F464597
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 359 | 1136 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100523957|Ga0070668_1005239572 |
| Length | 249 |
| Sequence | MPAVRRYHAHRRIIRKTLTVQEYQRTFIDLAMSRTALRFGSFKLKSGRESPYFFNAGLFNDGEAIAVLGQCYAAALTRSGLEFDMLFGPAYKGIPLATTTAVALAEHHHRSVPWAFNRKEAKEHGEGGNIVGAPLRGRVVIIDDVITAGTAIRESVEIIRAAGATPAGVALALDRQERGQGTQSAVQEVSAQFGLRCVSILTLADLIETFAQASGDAVRISREQFVALQSYQREWGIGAVSGGAKAGAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 80 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 81 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 82 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 173 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 174 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 175 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 186 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 193 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 194 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 195 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 196 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 197 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 234 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 260 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 261 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 262 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 263 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 264 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 265 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 266 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 267 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 268 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 269 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 270 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 271 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 272 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 273 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 274 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 275 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 276 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 277 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 278 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 279 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 280 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 281 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 282 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 283 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 284 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 285 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 286 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 287 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 288 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 289 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 290 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 291 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 292 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 293 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 294 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 295 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 296 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 297 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 298 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 299 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 300 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 301 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 302 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 303 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 304 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 305 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 306 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 307 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 308 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 309 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 310 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 311 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 312 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 313 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 314 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 315 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 316 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 317 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 318 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 319 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 320 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 321 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 322 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 323 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 324 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 325 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 326 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 327 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 328 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 329 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 330 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 331 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 332 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 333 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 334 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 335 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 336 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 337 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 338 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 339 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 340 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 341 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 342 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 343 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 344 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 345 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 346 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 347 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 348 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 349 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 350 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 351 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 352 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 353 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 354 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 355 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 356 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 357 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 358 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 359 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.04 |
| Metatranscriptomes | 0.18 |
| Isolates | 17.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 0.7 |
| Nodule | 4.05 |
| Rhizoplane | 12.32 |
| Rhizosphere | 70.77 |
| Stem | 0.18 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100523957 | 3300005347 | Bacteria | 1029 |
| 2 | SwRhRL2b_contig_138772 | 2162886007 | Bacteria | 1560 |
| 3 | SwRhRL2b_contig_1625696 | 2162886007 | Bacteria | 2164 |
| 4 | JGI25406J46586_10008309 | 3300003203 | Bacteria | 4709 |
| 5 | rootH2_10109502 | 3300003320 | Bacteria | 8002 |
| 6 | Ga0065704_10001283 | 3300005289 | Bacteria | 9882 |
| 7 | Ga0065704_10012633 | 3300005289 | Bacteria | 2172 |
| 8 | Ga0065704_10075026 | 3300005289 | Bacteria | 5837 |
| 9 | Ga0070658_10105779 | 3300005327 | Bacteria | 2328 |
| 10 | Ga0070683_100189701 | 3300005329 | Bacteria | 1952 |
| 11 | Ga0068869_100505600 | 3300005334 | Bacteria | 1009 |
| 12 | Ga0068869_100910467 | 3300005334 | Bacteria | 761 |
| 13 | Ga0070682_100039357 | 3300005337 | Bacteria | 2905 |
| 14 | Ga0070682_100074768 | 3300005337 | Bacteria | 2177 |
| 15 | Ga0070689_100003519 | 3300005340 | Bacteria | 10415 |
| 16 | Ga0070689_100181862 | 3300005340 | Unclassified | 1708 |
| 17 | Ga0070675_100082050 | 3300005354 | Bacteria | 2690 |
| 18 | Ga0070675_100198100 | 3300005354 | Bacteria | 1742 |
| 19 | Ga0070674_100016438 | 3300005356 | Bacteria | 4637 |
| 20 | Ga0070674_100036337 | 3300005356 | Bacteria | 3306 |
| 21 | Ga0070674_100076188 | 3300005356 | Bacteria | 2384 |
| 22 | Ga0070673_100043782 | 3300005364 | Bacteria | 3462 |
| 23 | Ga0070673_100103506 | 3300005364 | Bacteria | 2349 |
| 24 | Ga0070688_100070540 | 3300005365 | Bacteria | 2234 |
| 25 | Ga0070688_100301355 | 3300005365 | Bacteria | 1159 |
| 26 | Ga0070659_100145185 | 3300005366 | Bacteria | 1933 |
| 27 | Ga0070667_100328813 | 3300005367 | Bacteria | 1380 |
| 28 | Ga0070709_10011208 | 3300005434 | Bacteria | 4987 |
| 29 | Ga0070709_10053297 | 3300005434 | Bacteria | 2547 |
| 30 | Ga0070709_10370140 | 3300005434 | Bacteria | 1063 |
| 31 | Ga0070714_100003407 | 3300005435 | Bacteria | 11847 |
| 32 | Ga0070713_100038259 | 3300005436 | Bacteria | 3885 |
| 33 | Ga0070710_10048425 | 3300005437 | Bacteria | 2374 |
| 34 | Ga0070710_10074426 | 3300005437 | Bacteria | 1966 |
| 35 | Ga0070705_100421206 | 3300005440 | Bacteria | 994 |
| 36 | Ga0070700_100058918 | 3300005441 | Bacteria | 2415 |
| 37 | Ga0070694_100462604 | 3300005444 | Bacteria | 1003 |
| 38 | Ga0070678_100162233 | 3300005456 | Bacteria | 1812 |
| 39 | Ga0070678_100184247 | 3300005456 | Bacteria | 1712 |
| 40 | Ga0070681_10006040 | 3300005458 | Bacteria | 11739 |
| 41 | Ga0070681_10372730 | 3300005458 | Bacteria | 1338 |
| 42 | Ga0068867_100031599 | 3300005459 | Bacteria | 3824 |
| 43 | Ga0070685_10017897 | 3300005466 | Bacteria | 3803 |
| 44 | Ga0070679_100108954 | 3300005530 | Bacteria | 2756 |
| 45 | Ga0070679_100615864 | 3300005530 | Bacteria | 1029 |
| 46 | Ga0070684_100067734 | 3300005535 | Bacteria | 3137 |
| 47 | Ga0070672_100034454 | 3300005543 | Unclassified | 3842 |
| 48 | Ga0070672_100038891 | 3300005543 | Bacteria | 3639 |
| 49 | Ga0070672_100069426 | 3300005543 | Bacteria | 2797 |
| 50 | Ga0070672_100191720 | 3300005543 | Bacteria | 1707 |
| 51 | Ga0070686_100145648 | 3300005544 | Bacteria | 1654 |
| 52 | Ga0070686_100203412 | 3300005544 | Bacteria | 1421 |
| 53 | Ga0070696_100442106 | 3300005546 | Bacteria | 1025 |
| 54 | Ga0070665_100012223 | 3300005548 | Bacteria | 8655 |
| 55 | Ga0070665_100012353 | 3300005548 | Bacteria | 8606 |
| 56 | Ga0070665_100237810 | 3300005548 | Unclassified | 1822 |
| 57 | Ga0070664_100170115 | 3300005564 | Bacteria | 1933 |
| 58 | Ga0070664_100445025 | 3300005564 | Bacteria | 1189 |
| 59 | Ga0068857_100000119 | 3300005577 | Bacteria | 46982 |
| 60 | Ga0068857_100087304 | 3300005577 | Bacteria | 2790 |
| 61 | Ga0068856_100022706 | 3300005614 | Bacteria | 6100 |
| 62 | Ga0070702_100327145 | 3300005615 | Bacteria | 1070 |
| 63 | Ga0068859_100058480 | 3300005617 | Bacteria | 3884 |
| 64 | Ga0068861_100018605 | 3300005719 | Bacteria | 4950 |
| 65 | Ga0068861_100026530 | 3300005719 | Bacteria | 4212 |
| 66 | Ga0068861_100082872 | 3300005719 | Bacteria | 2515 |
| 67 | Ga0068851_10008063 | 3300005834 | Bacteria | 4861 |
| 68 | Ga0068870_10012786 | 3300005840 | Bacteria | 3931 |
| 69 | Ga0068870_10090122 | 3300005840 | Bacteria | 1713 |
| 70 | Ga0068863_100070361 | 3300005841 | Bacteria | 3309 |
| 71 | Ga0068863_100100424 | 3300005841 | Bacteria | 2750 |
| 72 | Ga0068863_100834291 | 3300005841 | Bacteria | 920 |
| 73 | Ga0068860_100168512 | 3300005843 | Bacteria | 2115 |
| 74 | Ga0068862_100095382 | 3300005844 | Bacteria | 2595 |
| 75 | Ga0068862_100248680 | 3300005844 | Bacteria | 1620 |
| 76 | Ga0081455_10004966 | 3300005937 | Bacteria | 14710 |
| 77 | Ga0081539_10000006 | 3300005985 | Bacteria | 534555 |
| 78 | Ga0070717_10063537 | 3300006028 | Bacteria | 3064 |
| 79 | Ga0070717_10358494 | 3300006028 | Bacteria | 1305 |
| 80 | Ga0075364_10017489 | 3300006051 | Bacteria | 4479 |
| 81 | Ga0070712_100096010 | 3300006175 | Bacteria | 2182 |
| 82 | Ga0075369_10017052 | 3300006186 | Bacteria | 2939 |
| 83 | Ga0097621_100016215 | 3300006237 | Bacteria | 5627 |
| 84 | Ga0097621_100183090 | 3300006237 | Bacteria | 1811 |
| 85 | Ga0097621_100198169 | 3300006237 | Bacteria | 1742 |
| 86 | Ga0097621_100236744 | 3300006237 | Bacteria | 1595 |
| 87 | Ga0097621_101055462 | 3300006237 | Bacteria | 761 |
| 88 | Ga0068871_100073743 | 3300006358 | Bacteria | 2814 |
| 89 | Ga0075430_100046800 | 3300006846 | Bacteria | 3653 |
| 90 | Ga0068865_100015466 | 3300006881 | Bacteria | 4867 |
| 91 | Ga0068865_100198418 | 3300006881 | Bacteria | 1556 |
| 92 | Ga0097620_100058478 | 3300006931 | Bacteria | 3884 |
| 93 | Ga0079104_1000882 | 3300006946 | Bacteria | 24635 |
| 94 | Ga0079104_1001818 | 3300006946 | Bacteria | 13151 |
| 95 | Ga0079104_1002035 | 3300006946 | Bacteria | 11766 |
| 96 | Ga0079104_1002480 | 3300006946 | Bacteria | 9885 |
| 97 | Ga0079104_1002590 | 3300006946 | Bacteria | 9498 |
| 98 | Ga0079104_1003177 | 3300006946 | Bacteria | 7953 |
| 99 | Ga0079104_1003908 | 3300006946 | Bacteria | 6658 |
| 100 | Ga0079104_1004351 | 3300006946 | Bacteria | 6109 |
| 101 | Ga0079104_1043133 | 3300006946 | Bacteria | 1040 |
| 102 | Ga0079104_1058442 | 3300006946 | Bacteria | 837 |
| 103 | Ga0105251_10014579 | 3300009011 | Bacteria | 4335 |
| 104 | Ga0105251_10014635 | 3300009011 | Bacteria | 4325 |
| 105 | Ga0105251_10016687 | 3300009011 | Bacteria | 3959 |
| 106 | Ga0105251_10043971 | 3300009011 | Bacteria | 2160 |
| 107 | Ga0105244_10000036 | 3300009036 | Bacteria | 166889 |
| 108 | Ga0105244_10003383 | 3300009036 | Bacteria | 11412 |
| 109 | Ga0105244_10004353 | 3300009036 | Bacteria | 9769 |
| 110 | Ga0105244_10004450 | 3300009036 | Bacteria | 9628 |
| 111 | Ga0105244_10033391 | 3300009036 | Bacteria | 2713 |
| 112 | Ga0105244_10049998 | 3300009036 | Bacteria | 2133 |
| 113 | Ga0105244_10065619 | 3300009036 | Bacteria | 1818 |
| 114 | Ga0105250_10000451 | 3300009092 | Bacteria | 29579 |
| 115 | Ga0105250_10002326 | 3300009092 | Bacteria | 9629 |
| 116 | Ga0105250_10017868 | 3300009092 | Bacteria | 2879 |
| 117 | Ga0105250_10030028 | 3300009092 | Bacteria | 2186 |
| 118 | Ga0105250_10037152 | 3300009092 | Bacteria | 1954 |
| 119 | Ga0105240_10015747 | 3300009093 | Bacteria | 10261 |
| 120 | Ga0111539_10032114 | 3300009094 | Bacteria | 6378 |
| 121 | Ga0111539_10103705 | 3300009094 | Bacteria | 3337 |
| 122 | Ga0105247_10453317 | 3300009101 | Bacteria | 925 |
| 123 | Ga0105243_10000220 | 3300009148 | Bacteria | 66484 |
| 124 | Ga0105243_10480642 | 3300009148 | Bacteria | 1172 |
| 125 | Ga0105241_10000030 | 3300009174 | Bacteria | 123241 |
| 126 | Ga0105249_10104287 | 3300009553 | Bacteria | 2672 |
| 127 | Ga0105249_10707136 | 3300009553 | Bacteria | 1068 |
| 128 | Ga0105246_10026082 | 3300011119 | Bacteria | 3813 |
| 129 | Ga0157373_10001500 | 3300013100 | Bacteria | 17806 |
| 130 | Ga0157370_10822670 | 3300013104 | Bacteria | 845 |
| 131 | Ga0157374_10298193 | 3300013296 | Bacteria | 1594 |
| 132 | Ga0163162_10086236 | 3300013306 | Bacteria | 3217 |
| 133 | Ga0157372_10048090 | 3300013307 | Bacteria | 4741 |
| 134 | Ga0157375_10013879 | 3300013308 | Bacteria | 7183 |
| 135 | Ga0163163_10287629 | 3300014325 | Bacteria | 1696 |
| 136 | Ga0157380_10012001 | 3300014326 | Bacteria | 6270 |
| 137 | Ga0157380_10069002 | 3300014326 | Bacteria | 2851 |
| 138 | Ga0157380_10105470 | 3300014326 | Bacteria | 2356 |
| 139 | Ga0182008_10002484 | 3300014497 | Bacteria | 11525 |
| 140 | Ga0157377_10461257 | 3300014745 | Bacteria | 879 |
| 141 | Ga0157379_10091048 | 3300014968 | Bacteria | 2736 |
| 142 | Ga0182006_1000009 | 3300015261 | Bacteria | 438243 |
| 143 | Ga0183366_1004 | 3300015679 | Bacteria | 252597 |
| 144 | Ga0183370_1004 | 3300015680 | Bacteria | 252597 |
| 145 | Ga0183369_1010 | 3300015685 | Bacteria | 252581 |
| 146 | Ga0183368_1008 | 3300015687 | Bacteria | 252581 |
| 147 | Ga0163161_10095946 | 3300017792 | Bacteria | 2200 |
| 148 | Ga0163161_10542232 | 3300017792 | Bacteria | 952 |
| 149 | Ga0206356_10837035 | 3300020070 | Bacteria | 2972 |
| 150 | Ga0213874_10000277 | 3300021377 | Bacteria | 9962 |
| 151 | Ga0207656_10064528 | 3300025321 | Bacteria | 1614 |
| 152 | Ga0207696_1000092 | 3300025711 | Bacteria | 185473 |
| 153 | Ga0207696_1000320 | 3300025711 | Bacteria | 51662 |
| 154 | Ga0207696_1000508 | 3300025711 | Bacteria | 32470 |
| 155 | Ga0207696_1005866 | 3300025711 | Bacteria | 5038 |
| 156 | Ga0207696_1006562 | 3300025711 | Bacteria | 4673 |
| 157 | Ga0207655_1000067 | 3300025728 | Bacteria | 245484 |
| 158 | Ga0207655_1000099 | 3300025728 | Bacteria | 188494 |
| 159 | Ga0207655_1000122 | 3300025728 | Bacteria | 154848 |
| 160 | Ga0207655_1000163 | 3300025728 | Bacteria | 122624 |
| 161 | Ga0207655_1002735 | 3300025728 | Bacteria | 13769 |
| 162 | Ga0207655_1012813 | 3300025728 | Bacteria | 4860 |
| 163 | Ga0207655_1020757 | 3300025728 | Bacteria | 3362 |
| 164 | Ga0207655_1046284 | 3300025728 | Bacteria | 1808 |
| 165 | Ga0207713_1000017 | 3300025735 | Bacteria | 394495 |
| 166 | Ga0207713_1000091 | 3300025735 | Bacteria | 148429 |
| 167 | Ga0207713_1000096 | 3300025735 | Bacteria | 145460 |
| 168 | Ga0207713_1000121 | 3300025735 | Bacteria | 123284 |
| 169 | Ga0207713_1001868 | 3300025735 | Bacteria | 16018 |
| 170 | Ga0207713_1003980 | 3300025735 | Bacteria | 9788 |
| 171 | Ga0207713_1008901 | 3300025735 | Bacteria | 5717 |
| 172 | Ga0207713_1027917 | 3300025735 | Bacteria | 2553 |
| 173 | Ga0207713_1034089 | 3300025735 | Bacteria | 2215 |
| 174 | Ga0207713_1036935 | 3300025735 | Bacteria | 2089 |
| 175 | Ga0207713_1040045 | 3300025735 | Bacteria | 1970 |
| 176 | Ga0207682_10001767 | 3300025893 | Bacteria | 9913 |
| 177 | Ga0207682_10001984 | 3300025893 | Bacteria | 9267 |
| 178 | Ga0207692_10039260 | 3300025898 | Bacteria | 2328 |
| 179 | Ga0207688_10303135 | 3300025901 | Bacteria | 977 |
| 180 | Ga0207699_10118281 | 3300025906 | Bacteria | 1709 |
| 181 | Ga0207645_10032364 | 3300025907 | Bacteria | 3361 |
| 182 | Ga0207643_10003782 | 3300025908 | Bacteria | 8136 |
| 183 | Ga0207643_10108188 | 3300025908 | Bacteria | 1635 |
| 184 | Ga0207654_10000030 | 3300025911 | Bacteria | 123413 |
| 185 | Ga0207707_10002066 | 3300025912 | Bacteria | 18217 |
| 186 | Ga0207707_10005125 | 3300025912 | Bacteria | 11488 |
| 187 | Ga0207695_10005991 | 3300025913 | Bacteria | 15899 |
| 188 | Ga0207663_10441221 | 3300025916 | Bacteria | 1003 |
| 189 | Ga0207660_10051853 | 3300025917 | Bacteria | 2918 |
| 190 | Ga0207660_10301631 | 3300025917 | Bacteria | 1275 |
| 191 | Ga0207657_10202037 | 3300025919 | Bacteria | 1598 |
| 192 | Ga0207652_10009790 | 3300025921 | Bacteria | 7715 |
| 193 | Ga0207652_10033543 | 3300025921 | Bacteria | 4323 |
| 194 | Ga0207652_10300790 | 3300025921 | Bacteria | 1448 |
| 195 | Ga0207652_10456678 | 3300025921 | Bacteria | 1151 |
| 196 | Ga0207694_10082288 | 3300025924 | Bacteria | 2530 |
| 197 | Ga0207694_10263672 | 3300025924 | Bacteria | 1412 |
| 198 | Ga0207659_10023981 | 3300025926 | Bacteria | 4081 |
| 199 | Ga0207659_10047402 | 3300025926 | Bacteria | 3039 |
| 200 | Ga0207659_10112446 | 3300025926 | Bacteria | 2072 |
| 201 | Ga0207659_10271399 | 3300025926 | Bacteria | 1384 |
| 202 | Ga0207664_10004867 | 3300025929 | Bacteria | 9127 |
| 203 | Ga0207664_10403089 | 3300025929 | Bacteria | 1217 |
| 204 | Ga0207644_10314559 | 3300025931 | Bacteria | 1265 |
| 205 | Ga0207644_10444254 | 3300025931 | Bacteria | 1065 |
| 206 | Ga0207690_10112105 | 3300025932 | Bacteria | 1966 |
| 207 | Ga0207706_10103055 | 3300025933 | Bacteria | 2510 |
| 208 | Ga0207686_10075633 | 3300025934 | Bacteria | 2181 |
| 209 | Ga0207686_10534889 | 3300025934 | Bacteria | 914 |
| 210 | Ga0207709_10000437 | 3300025935 | Bacteria | 39389 |
| 211 | Ga0207709_10168842 | 3300025935 | Bacteria | 1533 |
| 212 | Ga0207709_10317054 | 3300025935 | Bacteria | 1165 |
| 213 | Ga0207670_10183296 | 3300025936 | Unclassified | 1578 |
| 214 | Ga0207670_10193917 | 3300025936 | Bacteria | 1539 |
| 215 | Ga0207669_10010270 | 3300025937 | Bacteria | 4501 |
| 216 | Ga0207704_10006026 | 3300025938 | Bacteria | 5620 |
| 217 | Ga0207704_10025861 | 3300025938 | Bacteria | 3210 |
| 218 | Ga0207704_10207568 | 3300025938 | Bacteria | 1439 |
| 219 | Ga0207691_10005134 | 3300025940 | Bacteria | 12638 |
| 220 | Ga0207691_10012709 | 3300025940 | Bacteria | 8063 |
| 221 | Ga0207691_10191116 | 3300025940 | Unclassified | 1785 |
| 222 | Ga0207689_10090015 | 3300025942 | Bacteria | 2521 |
| 223 | Ga0207689_10398763 | 3300025942 | Bacteria | 1147 |
| 224 | Ga0207667_10004278 | 3300025949 | Bacteria | 17502 |
| 225 | Ga0207651_10107572 | 3300025960 | Bacteria | 2085 |
| 226 | Ga0207668_10208311 | 3300025972 | Bacteria | 1562 |
| 227 | Ga0207640_10013232 | 3300025981 | Bacteria | 4724 |
| 228 | Ga0207658_10283501 | 3300025986 | Bacteria | 1421 |
| 229 | Ga0207658_10647019 | 3300025986 | Bacteria | 953 |
| 230 | Ga0207678_10131861 | 3300026067 | Bacteria | 2132 |
| 231 | Ga0207708_10080830 | 3300026075 | Bacteria | 2498 |
| 232 | Ga0207708_10090214 | 3300026075 | Bacteria | 2362 |
| 233 | Ga0207708_10219715 | 3300026075 | Bacteria | 1522 |
| 234 | Ga0207702_10021769 | 3300026078 | Bacteria | 5309 |
| 235 | Ga0207702_10357458 | 3300026078 | Bacteria | 1399 |
| 236 | Ga0207641_10106855 | 3300026088 | Bacteria | 2474 |
| 237 | Ga0207641_10831902 | 3300026088 | Bacteria | 914 |
| 238 | Ga0207648_10025905 | 3300026089 | Bacteria | 5217 |
| 239 | Ga0207648_10161538 | 3300026089 | Bacteria | 1979 |
| 240 | Ga0207674_10000031 | 3300026116 | Bacteria | 145683 |
| 241 | Ga0207675_100139534 | 3300026118 | Bacteria | 2302 |
| 242 | Ga0207683_10224638 | 3300026121 | Bacteria | 1712 |
| 243 | Ga0207683_10347973 | 3300026121 | Bacteria | 1360 |
| 244 | Ga0209281_1000031 | 3300027111 | Bacteria | 422772 |
| 245 | Ga0209281_1000086 | 3300027111 | Bacteria | 250986 |
| 246 | Ga0209281_1000117 | 3300027111 | Bacteria | 209272 |
| 247 | Ga0209281_1000224 | 3300027111 | Bacteria | 120450 |
| 248 | Ga0209281_1000460 | 3300027111 | Bacteria | 57232 |
| 249 | Ga0209281_1000574 | 3300027111 | Bacteria | 43559 |
| 250 | Ga0209281_1000812 | 3300027111 | Bacteria | 28441 |
| 251 | Ga0209281_1002765 | 3300027111 | Bacteria | 6528 |
| 252 | Ga0209281_1002782 | 3300027111 | Bacteria | 6469 |
| 253 | Ga0209281_1003638 | 3300027111 | Bacteria | 4974 |
| 254 | Ga0209281_1018996 | 3300027111 | Bacteria | 1364 |
| 255 | Ga0209281_1036406 | 3300027111 | Bacteria | 851 |
| 256 | Ga0209973_1001152 | 3300027252 | Bacteria | 2230 |
| 257 | Ga0209371_1000029 | 3300027312 | Bacteria | 424797 |
| 258 | Ga0209371_1000042 | 3300027312 | Bacteria | 333147 |
| 259 | Ga0209371_1000880 | 3300027312 | Bacteria | 24050 |
| 260 | Ga0209371_1000936 | 3300027312 | Bacteria | 22836 |
| 261 | Ga0209371_1004641 | 3300027312 | Bacteria | 5865 |
| 262 | Ga0209371_1005918 | 3300027312 | Bacteria | 4697 |
| 263 | Ga0209969_1001372 | 3300027360 | Bacteria | 3344 |
| 264 | Ga0209981_1001533 | 3300027378 | Bacteria | 2924 |
| 265 | Ga0209981_1004894 | 3300027378 | Bacteria | 1771 |
| 266 | Ga0209996_1001907 | 3300027395 | Bacteria | 2565 |
| 267 | Ga0209984_1018402 | 3300027424 | Bacteria | 944 |
| 268 | Ga0210000_1008463 | 3300027462 | Bacteria | 1509 |
| 269 | Ga0209995_1000809 | 3300027471 | Bacteria | 4817 |
| 270 | Ga0209995_1004863 | 3300027471 | Bacteria | 2156 |
| 271 | Ga0209968_1006079 | 3300027526 | Bacteria | 1818 |
| 272 | Ga0209968_1012272 | 3300027526 | Bacteria | 1334 |
| 273 | Ga0209999_1000302 | 3300027543 | Bacteria | 7296 |
| 274 | Ga0210002_1017522 | 3300027617 | Bacteria | 1140 |
| 275 | Ga0209983_1001074 | 3300027665 | Bacteria | 6026 |
| 276 | Ga0209983_1009349 | 3300027665 | Bacteria | 2004 |
| 277 | Ga0209971_1001633 | 3300027682 | Bacteria | 5548 |
| 278 | Ga0209974_10006699 | 3300027876 | Bacteria | 4002 |
| 279 | Ga0268266_10008668 | 3300028379 | Bacteria | 9025 |
| 280 | Ga0268266_10021450 | 3300028379 | Bacteria | 5502 |
| 281 | Ga0268266_10204937 | 3300028379 | Bacteria | 1807 |
| 282 | Ga0268266_10258226 | 3300028379 | Unclassified | 1614 |
| 283 | Ga0268265_10669251 | 3300028380 | Bacteria | 1000 |
| 284 | Ga0265336_10017304 | 3300028666 | Bacteria | 2348 |
| 285 | Ga0307515_10302469 | 3300028794 | Bacteria | 1283 |
| 286 | Ga0265338_10523465 | 3300028800 | Bacteria | 833 |
| 287 | Ga0268256_1000032 | 3300030500 | Bacteria | 424603 |
| 288 | Ga0268256_1000042 | 3300030500 | Bacteria | 333815 |
| 289 | Ga0268256_1000738 | 3300030500 | Bacteria | 24052 |
| 290 | Ga0268256_1000835 | 3300030500 | Bacteria | 21884 |
| 291 | Ga0268256_1004394 | 3300030500 | Bacteria | 5865 |
| 292 | Ga0268256_1011746 | 3300030500 | Bacteria | 2750 |
| 293 | Ga0268256_1016697 | 3300030500 | Bacteria | 2093 |
| 294 | Ga0265320_10015426 | 3300031240 | Bacteria | 4319 |
| 295 | Ga0265339_10010319 | 3300031249 | Bacteria | 5809 |
| 296 | Ga0265327_10011967 | 3300031251 | Bacteria | 5912 |
| 297 | Ga0307513_10044622 | 3300031456 | Bacteria | 4854 |
| 298 | Ga0307513_10044801 | 3300031456 | Bacteria | 4842 |
| 299 | Ga0307408_100010721 | 3300031548 | Bacteria | 6046 |
| 300 | Ga0316575_10007625 | 3300031665 | Bacteria | 3921 |
| 301 | Ga0316579_10035189 | 3300031691 | Bacteria | 2307 |
| 302 | Ga0265314_10065532 | 3300031711 | Bacteria | 2453 |
| 303 | Ga0265342_10000696 | 3300031712 | Bacteria | 35259 |
| 304 | Ga0316576_10090755 | 3300031727 | Bacteria | 2276 |
| 305 | Ga0316578_10044762 | 3300031728 | Bacteria | 2575 |
| 306 | Ga0307405_10030713 | 3300031731 | Bacteria | 3153 |
| 307 | Ga0316577_10003153 | 3300031733 | Bacteria | 8288 |
| 308 | Ga0307413_10007466 | 3300031824 | Bacteria | 5079 |
| 309 | Ga0307413_10032660 | 3300031824 | Bacteria | 2953 |
| 310 | Ga0307410_10006243 | 3300031852 | Bacteria | 6415 |
| 311 | Ga0307410_10008901 | 3300031852 | Bacteria | 5600 |
| 312 | Ga0307406_10022637 | 3300031901 | Bacteria | 3730 |
| 313 | Ga0307406_10053459 | 3300031901 | Bacteria | 2572 |
| 314 | Ga0307407_10000131 | 3300031903 | Bacteria | 23037 |
| 315 | Ga0307407_10381397 | 3300031903 | Bacteria | 1006 |
| 316 | Ga0307412_10039432 | 3300031911 | Bacteria | 3049 |
| 317 | Ga0307409_100010626 | 3300031995 | Bacteria | 5739 |
| 318 | Ga0307409_100024364 | 3300031995 | Bacteria | 4219 |
| 319 | Ga0307414_10030421 | 3300032004 | Bacteria | 3527 |
| 320 | Ga0307411_10002887 | 3300032005 | Bacteria | 7774 |
| 321 | Ga0307411_10020421 | 3300032005 | Bacteria | 3852 |
| 322 | Ga0307411_10351239 | 3300032005 | Bacteria | 1202 |
| 323 | Ga0307415_100026620 | 3300032126 | Bacteria | 3651 |
| 324 | Ga0307415_100287655 | 3300032126 | Bacteria | 1355 |
| 325 | Ga0316583_10006794 | 3300032133 | Bacteria | 4122 |
| 326 | Ga0316585_10000617 | 3300032137 | Bacteria | 8737 |
| 327 | Ga0316580_10015626 | 3300032139 | Bacteria | 2323 |
| 328 | Ga0373958_0005295 | 3300034819 | Bacteria | 1954 |
| 329 | Ga0373956_0102319 | 3300035119 | Bacteria | 1329 |
| 330 | Ga0373955_0099047 | 3300035172 | Bacteria | 1671 |
| 331 | Ga0373955_0129676 | 3300035172 | Bacteria | 1471 |
| 332 | Ga0316574_0318923 | 3300035398 | Bacteria | 987 |
| 333 | Ga0373933_0056658 | 3300035724 | Bacteria | 2353 |
| 334 | Ga0373933_0223785 | 3300035724 | Bacteria | 1208 |
| 335 | Ga0373937_0008650 | 3300036401 | Bacteria | 8845 |
| 336 | Ga0373937_0106455 | 3300036401 | Bacteria | 2607 |
| 337 | Ga0316584_0040506 | 3300036712 | Bacteria | 3471 |
| 338 | Ga0316584_0371849 | 3300036712 | Bacteria | 1023 |
| 339 | Ga0395899_0008877 | 3300037312 | Bacteria | 7738 |
| 340 | Ga0436361_0535557 | 3300039447 | Bacteria | 1976 |
| 341 | Ga0436363_1081135 | 3300039450 | Bacteria | 19222 |
| 342 | Ga0439438_000288 | 3300041405 | Bacteria | 22527 |
| 343 | Ga0439438_007478 | 3300041405 | Bacteria | 3729 |
| 344 | Ga0451789_0916808 | 3300041443 | Bacteria | 2729 |
| 345 | Ga0451793_0356174 | 3300041452 | Bacteria | 3075 |
| 346 | Ga0451797_0026023 | 3300041453 | Bacteria | 1594 |
| 347 | Ga0451798_0965004 | 3300041458 | Bacteria | 1438 |
| 348 | Ga0451802_1527626 | 3300041460 | Bacteria | 1597 |
| 349 | Ga0451807_0103718 | 3300041486 | Bacteria | 2860 |
| 350 | Ga0451807_1825775 | 3300041486 | Bacteria | 1882 |
| 351 | Ga0451807_1920178 | 3300041486 | Bacteria | 1501 |
| 352 | Ga0451833_0094144 | 3300041491 | Bacteria | 2344 |
| 353 | Ga0439432_016755 | 3300042006 | Bacteria | 2464 |
| 354 | Ga0439432_159450 | 3300042006 | Bacteria | 660 |
| 355 | Ga0439452_000010 | 3300042010 | Bacteria | 459139 |
| 356 | Ga0439452_000560 | 3300042010 | Bacteria | 19574 |
| 357 | Ga0439452_000663 | 3300042010 | Bacteria | 17026 |
| 358 | Ga0439460_0088288 | 3300042461 | Bacteria | 982 |
| 359 | Ga0451577_0000385 | 3300042876 | Bacteria | 82015 |
| 360 | Ga0466981_0000015 | 3300044669 | Bacteria | 106046 |
| 361 | Ga0466961_0171132 | 3300044693 | Bacteria | 1351 |
| 362 | Ga0453684_0418278 | 3300044712 | Bacteria | 1498 |
| 363 | Ga0451576_0122338 | 3300045051 | Bacteria | 2710 |
| 364 | Ga0495591_000110 | 3300046458 | Bacteria | 94012 |
| 365 | Ga0495591_037716 | 3300046458 | Bacteria | 1397 |
| 366 | Ga0495638_0008604 | 3300046460 | Bacteria | 7223 |
| 367 | Ga0495651_0399744 | 3300046462 | Bacteria | 897 |
| 368 | Ga0495653_0097958 | 3300046463 | Bacteria | 2130 |
| 369 | Ga0495616_0071087 | 3300046513 | Bacteria | 1683 |
| 370 | Ga0495620_0015458 | 3300046515 | Bacteria | 3852 |
| 371 | Ga0495654_0075228 | 3300046530 | Bacteria | 1593 |
| 372 | Ga0495654_0262592 | 3300046530 | Bacteria | 715 |
| 373 | Ga0495597_0000974 | 3300046542 | Bacteria | 22111 |
| 374 | Ga0495656_0021659 | 3300046615 | Bacteria | 2505 |
| 375 | Ga0495657_0240379 | 3300046675 | Bacteria | 1093 |
| 376 | Ga0495658_0472991 | 3300046683 | Bacteria | 801 |
| 377 | Ga0495649_0079842 | 3300046694 | Bacteria | 1749 |
| 378 | Ga0495649_0114760 | 3300046694 | Bacteria | 1426 |
| 379 | Ga0495589_0000041 | 3300046794 | Bacteria | 140490 |
| 380 | Ga0495672_0000740 | 3300047320 | Bacteria | 35756 |
| 381 | Ga0495679_000283 | 3300047446 | Bacteria | 41984 |
| 382 | Ga0495679_000681 | 3300047446 | Bacteria | 22280 |
| 383 | Ga0495673_0000128 | 3300047469 | Bacteria | 139672 |
| 384 | Ga0495681_0024178 | 3300047470 | Bacteria | 3208 |
| 385 | Ga0495681_0112143 | 3300047470 | Bacteria | 1180 |
| 386 | Ga0495681_0199653 | 3300047470 | Bacteria | 812 |
| 387 | Ga0496101_0094162 | 3300048904 | Bacteria | 2232 |
| 388 | Ga0496101_0095572 | 3300048904 | Bacteria | 2217 |
| 389 | Ga0496101_0116704 | 3300048904 | Bacteria | 2014 |
| 390 | Ga0496102_0074680 | 3300048905 | Bacteria | 3117 |
| 391 | Ga0496104_0085647 | 3300048907 | Bacteria | 3008 |
| 392 | Ga0496104_0212127 | 3300048907 | Bacteria | 1848 |
| 393 | Ga0496107_0659605 | 3300048910 | Bacteria | 771 |
| 394 | Ga0496112_0274337 | 3300048915 | Bacteria | 1634 |
| 395 | Ga0496113_0291164 | 3300048916 | Bacteria | 1306 |
| 396 | Ga0496114_0002583 | 3300048917 | Bacteria | 13831 |
| 397 | Ga0496114_0028612 | 3300048917 | Bacteria | 4575 |
| 398 | Ga0496115_0124052 | 3300048918 | Bacteria | 2127 |
| 399 | Ga0496115_0133707 | 3300048918 | Bacteria | 2045 |
| 400 | Ga0496116_0042975 | 3300048919 | Bacteria | 3082 |
| 401 | Ga0496117_0009518 | 3300048920 | Bacteria | 9024 |
| 402 | Ga0496117_0077566 | 3300048920 | Bacteria | 2198 |
| 403 | Ga0496117_0080456 | 3300048920 | Bacteria | 2142 |
| 404 | Ga0496117_0085434 | 3300048920 | Bacteria | 2054 |
| 405 | Ga0496117_0087712 | 3300048920 | Bacteria | 2015 |
| 406 | Ga0496117_0221847 | 3300048920 | Bacteria | 1051 |
| 407 | Ga0496118_0036585 | 3300048921 | Bacteria | 3965 |
| 408 | Ga0496118_0234856 | 3300048921 | Bacteria | 1054 |
| 409 | Ga0496119_0005944 | 3300048922 | Bacteria | 11483 |
| 410 | Ga0496119_0029599 | 3300048922 | Bacteria | 3709 |
| 411 | Ga0496119_0045043 | 3300048922 | Bacteria | 2770 |
| 412 | Ga0496119_0069692 | 3300048922 | Bacteria | 2065 |
| 413 | Ga0496120_0004383 | 3300048923 | Bacteria | 11880 |
| 414 | Ga0496120_0006134 | 3300048923 | Bacteria | 9321 |
| 415 | Ga0496120_0007109 | 3300048923 | Bacteria | 8396 |
| 416 | Ga0496120_0030515 | 3300048923 | Bacteria | 3275 |
| 417 | Ga0496120_0059585 | 3300048923 | Bacteria | 2139 |
| 418 | Ga0496120_0166618 | 3300048923 | Bacteria | 1093 |
| 419 | Ga0496121_0009313 | 3300048924 | Bacteria | 11327 |
| 420 | Ga0496121_0014905 | 3300048924 | Bacteria | 8191 |
| 421 | Ga0496121_0026183 | 3300048924 | Bacteria | 5506 |
| 422 | Ga0496121_0315069 | 3300048924 | Bacteria | 1055 |
| 423 | Ga0496122_0000104 | 3300048925 | Bacteria | 195617 |
| 424 | Ga0496122_0023360 | 3300048925 | Bacteria | 5453 |
| 425 | Ga0496122_0041894 | 3300048925 | Bacteria | 3611 |
| 426 | Ga0496123_0000060 | 3300048926 | Bacteria | 224015 |
| 427 | Ga0496123_0007969 | 3300048926 | Bacteria | 9822 |
| 428 | Ga0496123_0012766 | 3300048926 | Bacteria | 7123 |
| 429 | Ga0496124_0001029 | 3300048927 | Bacteria | 44134 |
| 430 | Ga0496124_0109936 | 3300048927 | Bacteria | 2220 |
| 431 | Ga0496124_0231629 | 3300048927 | Bacteria | 1381 |
| 432 | Ga0496124_0275203 | 3300048927 | Bacteria | 1230 |
| 433 | Ga0496125_0000377 | 3300048928 | Bacteria | 83509 |
| 434 | Ga0496125_0013646 | 3300048928 | Bacteria | 7974 |
| 435 | Ga0496125_0040214 | 3300048928 | Bacteria | 4013 |
| 436 | Ga0496125_0429873 | 3300048928 | Bacteria | 762 |
| 437 | Ga0496126_0011219 | 3300048929 | Bacteria | 9296 |
| 438 | Ga0496126_0013399 | 3300048929 | Bacteria | 8342 |
| 439 | Ga0501034_0099365 | 3300049571 | Bacteria | 2905 |
| 440 | Ga0501039_0356391 | 3300049575 | Bacteria | 1149 |
| 441 | Ga0501041_0274926 | 3300049577 | Bacteria | 1060 |
| 442 | Ga0501042_0199918 | 3300049578 | Bacteria | 1441 |
| 443 | Ga0501042_0200024 | 3300049578 | Bacteria | 1441 |
| 444 | Ga0501042_0580750 | 3300049578 | Bacteria | 815 |
| 445 | Ga0501067_0007171 | 3300049583 | Bacteria | 6193 |
| 446 | Ga0501067_0088113 | 3300049583 | Bacteria | 1722 |
| 447 | Ga0501068_0004726 | 3300049584 | Bacteria | 7405 |
| 448 | Ga0501068_0123248 | 3300049584 | Bacteria | 1617 |
| 449 | Ga0501069_0062357 | 3300049585 | Bacteria | 2082 |
| 450 | Ga0501070_0065829 | 3300049586 | Bacteria | 3001 |
| 451 | Ga0501071_0004322 | 3300049587 | Bacteria | 9009 |
| 452 | Ga0501072_0180657 | 3300049588 | Bacteria | 1683 |
| 453 | Ga0501072_0410204 | 3300049588 | Bacteria | 1074 |
| 454 | Ga0501073_0024295 | 3300049589 | Bacteria | 4351 |
| 455 | Ga0501074_0016435 | 3300049590 | Bacteria | 5373 |
| 456 | Ga0501076_0038907 | 3300049592 | Bacteria | 3733 |
| 457 | Ga0501076_0439537 | 3300049592 | Bacteria | 1074 |
| 458 | Ga0501077_0001753 | 3300049593 | Bacteria | 13077 |
| 459 | Ga0501209_001702 | 3300049656 | Bacteria | 3181 |
| 460 | Ga0501079_0000277 | 3300049741 | Bacteria | 31633 |
| 461 | Ga0501080_0011608 | 3300049742 | Bacteria | 8067 |
| 462 | Ga0501080_0044298 | 3300049742 | Bacteria | 4142 |
| 463 | Ga0501083_0012407 | 3300049744 | Bacteria | 5964 |
| 464 | nmdc:mga08y16_34873_c1 | 3300050511 | Bacteria | 5286 |
| 465 | Ga0500616_0002995 | 3300053153 | Bacteria | 13353 |
| 466 | Ga0501084_0096930 | 3300054114 | Bacteria | 2476 |
| 467 | Ga0501082_0019428 | 3300060353 | Bacteria | 5857 |
| 468 | 2508854856 | 2508501071 | Bacteria | 5454741 |
| 469 | 2547696863 | 2547132181 | Bacteria | 4945084 |
| 470 | 2548652672 | 2547132416 | Bacteria | 4633861 |
| 471 | 2555260684 | 2554235234 | Bacteria | 5762085 |
| 472 | 2562465040 | 2561511199 | Bacteria | 5155034 |
| 473 | 2599411604 | 2599185169 | Bacteria | 5441380 |
| 474 | 2601524723 | 2600255254 | Bacteria | 5281859 |
| 475 | 2601529877 | 2600255255 | Bacteria | 5282785 |
| 476 | 2601535799 | 2600255256 | Bacteria | 5597742 |
| 477 | 2601540567 | 2600255257 | Bacteria | 5597196 |
| 478 | 2601616711 | 2600255280 | Bacteria | 5292309 |
| 479 | 2601621433 | 2600255281 | Bacteria | 5288753 |
| 480 | 2601645283 | 2600255287 | Bacteria | 5210468 |
| 481 | 2601649830 | 2600255288 | Bacteria | 5282738 |
| 482 | 2601654757 | 2600255289 | Bacteria | 5281907 |
| 483 | 2601659969 | 2600255290 | Bacteria | 5282218 |
| 484 | 2601664525 | 2600255291 | Bacteria | 5217298 |
| 485 | 2601697943 | 2600255298 | Bacteria | 5215185 |
| 486 | 2601702311 | 2600255299 | Bacteria | 5218662 |
| 487 | 2601707501 | 2600255300 | Bacteria | 5287774 |
| 488 | 2601712522 | 2600255301 | Bacteria | 5280532 |
| 489 | 2601718018 | 2600255302 | Bacteria | 5288235 |
| 490 | 2601722814 | 2600255303 | Bacteria | 5219315 |
| 491 | 2601727946 | 2600255304 | Bacteria | 5283973 |
| 492 | 2601732963 | 2600255305 | Bacteria | 5282329 |
| 493 | 2601737268 | 2600255306 | Bacteria | 5281613 |
| 494 | 2601741687 | 2600255307 | Bacteria | 5439064 |
| 495 | 2601752586 | 2600255309 | Bacteria | 5431045 |
| 496 | 2601759192 | 2600255310 | Bacteria | 5600903 |
| 497 | 2601765094 | 2600255311 | Bacteria | 5598766 |
| 498 | 2602019842 | 2600255392 | Bacteria | 5437392 |
| 499 | 2603640094 | 2602042046 | Bacteria | 5483348 |
| 500 | 2603645786 | 2602042047 | Bacteria | 4697674 |
| 501 | 2603662690 | 2602042052 | Bacteria | 5215873 |
| 502 | 2603667586 | 2602042053 | Bacteria | 5214361 |
| 503 | 2603701518 | 2602042066 | Bacteria | 4423871 |
| 504 | 2603706242 | 2602042067 | Bacteria | 4863713 |
| 505 | 2603840373 | 2602042103 | Bacteria | 5284714 |
| 506 | 2603845449 | 2602042104 | Bacteria | 5281639 |
| 507 | 2603850523 | 2602042105 | Bacteria | 5282303 |
| 508 | 2603855590 | 2602042106 | Bacteria | 5282744 |
| 509 | 2603868153 | 2602042109 | Bacteria | 5152801 |
| 510 | 2603872961 | 2602042110 | Bacteria | 5283285 |
| 511 | 2603878396 | 2602042111 | Bacteria | 5212080 |
| 512 | 2606050352 | 2603880178 | Bacteria | 5283018 |
| 513 | 2606072013 | 2603880184 | Bacteria | 5217896 |
| 514 | 2606148034 | 2603880202 | Bacteria | 5284684 |
| 515 | 2606178031 | 2603880211 | Bacteria | 5284226 |
| 516 | 2637222742 | 2636415599 | Bacteria | 5718434 |
| 517 | 2671104888 | 2667528172 | Bacteria | 5170840 |
| 518 | 2671588817 | 2671180115 | Bacteria | 5353919 |
| 519 | 2676408990 | 2675903046 | Bacteria | 5451247 |
| 520 | 2681994663 | 2681812866 | Bacteria | 4552357 |
| 521 | 2682009437 | 2681812869 | Bacteria | 5014465 |
| 522 | 2707101540 | 2706794495 | Bacteria | 4536932 |
| 523 | 2753854000 | 2751185917 | Bacteria | 4551186 |
| 524 | 2765586887 | 2765235842 | Bacteria | 4799256 |
| 525 | 2772441387 | 2772190666 | Bacteria | 5117644 |
| 526 | 2777021085 | 2775507074 | Bacteria | 5532402 |
| 527 | 2791922780 | 2791354903 | Bacteria | 4937680 |
| 528 | 2792310988 | 2791355010 | Bacteria | 4864581 |
| 529 | 2793403445 | 2791355275 | Bacteria | 4429597 |
| 530 | 2807179114 | 2806310673 | Bacteria | 4801221 |
| 531 | 2814693715 | 2814123068 | Bacteria | 5687681 |
| 532 | 2821122007 | 2821118458 | Bacteria | 4714306 |
| 533 | 2823377879 | 2823373977 | Bacteria | 4779415 |
| 534 | 2844425605 | 2844425489 | Bacteria | 4854065 |
| 535 | 2846544868 | 2846540461 | Bacteria | 5471451 |
| 536 | 2852104213 | 2852103415 | Bacteria | 5193810 |
| 537 | 2884086618 | 2884086401 | Bacteria | 5005459 |
| 538 | 2888371523 | 2888366609 | Bacteria | 5155009 |
| 539 | 2888375845 | 2888373701 | Bacteria | 5098052 |
| 540 | 2891672061 | 2891670763 | Bacteria | 4967099 |
| 541 | 2904516484 | 2904513164 | Bacteria | 5476410 |
| 542 | 2919112428 | 2919108558 | Bacteria | 5897419 |
| 543 | 2927836166 | 2927833300 | Bacteria | 4923934 |
| 544 | 2932409570 | 2932406140 | Bacteria | 5134491 |
| 545 | 2937544316 | 2937539931 | Bacteria | 4639830 |
| 546 | 2937972222 | 2937967321 | Bacteria | 5094075 |
| 547 | 2939571994 | 2939568625 | Bacteria | 4542555 |
| 548 | 2939576941 | 2939573065 | Bacteria | 4926053 |
| 549 | 2939580674 | 2939577877 | Bacteria | 5132791 |
| 550 | 2939611359 | 2939607340 | Bacteria | 4719256 |
| 551 | 2939646308 | 2939642701 | Bacteria | 4475280 |
| 552 | 2969079769 | 2969079654 | Bacteria | 5439582 |
| 553 | 2971821090 | 2971820967 | Bacteria | 5823634 |
| 554 | 2974314240 | 2974310843 | Bacteria | 4947816 |
| 555 | 2984562208 | 2984559226 | Bacteria | 5683096 |
| 556 | 2984600270 | 2984595703 | Bacteria | 5682994 |
| 557 | 3000376789 | 3000376612 | Bacteria | 4705565 |
| 558 | 640940419 | 640753048 | Bacteria | 5495657 |
| 559 | 8004593293 | 8004592986 | Bacteria | 5122074 |
| 560 | 8015395063 | 8015394850 | Bacteria | 5064660 |
| 561 | 8018222525 | 8018221730 | Bacteria | 4616064 |
| 562 | 8018406303 | 8018405270 | Bacteria | 4978981 |
| 563 | 8054844902 | 8054844752 | Bacteria | 4450330 |
| 564 | 8054849859 | 8054849141 | Bacteria | 5232694 |
| 565 | 8055091877 | 8055087960 | Bacteria | 4784273 |
| 566 | 8055097323 | 8055092621 | Bacteria | 4873875 |
| 567 | 8055097535 | 8055097453 | Bacteria | 4865496 |
| 568 | 8057307830 | 8057304971 | Bacteria | 4649742 |
| 569 | Ga0070668_100523957 | |||
| 570 | SwRhRL2b_contig_138772 | |||
| 571 | SwRhRL2b_contig_1625696 | |||
| 572 | JGI25406J46586_10008309 | |||
| 573 | rootH2_10109502 | |||
| 574 | Ga0065704_10001283 | |||
| 575 | Ga0065704_10012633 | |||
| 576 | Ga0065704_10075026 | |||
| 577 | Ga0070658_10105779 | |||
| 578 | Ga0070683_100189701 | |||
| 579 | Ga0068869_100505600 | |||
| 580 | Ga0068869_100910467 | |||
| 581 | Ga0070682_100039357 | |||
| 582 | Ga0070682_100074768 | |||
| 583 | Ga0070689_100003519 | |||
| 584 | Ga0070689_100181862 | |||
| 585 | Ga0070675_100082050 | |||
| 586 | Ga0070675_100198100 | |||
| 587 | Ga0070674_100016438 | |||
| 588 | Ga0070674_100036337 | |||
| 589 | Ga0070674_100076188 | |||
| 590 | Ga0070673_100043782 | |||
| 591 | Ga0070673_100103506 | |||
| 592 | Ga0070688_100070540 | |||
| 593 | Ga0070688_100301355 | |||
| 594 | Ga0070659_100145185 | |||
| 595 | Ga0070667_100328813 | |||
| 596 | Ga0070709_10011208 | |||
| 597 | Ga0070709_10053297 | |||
| 598 | Ga0070709_10370140 | |||
| 599 | Ga0070714_100003407 | |||
| 600 | Ga0070713_100038259 | |||
| 601 | Ga0070710_10048425 | |||
| 602 | Ga0070710_10074426 | |||
| 603 | Ga0070705_100421206 | |||
| 604 | Ga0070700_100058918 | |||
| 605 | Ga0070694_100462604 | |||
| 606 | Ga0070678_100162233 | |||
| 607 | Ga0070678_100184247 | |||
| 608 | Ga0070681_10006040 | |||
| 609 | Ga0070681_10372730 | |||
| 610 | Ga0068867_100031599 | |||
| 611 | Ga0070685_10017897 | |||
| 612 | Ga0070679_100108954 | |||
| 613 | Ga0070679_100615864 | |||
| 614 | Ga0070684_100067734 | |||
| 615 | Ga0070672_100034454 | |||
| 616 | Ga0070672_100038891 | |||
| 617 | Ga0070672_100069426 | |||
| 618 | Ga0070672_100191720 | |||
| 619 | Ga0070686_100145648 | |||
| 620 | Ga0070686_100203412 | |||
| 621 | Ga0070696_100442106 | |||
| 622 | Ga0070665_100012223 | |||
| 623 | Ga0070665_100012353 | |||
| 624 | Ga0070665_100237810 | |||
| 625 | Ga0070664_100170115 | |||
| 626 | Ga0070664_100445025 | |||
| 627 | Ga0068857_100000119 | |||
| 628 | Ga0068857_100087304 | |||
| 629 | Ga0068856_100022706 | |||
| 630 | Ga0070702_100327145 | |||
| 631 | Ga0068859_100058480 | |||
| 632 | Ga0068861_100018605 | |||
| 633 | Ga0068861_100026530 | |||
| 634 | Ga0068861_100082872 | |||
| 635 | Ga0068851_10008063 | |||
| 636 | Ga0068870_10012786 | |||
| 637 | Ga0068870_10090122 | |||
| 638 | Ga0068863_100070361 | |||
| 639 | Ga0068863_100100424 | |||
| 640 | Ga0068863_100834291 | |||
| 641 | Ga0068860_100168512 | |||
| 642 | Ga0068862_100095382 | |||
| 643 | Ga0068862_100248680 | |||
| 644 | Ga0081455_10004966 | |||
| 645 | Ga0081539_10000006 | |||
| 646 | Ga0070717_10063537 | |||
| 647 | Ga0070717_10358494 | |||
| 648 | Ga0075364_10017489 | |||
| 649 | Ga0070712_100096010 | |||
| 650 | Ga0075369_10017052 | |||
| 651 | Ga0097621_100016215 | |||
| 652 | Ga0097621_100183090 | |||
| 653 | Ga0097621_100198169 | |||
| 654 | Ga0097621_100236744 | |||
| 655 | Ga0097621_101055462 | |||
| 656 | Ga0068871_100073743 | |||
| 657 | Ga0075430_100046800 | |||
| 658 | Ga0068865_100015466 | |||
| 659 | Ga0068865_100198418 | |||
| 660 | Ga0097620_100058478 | |||
| 661 | Ga0079104_1000882 | |||
| 662 | Ga0079104_1001818 | |||
| 663 | Ga0079104_1002035 | |||
| 664 | Ga0079104_1002480 | |||
| 665 | Ga0079104_1002590 | |||
| 666 | Ga0079104_1003177 | |||
| 667 | Ga0079104_1003908 | |||
| 668 | Ga0079104_1004351 | |||
| 669 | Ga0079104_1043133 | |||
| 670 | Ga0079104_1058442 | |||
| 671 | Ga0105251_10014579 | |||
| 672 | Ga0105251_10014635 | |||
| 673 | Ga0105251_10016687 | |||
| 674 | Ga0105251_10043971 | |||
| 675 | Ga0105244_10000036 | |||
| 676 | Ga0105244_10003383 | |||
| 677 | Ga0105244_10004353 | |||
| 678 | Ga0105244_10004450 | |||
| 679 | Ga0105244_10033391 | |||
| 680 | Ga0105244_10049998 | |||
| 681 | Ga0105244_10065619 | |||
| 682 | Ga0105250_10000451 | |||
| 683 | Ga0105250_10002326 | |||
| 684 | Ga0105250_10017868 | |||
| 685 | Ga0105250_10030028 | |||
| 686 | Ga0105250_10037152 | |||
| 687 | Ga0105240_10015747 | |||
| 688 | Ga0111539_10032114 | |||
| 689 | Ga0111539_10103705 | |||
| 690 | Ga0105247_10453317 | |||
| 691 | Ga0105243_10000220 | |||
| 692 | Ga0105243_10480642 | |||
| 693 | Ga0105241_10000030 | |||
| 694 | Ga0105249_10104287 | |||
| 695 | Ga0105249_10707136 | |||
| 696 | Ga0105246_10026082 | |||
| 697 | Ga0157373_10001500 | |||
| 698 | Ga0157370_10822670 | |||
| 699 | Ga0157374_10298193 | |||
| 700 | Ga0163162_10086236 | |||
| 701 | Ga0157372_10048090 | |||
| 702 | Ga0157375_10013879 | |||
| 703 | Ga0163163_10287629 | |||
| 704 | Ga0157380_10012001 | |||
| 705 | Ga0157380_10069002 | |||
| 706 | Ga0157380_10105470 | |||
| 707 | Ga0182008_10002484 | |||
| 708 | Ga0157377_10461257 | |||
| 709 | Ga0157379_10091048 | |||
| 710 | Ga0182006_1000009 | |||
| 711 | Ga0183366_1004 | |||
| 712 | Ga0183370_1004 | |||
| 713 | Ga0183369_1010 | |||
| 714 | Ga0183368_1008 | |||
| 715 | Ga0163161_10095946 | |||
| 716 | Ga0163161_10542232 | |||
| 717 | Ga0206356_10837035 | |||
| 718 | Ga0213874_10000277 | |||
| 719 | Ga0207656_10064528 | |||
| 720 | Ga0207696_1000092 | |||
| 721 | Ga0207696_1000320 | |||
| 722 | Ga0207696_1000508 | |||
| 723 | Ga0207696_1005866 | |||
| 724 | Ga0207696_1006562 | |||
| 725 | Ga0207655_1000067 | |||
| 726 | Ga0207655_1000099 | |||
| 727 | Ga0207655_1000122 | |||
| 728 | Ga0207655_1000163 | |||
| 729 | Ga0207655_1002735 | |||
| 730 | Ga0207655_1012813 | |||
| 731 | Ga0207655_1020757 | |||
| 732 | Ga0207655_1046284 | |||
| 733 | Ga0207713_1000017 | |||
| 734 | Ga0207713_1000091 | |||
| 735 | Ga0207713_1000096 | |||
| 736 | Ga0207713_1000121 | |||
| 737 | Ga0207713_1001868 | |||
| 738 | Ga0207713_1003980 | |||
| 739 | Ga0207713_1008901 | |||
| 740 | Ga0207713_1027917 | |||
| 741 | Ga0207713_1034089 | |||
| 742 | Ga0207713_1036935 | |||
| 743 | Ga0207713_1040045 | |||
| 744 | Ga0207682_10001767 | |||
| 745 | Ga0207682_10001984 | |||
| 746 | Ga0207692_10039260 | |||
| 747 | Ga0207688_10303135 | |||
| 748 | Ga0207699_10118281 | |||
| 749 | Ga0207645_10032364 | |||
| 750 | Ga0207643_10003782 | |||
| 751 | Ga0207643_10108188 | |||
| 752 | Ga0207654_10000030 | |||
| 753 | Ga0207707_10002066 | |||
| 754 | Ga0207707_10005125 | |||
| 755 | Ga0207695_10005991 | |||
| 756 | Ga0207663_10441221 | |||
| 757 | Ga0207660_10051853 | |||
| 758 | Ga0207660_10301631 | |||
| 759 | Ga0207657_10202037 | |||
| 760 | Ga0207652_10009790 | |||
| 761 | Ga0207652_10033543 | |||
| 762 | Ga0207652_10300790 | |||
| 763 | Ga0207652_10456678 | |||
| 764 | Ga0207694_10082288 | |||
| 765 | Ga0207694_10263672 | |||
| 766 | Ga0207659_10023981 | |||
| 767 | Ga0207659_10047402 | |||
| 768 | Ga0207659_10112446 | |||
| 769 | Ga0207659_10271399 | |||
| 770 | Ga0207664_10004867 | |||
| 771 | Ga0207664_10403089 | |||
| 772 | Ga0207644_10314559 | |||
| 773 | Ga0207644_10444254 | |||
| 774 | Ga0207690_10112105 | |||
| 775 | Ga0207706_10103055 | |||
| 776 | Ga0207686_10075633 | |||
| 777 | Ga0207686_10534889 | |||
| 778 | Ga0207709_10000437 | |||
| 779 | Ga0207709_10168842 | |||
| 780 | Ga0207709_10317054 | |||
| 781 | Ga0207670_10183296 | |||
| 782 | Ga0207670_10193917 | |||
| 783 | Ga0207669_10010270 | |||
| 784 | Ga0207704_10006026 | |||
| 785 | Ga0207704_10025861 | |||
| 786 | Ga0207704_10207568 | |||
| 787 | Ga0207691_10005134 | |||
| 788 | Ga0207691_10012709 | |||
| 789 | Ga0207691_10191116 | |||
| 790 | Ga0207689_10090015 | |||
| 791 | Ga0207689_10398763 | |||
| 792 | Ga0207667_10004278 | |||
| 793 | Ga0207651_10107572 | |||
| 794 | Ga0207668_10208311 | |||
| 795 | Ga0207640_10013232 | |||
| 796 | Ga0207658_10283501 | |||
| 797 | Ga0207658_10647019 | |||
| 798 | Ga0207678_10131861 | |||
| 799 | Ga0207708_10080830 | |||
| 800 | Ga0207708_10090214 | |||
| 801 | Ga0207708_10219715 | |||
| 802 | Ga0207702_10021769 | |||
| 803 | Ga0207702_10357458 | |||
| 804 | Ga0207641_10106855 | |||
| 805 | Ga0207641_10831902 | |||
| 806 | Ga0207648_10025905 | |||
| 807 | Ga0207648_10161538 | |||
| 808 | Ga0207674_10000031 | |||
| 809 | Ga0207675_100139534 | |||
| 810 | Ga0207683_10224638 | |||
| 811 | Ga0207683_10347973 | |||
| 812 | Ga0209281_1000031 | |||
| 813 | Ga0209281_1000086 | |||
| 814 | Ga0209281_1000117 | |||
| 815 | Ga0209281_1000224 | |||
| 816 | Ga0209281_1000460 | |||
| 817 | Ga0209281_1000574 | |||
| 818 | Ga0209281_1000812 | |||
| 819 | Ga0209281_1002765 | |||
| 820 | Ga0209281_1002782 | |||
| 821 | Ga0209281_1003638 | |||
| 822 | Ga0209281_1018996 | |||
| 823 | Ga0209281_1036406 | |||
| 824 | Ga0209973_1001152 | |||
| 825 | Ga0209371_1000029 | |||
| 826 | Ga0209371_1000042 | |||
| 827 | Ga0209371_1000880 | |||
| 828 | Ga0209371_1000936 | |||
| 829 | Ga0209371_1004641 | |||
| 830 | Ga0209371_1005918 | |||
| 831 | Ga0209969_1001372 | |||
| 832 | Ga0209981_1001533 | |||
| 833 | Ga0209981_1004894 | |||
| 834 | Ga0209996_1001907 | |||
| 835 | Ga0209984_1018402 | |||
| 836 | Ga0210000_1008463 | |||
| 837 | Ga0209995_1000809 | |||
| 838 | Ga0209995_1004863 | |||
| 839 | Ga0209968_1006079 | |||
| 840 | Ga0209968_1012272 | |||
| 841 | Ga0209999_1000302 | |||
| 842 | Ga0210002_1017522 | |||
| 843 | Ga0209983_1001074 | |||
| 844 | Ga0209983_1009349 | |||
| 845 | Ga0209971_1001633 | |||
| 846 | Ga0209974_10006699 | |||
| 847 | Ga0268266_10008668 | |||
| 848 | Ga0268266_10021450 | |||
| 849 | Ga0268266_10204937 | |||
| 850 | Ga0268266_10258226 | |||
| 851 | Ga0268265_10669251 | |||
| 852 | Ga0265336_10017304 | |||
| 853 | Ga0307515_10302469 | |||
| 854 | Ga0265338_10523465 | |||
| 855 | Ga0268256_1000032 | |||
| 856 | Ga0268256_1000042 | |||
| 857 | Ga0268256_1000738 | |||
| 858 | Ga0268256_1000835 | |||
| 859 | Ga0268256_1004394 | |||
| 860 | Ga0268256_1011746 | |||
| 861 | Ga0268256_1016697 | |||
| 862 | Ga0265320_10015426 | |||
| 863 | Ga0265339_10010319 | |||
| 864 | Ga0265327_10011967 | |||
| 865 | Ga0307513_10044622 | |||
| 866 | Ga0307513_10044801 | |||
| 867 | Ga0307408_100010721 | |||
| 868 | Ga0316575_10007625 | |||
| 869 | Ga0316579_10035189 | |||
| 870 | Ga0265314_10065532 | |||
| 871 | Ga0265342_10000696 | |||
| 872 | Ga0316576_10090755 | |||
| 873 | Ga0316578_10044762 | |||
| 874 | Ga0307405_10030713 | |||
| 875 | Ga0316577_10003153 | |||
| 876 | Ga0307413_10007466 | |||
| 877 | Ga0307413_10032660 | |||
| 878 | Ga0307410_10006243 | |||
| 879 | Ga0307410_10008901 | |||
| 880 | Ga0307406_10022637 | |||
| 881 | Ga0307406_10053459 | |||
| 882 | Ga0307407_10000131 | |||
| 883 | Ga0307407_10381397 | |||
| 884 | Ga0307412_10039432 | |||
| 885 | Ga0307409_100010626 | |||
| 886 | Ga0307409_100024364 | |||
| 887 | Ga0307414_10030421 | |||
| 888 | Ga0307411_10002887 | |||
| 889 | Ga0307411_10020421 | |||
| 890 | Ga0307411_10351239 | |||
| 891 | Ga0307415_100026620 | |||
| 892 | Ga0307415_100287655 | |||
| 893 | Ga0316583_10006794 | |||
| 894 | Ga0316585_10000617 | |||
| 895 | Ga0316580_10015626 | |||
| 896 | Ga0373958_0005295 | |||
| 897 | Ga0373956_0102319 | |||
| 898 | Ga0373955_0099047 | |||
| 899 | Ga0373955_0129676 | |||
| 900 | Ga0316574_0318923 | |||
| 901 | Ga0373933_0056658 | |||
| 902 | Ga0373933_0223785 | |||
| 903 | Ga0373937_0008650 | |||
| 904 | Ga0373937_0106455 | |||
| 905 | Ga0316584_0040506 | |||
| 906 | Ga0316584_0371849 | |||
| 907 | Ga0395899_0008877 | |||
| 908 | Ga0436361_0535557 | |||
| 909 | Ga0436363_1081135 | |||
| 910 | Ga0439438_000288 | |||
| 911 | Ga0439438_007478 | |||
| 912 | Ga0451789_0916808 | |||
| 913 | Ga0451793_0356174 | |||
| 914 | Ga0451797_0026023 | |||
| 915 | Ga0451798_0965004 | |||
| 916 | Ga0451802_1527626 | |||
| 917 | Ga0451807_0103718 | |||
| 918 | Ga0451807_1825775 | |||
| 919 | Ga0451807_1920178 | |||
| 920 | Ga0451833_0094144 | |||
| 921 | Ga0439432_016755 | |||
| 922 | Ga0439432_159450 | |||
| 923 | Ga0439452_000010 | |||
| 924 | Ga0439452_000560 | |||
| 925 | Ga0439452_000663 | |||
| 926 | Ga0439460_0088288 | |||
| 927 | Ga0451577_0000385 | |||
| 928 | Ga0466981_0000015 | |||
| 929 | Ga0466961_0171132 | |||
| 930 | Ga0453684_0418278 | |||
| 931 | Ga0451576_0122338 | |||
| 932 | Ga0495591_000110 | |||
| 933 | Ga0495591_037716 | |||
| 934 | Ga0495638_0008604 | |||
| 935 | Ga0495651_0399744 | |||
| 936 | Ga0495653_0097958 | |||
| 937 | Ga0495616_0071087 | |||
| 938 | Ga0495620_0015458 | |||
| 939 | Ga0495654_0075228 | |||
| 940 | Ga0495654_0262592 | |||
| 941 | Ga0495597_0000974 | |||
| 942 | Ga0495656_0021659 | |||
| 943 | Ga0495657_0240379 | |||
| 944 | Ga0495658_0472991 | |||
| 945 | Ga0495649_0079842 | |||
| 946 | Ga0495649_0114760 | |||
| 947 | Ga0495589_0000041 | |||
| 948 | Ga0495672_0000740 | |||
| 949 | Ga0495679_000283 | |||
| 950 | Ga0495679_000681 | |||
| 951 | Ga0495673_0000128 | |||
| 952 | Ga0495681_0024178 | |||
| 953 | Ga0495681_0112143 | |||
| 954 | Ga0495681_0199653 | |||
| 955 | Ga0496101_0094162 | |||
| 956 | Ga0496101_0095572 | |||
| 957 | Ga0496101_0116704 | |||
| 958 | Ga0496102_0074680 | |||
| 959 | Ga0496104_0085647 | |||
| 960 | Ga0496104_0212127 | |||
| 961 | Ga0496107_0659605 | |||
| 962 | Ga0496112_0274337 | |||
| 963 | Ga0496113_0291164 | |||
| 964 | Ga0496114_0002583 | |||
| 965 | Ga0496114_0028612 | |||
| 966 | Ga0496115_0124052 | |||
| 967 | Ga0496115_0133707 | |||
| 968 | Ga0496116_0042975 | |||
| 969 | Ga0496117_0009518 | |||
| 970 | Ga0496117_0077566 | |||
| 971 | Ga0496117_0080456 | |||
| 972 | Ga0496117_0085434 | |||
| 973 | Ga0496117_0087712 | |||
| 974 | Ga0496117_0221847 | |||
| 975 | Ga0496118_0036585 | |||
| 976 | Ga0496118_0234856 | |||
| 977 | Ga0496119_0005944 | |||
| 978 | Ga0496119_0029599 | |||
| 979 | Ga0496119_0045043 | |||
| 980 | Ga0496119_0069692 | |||
| 981 | Ga0496120_0004383 | |||
| 982 | Ga0496120_0006134 | |||
| 983 | Ga0496120_0007109 | |||
| 984 | Ga0496120_0030515 | |||
| 985 | Ga0496120_0059585 | |||
| 986 | Ga0496120_0166618 | |||
| 987 | Ga0496121_0009313 | |||
| 988 | Ga0496121_0014905 | |||
| 989 | Ga0496121_0026183 | |||
| 990 | Ga0496121_0315069 | |||
| 991 | Ga0496122_0000104 | |||
| 992 | Ga0496122_0023360 | |||
| 993 | Ga0496122_0041894 | |||
| 994 | Ga0496123_0000060 | |||
| 995 | Ga0496123_0007969 | |||
| 996 | Ga0496123_0012766 | |||
| 997 | Ga0496124_0001029 | |||
| 998 | Ga0496124_0109936 | |||
| 999 | Ga0496124_0231629 | |||
| 1000 | Ga0496124_0275203 | |||
| 1001 | Ga0496125_0000377 | |||
| 1002 | Ga0496125_0013646 | |||
| 1003 | Ga0496125_0040214 | |||
| 1004 | Ga0496125_0429873 | |||
| 1005 | Ga0496126_0011219 | |||
| 1006 | Ga0496126_0013399 | |||
| 1007 | Ga0501034_0099365 | |||
| 1008 | Ga0501039_0356391 | |||
| 1009 | Ga0501041_0274926 | |||
| 1010 | Ga0501042_0199918 | |||
| 1011 | Ga0501042_0200024 | |||
| 1012 | Ga0501042_0580750 | |||
| 1013 | Ga0501067_0007171 | |||
| 1014 | Ga0501067_0088113 | |||
| 1015 | Ga0501068_0004726 | |||
| 1016 | Ga0501068_0123248 | |||
| 1017 | Ga0501069_0062357 | |||
| 1018 | Ga0501070_0065829 | |||
| 1019 | Ga0501071_0004322 | |||
| 1020 | Ga0501072_0180657 | |||
| 1021 | Ga0501072_0410204 | |||
| 1022 | Ga0501073_0024295 | |||
| 1023 | Ga0501074_0016435 | |||
| 1024 | Ga0501076_0038907 | |||
| 1025 | Ga0501076_0439537 | |||
| 1026 | Ga0501077_0001753 | |||
| 1027 | Ga0501209_001702 | |||
| 1028 | Ga0501079_0000277 | |||
| 1029 | Ga0501080_0011608 | |||
| 1030 | Ga0501080_0044298 | |||
| 1031 | Ga0501083_0012407 | |||
| 1032 | nmdc:mga08y16_34873_c1 | |||
| 1033 | Ga0500616_0002995 | |||
| 1034 | Ga0501084_0096930 | |||
| 1035 | Ga0501082_0019428 | |||
| 1036 | 2508854856 | |||
| 1037 | 2547696863 | |||
| 1038 | 2548652672 | |||
| 1039 | 2555260684 | |||
| 1040 | 2562465040 | |||
| 1041 | 2599411604 | |||
| 1042 | 2601524723 | |||
| 1043 | 2601529877 | |||
| 1044 | 2601535799 | |||
| 1045 | 2601540567 | |||
| 1046 | 2601616711 | |||
| 1047 | 2601621433 | |||
| 1048 | 2601645283 | |||
| 1049 | 2601649830 | |||
| 1050 | 2601654757 | |||
| 1051 | 2601659969 | |||
| 1052 | 2601664525 | |||
| 1053 | 2601697943 | |||
| 1054 | 2601702311 | |||
| 1055 | 2601707501 | |||
| 1056 | 2601712522 | |||
| 1057 | 2601718018 | |||
| 1058 | 2601722814 | |||
| 1059 | 2601727946 | |||
| 1060 | 2601732963 | |||
| 1061 | 2601737268 | |||
| 1062 | 2601741687 | |||
| 1063 | 2601752586 | |||
| 1064 | 2601759192 | |||
| 1065 | 2601765094 | |||
| 1066 | 2602019842 | |||
| 1067 | 2603640094 | |||
| 1068 | 2603645786 | |||
| 1069 | 2603662690 | |||
| 1070 | 2603667586 | |||
| 1071 | 2603701518 | |||
| 1072 | 2603706242 | |||
| 1073 | 2603840373 | |||
| 1074 | 2603845449 | |||
| 1075 | 2603850523 | |||
| 1076 | 2603855590 | |||
| 1077 | 2603868153 | |||
| 1078 | 2603872961 | |||
| 1079 | 2603878396 | |||
| 1080 | 2606050352 | |||
| 1081 | 2606072013 | |||
| 1082 | 2606148034 | |||
| 1083 | 2606178031 | |||
| 1084 | 2637222742 | |||
| 1085 | 2671104888 | |||
| 1086 | 2671588817 | |||
| 1087 | 2676408990 | |||
| 1088 | 2681994663 | |||
| 1089 | 2682009437 | |||
| 1090 | 2707101540 | |||
| 1091 | 2753854000 | |||
| 1092 | 2765586887 | |||
| 1093 | 2772441387 | |||
| 1094 | 2777021085 | |||
| 1095 | 2791922780 | |||
| 1096 | 2792310988 | |||
| 1097 | 2793403445 | |||
| 1098 | 2807179114 | |||
| 1099 | 2814693715 | |||
| 1100 | 2821122007 | |||
| 1101 | 2823377879 | |||
| 1102 | 2844425605 | |||
| 1103 | 2846544868 | |||
| 1104 | 2852104213 | |||
| 1105 | 2884086618 | |||
| 1106 | 2888371523 | |||
| 1107 | 2888375845 | |||
| 1108 | 2891672061 | |||
| 1109 | 2904516484 | |||
| 1110 | 2919112428 | |||
| 1111 | 2927836166 | |||
| 1112 | 2932409570 | |||
| 1113 | 2937544316 | |||
| 1114 | 2937972222 | |||
| 1115 | 2939571994 | |||
| 1116 | 2939576941 | |||
| 1117 | 2939580674 | |||
| 1118 | 2939611359 | |||
| 1119 | 2939646308 | |||
| 1120 | 2969079769 | |||
| 1121 | 2971821090 | |||
| 1122 | 2974314240 | |||
| 1123 | 2984562208 | |||
| 1124 | 2984600270 | |||
| 1125 | 3000376789 | |||
| 1126 | 640940419 | |||
| 1127 | 8004593293 | |||
| 1128 | 8015395063 | |||
| 1129 | 8018222525 | |||
| 1130 | 8018406303 | |||
| 1131 | 8054844902 | |||
| 1132 | 8054849859 | |||
| 1133 | 8055091877 | |||
| 1134 | 8055097323 | |||
| 1135 | 8055097535 | |||
| 1136 | 8057307830 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tak-assembly1.cif.gz_AAA | crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution | 0.9788 | 1 | 213 |
| 1sto-assembly1.cif.gz_A-2 | crystal structure of orotate phosphoribosyltransferase | 0.9783 | 1 | 213 |
| 6taj-assembly2.cif.gz_BBB-2 | crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution | 0.9758 | 1 | 213 |
| 6tak-assembly1.cif.gz_AAA | crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution | 0.9741 | 1 | 213 |
| 1sto-assembly1.cif.gz_A-2 | crystal structure of orotate phosphoribosyltransferase | 0.9737 | 1 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n2lH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9709 | 1 | 192 | 3.40.50.2020 |
| 3n2lH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9597 | 1 | 192 | 3.40.50.2020 |
| 3mjdC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9146 | 7 | 213 | 3.40.50.2020 |
| 3mjdC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9061 | 7 | 213 | 3.40.50.2020 |
| 4wn3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9038 | 1 | 213 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A745CG89-F1-model_v4 | Orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9977 | 1 | 91 |
GO:0004588
GO:0005737 GO:0006207 GO:0044205 GO:0046132 |
| AF-A0A7B4HVX2-F1-model_v4 | deleted | 0.9931 | 1 | 95 |
|
| AF-A0A615E2N5-F1-model_v4 | Orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9925 | 1 | 78 |
GO:0004588
GO:0005737 GO:0006207 GO:0006221 GO:0046132 |
| AF-A0A2D6NU13-F1-model_v4 | deleted | 0.9917 | 1 | 85 |
|
| AF-A0A0S8EKK5-F1-model_v4 | Orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9892 | 1 | 80 |
GO:0004588
GO:0005737 GO:0006207 GO:0006221 GO:0046132 |