728 Bacteria 154848
160 Ga0207655_1000163 3300025728 Bacteria 122624
161 Ga0207655_1002735 3300025728 Bacteria 13769
162 Ga0207655_1012813 3300025728 Bacteria 4860
163 Ga0207655_1020757 3300025728 Bacteria 3362
164 Ga0207655_1046284 3300025728 Bacteria 1808
165 Ga0207713_1000017 3300025735 Bacteria 394495
166 Ga0207713_1000091 3300025735 Bacteria 148429
167 Ga0207713_1000096 3300025735 Bacteria 145460
168 Ga0207713_1000121 3300025735 Bacteria 123284
169 Ga0207713_1001868 3300025735 Bacteria 16018
170 Ga0207713_1003980 3300025735 Bacteria 9788
171 Ga0207713_1008901 3300025735 Bacteria 5717
172 Ga0207713_1027917 3300025735 Bacteria 2553
173 Ga0207713_1034089 3300025735 Bacteria 2215
174 Ga0207713_1036935 3300025735 Bacteria 2089
175 Ga0207713_1040045 3300025735 Bacteria 1970
176 Ga0207682_10001767 3300025893 Bacteria 9913
177 Ga0207682_10001984 3300025893 Bacteria 9267
178 Ga0207692_10039260 3300025898 Bacteria 2328
179 Ga0207688_10303135 3300025901 Bacteria 977
180 Ga0207699_10118281 3300025906 Bacteria 1709
181 Ga0207645_10032364 3300025907 Bacteria 3361
182 Ga0207643_10003782 3300025908 Bacteria 8136
183 Ga0207643_10108188 3300025908 Bacteria 1635
184 Ga0207654_10000030 3300025911 Bacteria 123413
185 Ga0207707_10002066 3300025912 Bacteria 18217
186 Ga0207707_10005125 3300025912 Bacteria 11488
187 Ga0207695_10005991 3300025913 Bacteria 15899
188 Ga0207663_10441221 3300025916 Bacteria 1003
189 Ga0207660_10051853 3300025917 Bacteria 2918
190 Ga0207660_10301631 3300025917 Bacteria 1275
191 Ga0207657_10202037 3300025919 Bacteria 1598
192 Ga0207652_10009790 3300025921 Bacteria 7715
193 Ga0207652_10033543 3300025921 Bacteria 4323
194 Ga0207652_10300790 3300025921 Bacteria 1448
195 Ga0207652_10456678 3300025921 Bacteria 1151
196 Ga0207694_10082288 3300025924 Bacteria 2530
197 Ga0207694_10263672 3300025924 Bacteria 1412
198 Ga0207659_10023981 3300025926 Bacteria 4081
199 Ga0207659_10047402 3300025926 Bacteria 3039
200 Ga0207659_10112446 3300025926 Bacteria 2072
201 Ga0207659_10271399 3300025926 Bacteria 1384
202 Ga0207664_10004867 3300025929 Bacteria 9127
203 Ga0207664_10403089 3300025929 Bacteria 1217
204 Ga0207644_10314559 3300025931 Bacteria 1265
205 Ga0207644_10444254 3300025931 Bacteria 1065
206 Ga0207690_10112105 3300025932 Bacteria 1966
207 Ga0207706_10103055 3300025933 Bacteria 2510
208 Ga0207686_10075633 3300025934 Bacteria 2181
209 Ga0207686_10534889 3300025934 Bacteria 914
210 Ga0207709_10000437 3300025935 Bacteria 39389
211 Ga0207709_10168842 3300025935 Bacteria 1533
212 Ga0207709_10317054 3300025935 Bacteria 1165
213 Ga0207670_10183296 3300025936 Unclassified 1578
214 Ga0207670_10193917 3300025936 Bacteria 1539
215 Ga0207669_10010270 3300025937 Bacteria 4501
216 Ga0207704_10006026 3300025938 Bacteria 5620
217 Ga0207704_10025861 3300025938 Bacteria 3210
218 Ga0207704_10207568 3300025938 Bacteria 1439
219 Ga0207691_10005134 3300025940 Bacteria 12638
220 Ga0207691_10012709 3300025940 Bacteria 8063
221 Ga0207691_10191116 3300025940 Unclassified 1785
222 Ga0207689_10090015 3300025942 Bacteria 2521
223 Ga0207689_10398763 3300025942 Bacteria 1147
224 Ga0207667_10004278 3300025949 Bacteria 17502
225 Ga0207651_10107572 3300025960 Bacteria 2085
226 Ga0207668_10208311 3300025972 Bacteria 1562
227 Ga0207640_10013232 3300025981 Bacteria 4724
228 Ga0207658_10283501 3300025986 Bacteria 1421
229 Ga0207658_10647019 3300025986 Bacteria 953
230 Ga0207678_10131861 3300026067 Bacteria 2132
231 Ga0207708_10080830 3300026075 Bacteria 2498
232 Ga0207708_10090214 3300026075 Bacteria 2362
233 Ga0207708_10219715 3300026075 Bacteria 1522
234 Ga0207702_10021769 3300026078 Bacteria 5309
235 Ga0207702_10357458 3300026078 Bacteria 1399
236 Ga0207641_10106855 3300026088 Bacteria 2474
237 Ga0207641_10831902 3300026088 Bacteria 914
238 Ga0207648_10025905 3300026089 Bacteria 5217
239 Ga0207648_10161538 3300026089 Bacteria 1979
240 Ga0207674_10000031 3300026116 Bacteria 145683
241 Ga0207675_100139534 3300026118 Bacteria 2302
242 Ga0207683_10224638 3300026121 Bacteria 1712
243 Ga0207683_10347973 3300026121 Bacteria 1360
244 Ga0209281_1000031 3300027111 Bacteria 422772
245 Ga0209281_1000086 3300027111 Bacteria 250986
246 Ga0209281_1000117 3300027111 Bacteria 209272
247 Ga0209281_1000224 3300027111 Bacteria 120450
248 Ga0209281_1000460 3300027111 Bacteria 57232
249 Ga0209281_1000574 3300027111 Bacteria 43559
250 Ga0209281_1000812 3300027111 Bacteria 28441
251 Ga0209281_1002765 3300027111 Bacteria 6528
252 Ga0209281_1002782 3300027111 Bacteria 6469
253 Ga0209281_1003638 3300027111 Bacteria 4974
254 Ga0209281_1018996 3300027111 Bacteria 1364
255 Ga0209281_1036406 3300027111 Bacteria 851
256 Ga0209973_1001152 3300027252 Bacteria 2230
257 Ga0209371_1000029 3300027312 Bacteria 424797
258 Ga0209371_1000042 3300027312 Bacteria 333147
259 Ga0209371_1000880 3300027312 Bacteria 24050
260 Ga0209371_1000936 3300027312 Bacteria 22836
261 Ga0209371_1004641 3300027312 Bacteria 5865
262 Ga0209371_1005918 3300027312 Bacteria 4697
263 Ga0209969_1001372 3300027360 Bacteria 3344
264 Ga0209981_1001533 3300027378 Bacteria 2924
265 Ga0209981_1004894 3300027378 Bacteria 1771
266 Ga0209996_1001907 3300027395 Bacteria 2565
267 Ga0209984_1018402 3300027424 Bacteria 944
268 Ga0210000_1008463 3300027462 Bacteria 1509
269 Ga0209995_1000809 3300027471 Bacteria 4817
270 Ga0209995_1004863 3300027471 Bacteria 2156
271 Ga0209968_1006079 3300027526 Bacteria 1818
272 Ga0209968_1012272 3300027526 Bacteria 1334
273 Ga0209999_1000302 3300027543 Bacteria 7296
274 Ga0210002_1017522 3300027617 Bacteria 1140
275 Ga0209983_1001074 3300027665 Bacteria 6026
276 Ga0209983_1009349 3300027665 Bacteria 2004
277 Ga0209971_1001633 3300027682 Bacteria 5548
278 Ga0209974_10006699 3300027876 Bacteria 4002
279 Ga0268266_10008668 3300028379 Bacteria 9025
280 Ga0268266_10021450 3300028379 Bacteria 5502
281 Ga0268266_10204937 3300028379 Bacteria 1807
282 Ga0268266_10258226 3300028379 Unclassified 1614
283 Ga0268265_10669251 3300028380 Bacteria 1000
284 Ga0265336_10017304 3300028666 Bacteria 2348
285 Ga0307515_10302469 3300028794 Bacteria 1283
286 Ga0265338_10523465 3300028800 Bacteria 833
287 Ga0268256_1000032 3300030500 Bacteria 424603
288 Ga0268256_1000042 3300030500 Bacteria 333815
289 Ga0268256_1000738 3300030500 Bacteria 24052
290 Ga0268256_1000835 3300030500 Bacteria 21884
291 Ga0268256_1004394 3300030500 Bacteria 5865
292 Ga0268256_1011746 3300030500 Bacteria 2750
293 Ga0268256_1016697 3300030500 Bacteria 2093
294 Ga0265320_10015426 3300031240 Bacteria 4319
295 Ga0265339_10010319 3300031249 Bacteria 5809
296 Ga0265327_10011967 3300031251 Bacteria 5912
297 Ga0307513_10044622 3300031456 Bacteria 4854
298 Ga0307513_10044801 3300031456 Bacteria 4842
299 Ga0307408_100010721 3300031548 Bacteria 6046
300 Ga0316575_10007625 3300031665 Bacteria 3921
301 Ga0316579_10035189 3300031691 Bacteria 2307
302 Ga0265314_10065532 3300031711 Bacteria 2453
303 Ga0265342_10000696 3300031712 Bacteria 35259
304 Ga0316576_10090755 3300031727 Bacteria 2276
305 Ga0316578_10044762 3300031728 Bacteria 2575
306 Ga0307405_10030713 3300031731 Bacteria 3153
307 Ga0316577_10003153 3300031733 Bacteria 8288
308 Ga0307413_10007466 3300031824 Bacteria 5079
309 Ga0307413_10032660 3300031824 Bacteria 2953
310 Ga0307410_10006243 3300031852 Bacteria 6415
311 Ga0307410_10008901 3300031852 Bacteria 5600
312 Ga0307406_10022637 3300031901 Bacteria 3730
313 Ga0307406_10053459 3300031901 Bacteria 2572
314 Ga0307407_10000131 3300031903 Bacteria 23037
315 Ga0307407_10381397 3300031903 Bacteria 1006
316 Ga0307412_10039432 3300031911 Bacteria 3049
317 Ga0307409_100010626 3300031995 Bacteria 5739
318 Ga0307409_100024364 3300031995 Bacteria 4219
319 Ga0307414_10030421 3300032004 Bacteria 3527
320 Ga0307411_10002887 3300032005 Bacteria 7774
321 Ga0307411_10020421 3300032005 Bacteria 3852
322 Ga0307411_10351239 3300032005 Bacteria 1202
323 Ga0307415_100026620 3300032126 Bacteria 3651
324 Ga0307415_100287655 3300032126 Bacteria 1355
325 Ga0316583_10006794 3300032133 Bacteria 4122
326 Ga0316585_10000617 3300032137 Bacteria 8737
327 Ga0316580_10015626 3300032139 Bacteria 2323
328 Ga0373958_0005295 3300034819 Bacteria 1954
329 Ga0373956_0102319 3300035119 Bacteria 1329
330 Ga0373955_0099047 3300035172 Bacteria 1671
331 Ga0373955_0129676 3300035172 Bacteria 1471
332 Ga0316574_0318923 3300035398 Bacteria 987
333 Ga0373933_0056658 3300035724 Bacteria 2353
334 Ga0373933_0223785 3300035724 Bacteria 1208
335 Ga0373937_0008650 3300036401 Bacteria 8845
336 Ga0373937_0106455 3300036401 Bacteria 2607
337 Ga0316584_0040506 3300036712 Bacteria 3471
338 Ga0316584_0371849 3300036712 Bacteria 1023
339 Ga0395899_0008877 3300037312 Bacteria 7738
340 Ga0436361_0535557 3300039447 Bacteria 1976
341 Ga0436363_1081135 3300039450 Bacteria 19222
342 Ga0439438_000288 3300041405 Bacteria 22527
343 Ga0439438_007478 3300041405 Bacteria 3729
344 Ga0451789_0916808 3300041443 Bacteria 2729
345 Ga0451793_0356174 3300041452 Bacteria 3075
346 Ga0451797_0026023 3300041453 Bacteria 1594
347 Ga0451798_0965004 3300041458 Bacteria 1438
348 Ga0451802_1527626 3300041460 Bacteria 1597
349 Ga0451807_0103718 3300041486 Bacteria 2860
350 Ga0451807_1825775 3300041486 Bacteria 1882
351 Ga0451807_1920178 3300041486 Bacteria 1501
352 Ga0451833_0094144 3300041491 Bacteria 2344
353 Ga0439432_016755 3300042006 Bacteria 2464
354 Ga0439432_159450 3300042006 Bacteria 660
355 Ga0439452_000010 3300042010 Bacteria 459139
356 Ga0439452_000560 3300042010 Bacteria 19574
357 Ga0439452_000663 3300042010 Bacteria 17026
358 Ga0439460_0088288 3300042461 Bacteria 982
359 Ga0451577_0000385 3300042876 Bacteria 82015
360 Ga0466981_0000015 3300044669 Bacteria 106046
361 Ga0466961_0171132 3300044693 Bacteria 1351
362 Ga0453684_0418278 3300044712 Bacteria 1498
363 Ga0451576_0122338 3300045051 Bacteria 2710
364 Ga0495591_000110 3300046458 Bacteria 94012
365 Ga0495591_037716 3300046458 Bacteria 1397
366 Ga0495638_0008604 3300046460 Bacteria 7223
367 Ga0495651_0399744 3300046462 Bacteria 897
368 Ga0495653_0097958 3300046463 Bacteria 2130
369 Ga0495616_0071087 3300046513 Bacteria 1683
370 Ga0495620_0015458 3300046515 Bacteria 3852
371 Ga0495654_0075228 3300046530 Bacteria 1593
372 Ga0495654_0262592 3300046530 Bacteria 715
373 Ga0495597_0000974 3300046542 Bacteria 22111
374 Ga0495656_0021659 3300046615 Bacteria 2505
375 Ga0495657_0240379 3300046675 Bacteria 1093
376 Ga0495658_0472991 3300046683 Bacteria 801
377 Ga0495649_0079842 3300046694 Bacteria 1749
378 Ga0495649_0114760 3300046694 Bacteria 1426
379 Ga0495589_0000041 3300046794 Bacteria 140490
380 Ga0495672_0000740 3300047320 Bacteria 35756
381 Ga0495679_000283 3300047446 Bacteria 41984
382 Ga0495679_000681 3300047446 Bacteria 22280
383 Ga0495673_0000128 3300047469 Bacteria 139672
384 Ga0495681_0024178 3300047470 Bacteria 3208
385 Ga0495681_0112143 3300047470 Bacteria 1180
386 Ga0495681_0199653 3300047470 Bacteria 812
387 Ga0496101_0094162 3300048904 Bacteria 2232
388 Ga0496101_0095572 3300048904 Bacteria 2217
389 Ga0496101_0116704 3300048904 Bacteria 2014
390 Ga0496102_0074680 3300048905 Bacteria 3117
391 Ga0496104_0085647 3300048907 Bacteria 3008
392 Ga0496104_0212127 3300048907 Bacteria 1848
393 Ga0496107_0659605 3300048910 Bacteria 771
394 Ga0496112_0274337 3300048915 Bacteria 1634
395 Ga0496113_0291164 3300048916 Bacteria 1306
396 Ga0496114_0002583 3300048917 Bacteria 13831
397 Ga0496114_0028612 3300048917 Bacteria 4575
398 Ga0496115_0124052 3300048918 Bacteria 2127
399 Ga0496115_0133707 3300048918 Bacteria 2045
400 Ga0496116_0042975 3300048919 Bacteria 3082
401 Ga0496117_0009518 3300048920 Bacteria 9024
402 Ga0496117_0077566 3300048920 Bacteria 2198
403 Ga0496117_0080456 3300048920 Bacteria 2142
404 Ga0496117_0085434 3300048920 Bacteria 2054
405 Ga0496117_0087712 3300048920 Bacteria 2015
406 Ga0496117_0221847 3300048920 Bacteria 1051
407 Ga0496118_0036585 3300048921 Bacteria 3965
408 Ga0496118_0234856 3300048921 Bacteria 1054
409 Ga0496119_0005944 3300048922 Bacteria 11483
410 Ga0496119_0029599 3300048922 Bacteria 3709
411 Ga0496119_0045043 3300048922 Bacteria 2770
412 Ga0496119_0069692 3300048922 Bacteria 2065
413 Ga0496120_0004383 3300048923 Bacteria 11880
414 Ga0496120_0006134 3300048923 Bacteria 9321
415 Ga0496120_0007109 3300048923 Bacteria 8396
416 Ga0496120_0030515 3300048923 Bacteria 3275
417 Ga0496120_0059585 3300048923 Bacteria 2139
418 Ga0496120_0166618 3300048923 Bacteria 1093
419 Ga0496121_0009313 3300048924 Bacteria 11327
420 Ga0496121_0014905 3300048924 Bacteria 8191
421 Ga0496121_0026183 3300048924 Bacteria 5506
422 Ga0496121_0315069 3300048924 Bacteria 1055
423 Ga0496122_0000104 3300048925 Bacteria 195617
424 Ga0496122_0023360 3300048925 Bacteria 5453
425 Ga0496122_0041894 3300048925 Bacteria 3611
426 Ga0496123_0000060 3300048926 Bacteria 224015
427 Ga0496123_0007969 3300048926 Bacteria 9822
428 Ga0496123_0012766 3300048926 Bacteria 7123
429 Ga0496124_0001029 3300048927 Bacteria 44134
430 Ga0496124_0109936 3300048927 Bacteria 2220
431 Ga0496124_0231629 3300048927 Bacteria 1381
432 Ga0496124_0275203 3300048927 Bacteria 1230
433 Ga0496125_0000377 3300048928 Bacteria 83509
434 Ga0496125_0013646 3300048928 Bacteria 7974
435 Ga0496125_0040214 3300048928 Bacteria 4013
436 Ga0496125_0429873 3300048928 Bacteria 762
437 Ga0496126_0011219 3300048929 Bacteria 9296
438 Ga0496126_0013399 3300048929 Bacteria 8342
439 Ga0501034_0099365 3300049571 Bacteria 2905
440 Ga0501039_0356391 3300049575 Bacteria 1149
441 Ga0501041_0274926 3300049577 Bacteria 1060
442 Ga0501042_0199918 3300049578 Bacteria 1441
443 Ga0501042_0200024 3300049578 Bacteria 1441
444 Ga0501042_0580750 3300049578 Bacteria 815
445 Ga0501067_0007171 3300049583 Bacteria 6193
446 Ga0501067_0088113 3300049583 Bacteria 1722
447 Ga0501068_0004726 3300049584 Bacteria 7405
448 Ga0501068_0123248 3300049584 Bacteria 1617
449 Ga0501069_0062357 3300049585 Bacteria 2082
450 Ga0501070_0065829 3300049586 Bacteria 3001
451 Ga0501071_0004322 3300049587 Bacteria 9009
452 Ga0501072_0180657 3300049588 Bacteria 1683
453 Ga0501072_0410204 3300049588 Bacteria 1074
454 Ga0501073_0024295 3300049589 Bacteria 4351
455 Ga0501074_0016435 3300049590 Bacteria 5373
456 Ga0501076_0038907 3300049592 Bacteria 3733
457 Ga0501076_0439537 3300049592 Bacteria 1074
458 Ga0501077_0001753 3300049593 Bacteria 13077
459 Ga0501209_001702 3300049656 Bacteria 3181
460 Ga0501079_0000277 3300049741 Bacteria 31633
461 Ga0501080_0011608 3300049742 Bacteria 8067
462 Ga0501080_0044298 3300049742 Bacteria 4142
463 Ga0501083_0012407 3300049744 Bacteria 5964
464 nmdc:mga08y16_34873_c1 3300050511 Bacteria 5286
465 Ga0500616_0002995 3300053153 Bacteria 13353
466 Ga0501084_0096930 3300054114 Bacteria 2476
467 Ga0501082_0019428 3300060353 Bacteria 5857
468 2508854856 2508501071 Bacteria 5454741
469 2547696863 2547132181 Bacteria 4945084
470 2548652672 2547132416 Bacteria 4633861
471 2555260684 2554235234 Bacteria 5762085
472 2562465040 2561511199 Bacteria 5155034
473 2599411604 2599185169 Bacteria 5441380
474 2601524723 2600255254 Bacteria 5281859
475 2601529877 2600255255 Bacteria 5282785
476 2601535799 2600255256 Bacteria 5597742
477 2601540567 2600255257 Bacteria 5597196
478 2601616711 2600255280 Bacteria 5292309
479 2601621433 2600255281 Bacteria 5288753
480 2601645283 2600255287 Bacteria 5210468
481 2601649830 2600255288 Bacteria 5282738
482 2601654757 2600255289 Bacteria 5281907
483 2601659969 2600255290 Bacteria 5282218
484 2601664525 2600255291 Bacteria 5217298
485 2601697943 2600255298 Bacteria 5215185
486 2601702311 2600255299 Bacteria 5218662
487 2601707501 2600255300 Bacteria 5287774
488 2601712522 2600255301 Bacteria 5280532
489 2601718018 2600255302 Bacteria 5288235
490 2601722814 2600255303 Bacteria 5219315
491 2601727946 2600255304 Bacteria 5283973
492 2601732963 2600255305 Bacteria 5282329
493 2601737268 2600255306 Bacteria 5281613
494 2601741687 2600255307 Bacteria 5439064
495 2601752586 2600255309 Bacteria 5431045
496 2601759192 2600255310 Bacteria 5600903
497 2601765094 2600255311 Bacteria 5598766
498 2602019842 2600255392 Bacteria 5437392
499 2603640094 2602042046 Bacteria 5483348
500 2603645786 2602042047 Bacteria 4697674
501 2603662690 2602042052 Bacteria 5215873
502 2603667586 2602042053 Bacteria 5214361
503 2603701518 2602042066 Bacteria 4423871
504 2603706242 2602042067 Bacteria 4863713
505 2603840373 2602042103 Bacteria 5284714
506 2603845449 2602042104 Bacteria 5281639
507 2603850523 2602042105 Bacteria 5282303
508 2603855590 2602042106 Bacteria 5282744
509 2603868153 2602042109 Bacteria 5152801
510 2603872961 2602042110 Bacteria 5283285
511 2603878396 2602042111 Bacteria 5212080
512 2606050352 2603880178 Bacteria 5283018
513 2606072013 2603880184 Bacteria 5217896
514 2606148034 2603880202 Bacteria 5284684
515 2606178031 2603880211 Bacteria 5284226
516 2637222742 2636415599 Bacteria 5718434
517 2671104888 2667528172 Bacteria 5170840
518 2671588817 2671180115 Bacteria 5353919
519 2676408990 2675903046 Bacteria 5451247
520 2681994663 2681812866 Bacteria 4552357
521 2682009437 2681812869 Bacteria 5014465
522 2707101540 2706794495 Bacteria 4536932
523 2753854000 2751185917 Bacteria 4551186
524 2765586887 2765235842 Bacteria 4799256
525 2772441387 2772190666 Bacteria 5117644
526 2777021085 2775507074 Bacteria 5532402
527 2791922780 2791354903 Bacteria 4937680
528 2792310988 2791355010 Bacteria 4864581
529 2793403445 2791355275 Bacteria 4429597
530 2807179114 2806310673 Bacteria 4801221
531 2814693715 2814123068 Bacteria 5687681
532 2821122007 2821118458 Bacteria 4714306
533 2823377879 2823373977 Bacteria 4779415
534 2844425605 2844425489 Bacteria 4854065
535 2846544868 2846540461 Bacteria 5471451
536 2852104213 2852103415 Bacteria 5193810
537 2884086618 2884086401 Bacteria 5005459
538 2888371523 2888366609 Bacteria 5155009
539 2888375845 2888373701 Bacteria 5098052
540 2891672061 2891670763 Bacteria 4967099
541 2904516484 2904513164 Bacteria 5476410
542 2919112428 2919108558 Bacteria 5897419
543 2927836166 2927833300 Bacteria 4923934
544 2932409570 2932406140 Bacteria 5134491
545 2937544316 2937539931 Bacteria 4639830
546 2937972222 2937967321 Bacteria 5094075
547 2939571994 2939568625 Bacteria 4542555
548 2939576941 2939573065 Bacteria 4926053
549 2939580674 2939577877 Bacteria 5132791
550 2939611359 2939607340 Bacteria 4719256
551 2939646308 2939642701 Bacteria 4475280
552 2969079769 2969079654 Bacteria 5439582
553 2971821090 2971820967 Bacteria 5823634
554 2974314240 2974310843 Bacteria 4947816
555 2984562208 2984559226 Bacteria 5683096
556 2984600270 2984595703 Bacteria 5682994
557 3000376789 3000376612 Bacteria 4705565
558 640940419 640753048 Bacteria 5495657
559 8004593293 8004592986 Bacteria 5122074
560 8015395063 8015394850 Bacteria 5064660
561 8018222525 8018221730 Bacteria 4616064
562 8018406303 8018405270 Bacteria 4978981
563 8054844902 8054844752 Bacteria 4450330
564 8054849859 8054849141 Bacteria 5232694
565 8055091877 8055087960 Bacteria 4784273
566 8055097323 8055092621 Bacteria 4873875
567 8055097535 8055097453 Bacteria 4865496
568 8057307830 8057304971 Bacteria 4649742
569 Ga0070668_100523957
570 SwRhRL2b_contig_138772
571 SwRhRL2b_contig_1625696
572 JGI25406J46586_10008309
573 rootH2_10109502
574 Ga0065704_10001283
575 Ga0065704_10012633
576 Ga0065704_10075026
577 Ga0070658_10105779
578 Ga0070683_100189701
579 Ga0068869_100505600
580 Ga0068869_100910467
581 Ga0070682_100039357
582 Ga0070682_100074768
583 Ga0070689_100003519
584 Ga0070689_100181862
585 Ga0070675_100082050
586 Ga0070675_100198100
587 Ga0070674_100016438
588 Ga0070674_100036337
589 Ga0070674_100076188
590 Ga0070673_100043782
591 Ga0070673_100103506
592 Ga0070688_100070540
593 Ga0070688_100301355
594 Ga0070659_100145185
595 Ga0070667_100328813
596 Ga0070709_10011208
597 Ga0070709_10053297
598 Ga0070709_10370140
599 Ga0070714_100003407
600 Ga0070713_100038259
601 Ga0070710_10048425
602 Ga0070710_10074426
603 Ga0070705_100421206
604 Ga0070700_100058918
605 Ga0070694_100462604
606 Ga0070678_100162233
607 Ga0070678_100184247
608 Ga0070681_10006040
609 Ga0070681_10372730
610 Ga0068867_100031599
611 Ga0070685_10017897
612 Ga0070679_100108954
613 Ga0070679_100615864
614 Ga0070684_100067734
615 Ga0070672_100034454
616 Ga0070672_100038891
617 Ga0070672_100069426
618 Ga0070672_100191720
619 Ga0070686_100145648
620 Ga0070686_100203412
621 Ga0070696_100442106
622 Ga0070665_100012223
623 Ga0070665_100012353
624 Ga0070665_100237810
625 Ga0070664_100170115
626 Ga0070664_100445025
627 Ga0068857_100000119
628 Ga0068857_100087304
629 Ga0068856_100022706
630 Ga0070702_100327145
631 Ga0068859_100058480
632 Ga0068861_100018605
633 Ga0068861_100026530
634 Ga0068861_100082872
635 Ga0068851_10008063
636 Ga0068870_10012786
637 Ga0068870_10090122
638 Ga0068863_100070361
639 Ga0068863_100100424
640 Ga0068863_100834291
641 Ga0068860_100168512
642 Ga0068862_100095382
643 Ga0068862_100248680
644 Ga0081455_10004966
645 Ga0081539_10000006
646 Ga0070717_10063537
647 Ga0070717_10358494
648 Ga0075364_10017489
649 Ga0070712_100096010
650 Ga0075369_10017052
651 Ga0097621_100016215
652 Ga0097621_100183090
653 Ga0097621_100198169
654 Ga0097621_100236744
655 Ga0097621_101055462
656 Ga0068871_100073743
657 Ga0075430_100046800
658 Ga0068865_100015466
659 Ga0068865_100198418
660 Ga0097620_100058478
661 Ga0079104_1000882
662 Ga0079104_1001818
663 Ga0079104_1002035
664 Ga0079104_1002480
665 Ga0079104_1002590
666 Ga0079104_1003177
667 Ga0079104_1003908
668 Ga0079104_1004351
669 Ga0079104_1043133
670 Ga0079104_1058442
671 Ga0105251_10014579
672 Ga0105251_10014635
673 Ga0105251_10016687
674 Ga0105251_10043971
675 Ga0105244_10000036
676 Ga0105244_10003383
677 Ga0105244_10004353
678 Ga0105244_10004450
679 Ga0105244_10033391
680 Ga0105244_10049998
681 Ga0105244_10065619
682 Ga0105250_10000451
683 Ga0105250_10002326
684 Ga0105250_10017868
685 Ga0105250_10030028
686 Ga0105250_10037152
687 Ga0105240_10015747
688 Ga0111539_10032114
689 Ga0111539_10103705
690 Ga0105247_10453317
691 Ga0105243_10000220
692 Ga0105243_10480642
693 Ga0105241_10000030
694 Ga0105249_10104287
695 Ga0105249_10707136
696 Ga0105246_10026082
697 Ga0157373_10001500
698 Ga0157370_10822670
699 Ga0157374_10298193
700 Ga0163162_10086236
701 Ga0157372_10048090
702 Ga0157375_10013879
703 Ga0163163_10287629
704 Ga0157380_10012001
705 Ga0157380_10069002
706 Ga0157380_10105470
707 Ga0182008_10002484
708 Ga0157377_10461257
709 Ga0157379_10091048
710 Ga0182006_1000009
711 Ga0183366_1004
712 Ga0183370_1004
713 Ga0183369_1010
714 Ga0183368_1008
715 Ga0163161_10095946
716 Ga0163161_10542232
717 Ga0206356_10837035
718 Ga0213874_10000277
719 Ga0207656_10064528
720 Ga0207696_1000092
721 Ga0207696_1000320
722 Ga0207696_1000508
723 Ga0207696_1005866
724 Ga0207696_1006562
725 Ga0207655_1000067
726 Ga0207655_1000099
727 Ga0207655_1000122
728 Ga0207655_1000163
729 Ga0207655_1002735
730 Ga0207655_1012813
731 Ga0207655_1020757
732 Ga0207655_1046284
733 Ga0207713_1000017
734 Ga0207713_1000091
735 Ga0207713_1000096
736 Ga0207713_1000121
737 Ga0207713_1001868
738 Ga0207713_1003980
739 Ga0207713_1008901
740 Ga0207713_1027917
741 Ga0207713_1034089
742 Ga0207713_1036935
743 Ga0207713_1040045
744 Ga0207682_10001767
745 Ga0207682_10001984
746 Ga0207692_10039260
747 Ga0207688_10303135
748 Ga0207699_10118281
749 Ga0207645_10032364
750 Ga0207643_10003782
751 Ga0207643_10108188
752 Ga0207654_10000030
753 Ga0207707_10002066
754 Ga0207707_10005125
755 Ga0207695_10005991
756 Ga0207663_10441221
757 Ga0207660_10051853
758 Ga0207660_10301631
759 Ga0207657_10202037
760 Ga0207652_10009790
761 Ga0207652_10033543
762 Ga0207652_10300790
763 Ga0207652_10456678
764 Ga0207694_10082288
765 Ga0207694_10263672
766 Ga0207659_10023981
767 Ga0207659_10047402
768 Ga0207659_10112446
769 Ga0207659_10271399
770 Ga0207664_10004867
771 Ga0207664_10403089
772 Ga0207644_10314559
773 Ga0207644_10444254
774 Ga0207690_10112105
775 Ga0207706_10103055
776 Ga0207686_10075633
777 Ga0207686_10534889
778 Ga0207709_10000437
779 Ga0207709_10168842
780 Ga0207709_10317054
781 Ga0207670_10183296
782 Ga0207670_10193917
783 Ga0207669_10010270
784 Ga0207704_10006026
785 Ga0207704_10025861
786 Ga0207704_10207568
787 Ga0207691_10005134
788 Ga0207691_10012709
789 Ga0207691_10191116
790 Ga0207689_10090015
791 Ga0207689_10398763
792 Ga0207667_10004278
793 Ga0207651_10107572
794 Ga0207668_10208311
795 Ga0207640_10013232
796 Ga0207658_10283501
797 Ga0207658_10647019
798 Ga0207678_10131861
799 Ga0207708_10080830
800 Ga0207708_10090214
801 Ga0207708_10219715
802 Ga0207702_10021769
803 Ga0207702_10357458
804 Ga0207641_10106855
805 Ga0207641_10831902
806 Ga0207648_10025905
807 Ga0207648_10161538
808 Ga0207674_10000031
809 Ga0207675_100139534
810 Ga0207683_10224638
811 Ga0207683_10347973
812 Ga0209281_1000031
813 Ga0209281_1000086
814 Ga0209281_1000117
815 Ga0209281_1000224
816 Ga0209281_1000460
817 Ga0209281_1000574
818 Ga0209281_1000812
819 Ga0209281_1002765
820 Ga0209281_1002782
821 Ga0209281_1003638
822 Ga0209281_1018996
823 Ga0209281_1036406
824 Ga0209973_1001152
825 Ga0209371_1000029
826 Ga0209371_1000042
827 Ga0209371_1000880
828 Ga0209371_1000936
829 Ga0209371_1004641
830 Ga0209371_1005918
831 Ga0209969_1001372
832 Ga0209981_1001533
833 Ga0209981_1004894
834 Ga0209996_1001907
835 Ga0209984_1018402
836 Ga0210000_1008463
837 Ga0209995_1000809
838 Ga0209995_1004863
839 Ga0209968_1006079
840 Ga0209968_1012272
841 Ga0209999_1000302
842 Ga0210002_1017522
843 Ga0209983_1001074
844 Ga0209983_1009349
845 Ga0209971_1001633
846 Ga0209974_10006699
847 Ga0268266_10008668
848 Ga0268266_10021450
849 Ga0268266_10204937
850 Ga0268266_10258226
851 Ga0268265_10669251
852 Ga0265336_10017304
853 Ga0307515_10302469
854 Ga0265338_10523465
855 Ga0268256_1000032
856 Ga0268256_1000042
857 Ga0268256_1000738
858 Ga0268256_1000835
859 Ga0268256_1004394
860 Ga0268256_1011746
861 Ga0268256_1016697
862 Ga0265320_10015426
863 Ga0265339_10010319
864 Ga0265327_10011967
865 Ga0307513_10044622
866 Ga0307513_10044801
867 Ga0307408_100010721
868 Ga0316575_10007625
869 Ga0316579_10035189
870 Ga0265314_10065532
871 Ga0265342_10000696
872 Ga0316576_10090755
873 Ga0316578_10044762
874 Ga0307405_10030713
875 Ga0316577_10003153
876 Ga0307413_10007466
877 Ga0307413_10032660
878 Ga0307410_10006243
879 Ga0307410_10008901
880 Ga0307406_10022637
881 Ga0307406_10053459
882 Ga0307407_10000131
883 Ga0307407_10381397
884 Ga0307412_10039432
885 Ga0307409_100010626
886 Ga0307409_100024364
887 Ga0307414_10030421
888 Ga0307411_10002887
889 Ga0307411_10020421
890 Ga0307411_10351239
891 Ga0307415_100026620
892 Ga0307415_100287655
893 Ga0316583_10006794
894 Ga0316585_10000617
895 Ga0316580_10015626
896 Ga0373958_0005295
897 Ga0373956_0102319
898 Ga0373955_0099047
899 Ga0373955_0129676
900 Ga0316574_0318923
901 Ga0373933_0056658
902 Ga0373933_0223785
903 Ga0373937_0008650
904 Ga0373937_0106455
905 Ga0316584_0040506
906 Ga0316584_0371849
907 Ga0395899_0008877
908 Ga0436361_0535557
909 Ga0436363_1081135
910 Ga0439438_000288
911 Ga0439438_007478
912 Ga0451789_0916808
913 Ga0451793_0356174
914 Ga0451797_0026023
915 Ga0451798_0965004
916 Ga0451802_1527626
917 Ga0451807_0103718
918 Ga0451807_1825775
919 Ga0451807_1920178
920 Ga0451833_0094144
921 Ga0439432_016755
922 Ga0439432_159450
923 Ga0439452_000010
924 Ga0439452_000560
925 Ga0439452_000663
926 Ga0439460_0088288
927 Ga0451577_0000385
928 Ga0466981_0000015
929 Ga0466961_0171132
930 Ga0453684_0418278
931 Ga0451576_0122338
932 Ga0495591_000110
933 Ga0495591_037716
934 Ga0495638_0008604
935 Ga0495651_0399744
936 Ga0495653_0097958
937 Ga0495616_0071087
938 Ga0495620_0015458
939 Ga0495654_0075228
940 Ga0495654_0262592
941 Ga0495597_0000974
942 Ga0495656_0021659
943 Ga0495657_0240379
944 Ga0495658_0472991
945 Ga0495649_0079842
946 Ga0495649_0114760
947 Ga0495589_0000041
948 Ga0495672_0000740
949 Ga0495679_000283
950 Ga0495679_000681
951 Ga0495673_0000128
952 Ga0495681_0024178
953 Ga0495681_0112143
954 Ga0495681_0199653
955 Ga0496101_0094162
956 Ga0496101_0095572
957 Ga0496101_0116704
958 Ga0496102_0074680
959 Ga0496104_0085647
960 Ga0496104_0212127
961 Ga0496107_0659605
962 Ga0496112_0274337
963 Ga0496113_0291164
964 Ga0496114_0002583
965 Ga0496114_0028612
966 Ga0496115_0124052
967 Ga0496115_0133707
968 Ga0496116_0042975
969 Ga0496117_0009518
970 Ga0496117_0077566
971 Ga0496117_0080456
972 Ga0496117_0085434
973 Ga0496117_0087712
974 Ga0496117_0221847
975 Ga0496118_0036585
976 Ga0496118_0234856
977 Ga0496119_0005944
978 Ga0496119_0029599
979 Ga0496119_0045043
980 Ga0496119_0069692
981 Ga0496120_0004383
982 Ga0496120_0006134
983 Ga0496120_0007109
984 Ga0496120_0030515
985 Ga0496120_0059585
986 Ga0496120_0166618
987 Ga0496121_0009313
988 Ga0496121_0014905
989 Ga0496121_0026183
990 Ga0496121_0315069
991 Ga0496122_0000104
992 Ga0496122_0023360
993 Ga0496122_0041894
994 Ga0496123_0000060
995 Ga0496123_0007969
996 Ga0496123_0012766
997 Ga0496124_0001029
998 Ga0496124_0109936
999 Ga0496124_0231629
1000 Ga0496124_0275203
1001 Ga0496125_0000377
1002 Ga0496125_0013646
1003 Ga0496125_0040214
1004 Ga0496125_0429873
1005 Ga0496126_0011219
1006 Ga0496126_0013399
1007 Ga0501034_0099365
1008 Ga0501039_0356391
1009 Ga0501041_0274926
1010 Ga0501042_0199918
1011 Ga0501042_0200024
1012 Ga0501042_0580750
1013 Ga0501067_0007171
1014 Ga0501067_0088113
1015 Ga0501068_0004726
1016 Ga0501068_0123248
1017 Ga0501069_0062357
1018 Ga0501070_0065829
1019 Ga0501071_0004322
1020 Ga0501072_0180657
1021 Ga0501072_0410204
1022 Ga0501073_0024295
1023 Ga0501074_0016435
1024 Ga0501076_0038907
1025 Ga0501076_0439537
1026 Ga0501077_0001753
1027 Ga0501209_001702
1028 Ga0501079_0000277
1029 Ga0501080_0011608
1030 Ga0501080_0044298
1031 Ga0501083_0012407
1032 nmdc:mga08y16_34873_c1
1033 Ga0500616_0002995
1034 Ga0501084_0096930
1035 Ga0501082_0019428
1036 2508854856
1037 2547696863
1038 2548652672
1039 2555260684
1040 2562465040
1041 2599411604
1042 2601524723
1043 2601529877
1044 2601535799
1045 2601540567
1046 2601616711
1047 2601621433
1048 2601645283
1049 2601649830
1050 2601654757
1051 2601659969
1052 2601664525
1053 2601697943
1054 2601702311
1055 2601707501
1056 2601712522
1057 2601718018
1058 2601722814
1059 2601727946
1060 2601732963
1061 2601737268
1062 2601741687
1063 2601752586
1064 2601759192
1065 2601765094
1066 2602019842
1067 2603640094
1068 2603645786
1069 2603662690
1070 2603667586
1071 2603701518
1072 2603706242
1073 2603840373
1074 2603845449
1075 2603850523
1076 2603855590
1077 2603868153
1078 2603872961
1079 2603878396
1080 2606050352
1081 2606072013
1082 2606148034
1083 2606178031
1084 2637222742
1085 2671104888
1086 2671588817
1087 2676408990
1088 2681994663
1089 2682009437
1090 2707101540
1091 2753854000
1092 2765586887
1093 2772441387
1094 2777021085
1095 2791922780
1096 2792310988
1097 2793403445
1098 2807179114
1099 2814693715
1100 2821122007
1101 2823377879
1102 2844425605
1103 2846544868
1104 2852104213
1105 2884086618
1106 2888371523
1107 2888375845
1108 2891672061
1109 2904516484
1110 2919112428
1111 2927836166
1112 2932409570
1113 2937544316
1114 2937972222
1115 2939571994
1116 2939576941
1117 2939580674
1118 2939611359
1119 2939646308
1120 2969079769
1121 2971821090
1122 2974314240
1123 2984562208
1124 2984600270
1125 3000376789
1126 640940419
1127 8004593293
1128 8015395063
1129 8018222525
1130 8018406303
1131 8054844902
1132 8054849859
1133 8055091877
1134 8055097323
1135 8055097535
1136 8057307830

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

58

209

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9788 1 213
1sto-assembly1.cif.gz_A-2 crystal structure of orotate phosphoribosyltransferase 0.9783 1 213
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9758 1 213
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9741 1 213
1sto-assembly1.cif.gz_A-2 crystal structure of orotate phosphoribosyltransferase 0.9737 1 213
ID Description Score Start End Superfamily
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9709 1 192 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9597 1 192 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9146 7 213 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9061 7 213 3.40.50.2020
4wn3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9038 1 213 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A745CG89-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9977 1 91 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A7B4HVX2-F1-model_v4 deleted 0.9931 1 95
AF-A0A615E2N5-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9925 1 78 GO:0004588
GO:0005737
GO:0006207
GO:0006221
GO:0046132
AF-A0A2D6NU13-F1-model_v4 deleted 0.9917 1 85
AF-A0A0S8EKK5-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9892 1 80 GO:0004588
GO:0005737
GO:0006207
GO:0006221
GO:0046132

Map