F464157

General Info

Members Datasets Scaffolds Average Seq Length
564 221 1128 150

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100065022|Ga0075436_1000650222
Length 164
Sequence MPLEDVGRQGTAVSATRLNTALVGRELAPFAVTVERGKIKEFARAVGDLNPFYLDERVGQASEFGDIIAPPTFLTTFRDESADTAALLRELGTDISRVLHGEQEFELHRPIRPGETFLCRSKVVDIYEKTGKSGPMAFVVREMAVTDRTNEVVATARHITVVRL

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.24
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100065022 3300006914 Bacteria 2522
2 JGI25405J52794_10109551 3300003911 Bacteria 619
3 Ga0065712_10402305 3300005290 Bacteria 730
4 Ga0065715_10198706 3300005293 Bacteria 1373
5 Ga0065707_10143437 3300005295 Unclassified 1743
6 Ga0065707_10494215 3300005295 Bacteria 762
7 Ga0070690_100143841 3300005330 Bacteria 1621
8 Ga0070690_100147992 3300005330 Bacteria 1600
9 Ga0068869_100000172 3300005334 Bacteria 32764
10 Ga0070680_100001506 3300005336 Bacteria 16967
11 Ga0070680_100012847 3300005336 Bacteria 6515
12 Ga0070680_100623906 3300005336 Bacteria 926
13 Ga0070682_100000273 3300005337 Bacteria 37152
14 Ga0070689_100078316 3300005340 Bacteria 2591
15 Ga0070689_100911183 3300005340 Unclassified 778
16 Ga0070691_10020593 3300005341 Bacteria 3048
17 Ga0070687_100701489 3300005343 Bacteria 707
18 Ga0070661_100009656 3300005344 Bacteria 6688
19 Ga0070692_10010295 3300005345 Bacteria 4250
20 Ga0070692_10138199 3300005345 Unclassified 1376
21 Ga0070668_100812050 3300005347 Bacteria 831
22 Ga0070669_100037663 3300005353 Bacteria 3508
23 Ga0070669_100084639 3300005353 Bacteria 2367
24 Ga0070673_100733600 3300005364 Bacteria 909
25 Ga0070659_100009310 3300005366 Bacteria 7213
26 Ga0070705_100004628 3300005440 Bacteria 6698
27 Ga0070705_100011166 3300005440 Bacteria 4523
28 Ga0070705_100039180 3300005440 Bacteria 2687
29 Ga0070705_101097158 3300005440 Bacteria 651
30 Ga0070700_100843096 3300005441 Unclassified 742
31 Ga0070694_100003162 3300005444 Bacteria 9816
32 Ga0070694_100007918 3300005444 Bacteria 6489
33 Ga0070694_100094477 3300005444 Bacteria 2104
34 Ga0070694_100305728 3300005444 Bacteria 1220
35 Ga0070708_100034282 3300005445 Bacteria 4415
36 Ga0070708_100051373 3300005445 Bacteria 3652
37 Ga0070708_100083842 3300005445 Bacteria 2890
38 Ga0070708_100249792 3300005445 Bacteria 1666
39 Ga0070708_100338739 3300005445 Bacteria 1417
40 Ga0070708_100508239 3300005445 Bacteria 1137
41 Ga0070708_100591112 3300005445 Bacteria 1046
42 Ga0070708_101333643 3300005445 Bacteria 670
43 Ga0070663_100165356 3300005455 Bacteria 1706
44 Ga0070662_100056647 3300005457 Bacteria 2846
45 Ga0070662_100216235 3300005457 Bacteria 1527
46 Ga0070681_10010009 3300005458 Bacteria 9348
47 Ga0068867_100205725 3300005459 Bacteria 1578
48 Ga0068867_100677592 3300005459 Bacteria 908
49 Ga0070706_100004837 3300005467 Bacteria 12901
50 Ga0070706_100063011 3300005467 Bacteria 3426
51 Ga0070706_100218422 3300005467 Bacteria 1779
52 Ga0070707_100000549 3300005468 Bacteria 37571
53 Ga0070707_100005757 3300005468 Bacteria 11559
54 Ga0070707_100546459 3300005468 Bacteria 1120
55 Ga0070698_100116897 3300005471 Bacteria 2629
56 Ga0070698_100391062 3300005471 Bacteria 1323
57 Ga0070699_100000309 3300005518 Bacteria 47299
58 Ga0070699_100068167 3300005518 Bacteria 3089
59 Ga0070699_100081715 3300005518 Bacteria 2817
60 Ga0070699_100232073 3300005518 Bacteria 1646
61 Ga0070699_100263997 3300005518 Unclassified 1540
62 Ga0070679_100000834 3300005530 Bacteria 26790
63 Ga0070679_100268374 3300005530 Bacteria 1661
64 Ga0070697_100010942 3300005536 Bacteria 7088
65 Ga0070697_100064723 3300005536 Bacteria 2986
66 Ga0070697_100085244 3300005536 Bacteria 2606
67 Ga0070672_100038225 3300005543 Bacteria 3666
68 Ga0070686_100120859 3300005544 Bacteria 1798
69 Ga0070695_100003200 3300005545 Bacteria 9561
70 Ga0070695_100017126 3300005545 Bacteria 4395
71 Ga0070695_100098175 3300005545 Bacteria 1968
72 Ga0070695_101476953 3300005545 Unclassified 565
73 Ga0070696_100008412 3300005546 Bacteria 6904
74 Ga0070696_100009494 3300005546 Bacteria 6514
75 Ga0070696_100056446 3300005546 Bacteria 2739
76 Ga0070696_100059755 3300005546 Bacteria 2665
77 Ga0070696_100210259 3300005546 Bacteria 1456
78 Ga0070693_100007985 3300005547 Bacteria 5194
79 Ga0070693_100528858 3300005547 Bacteria 841
80 Ga0070704_100005191 3300005549 Bacteria 7574
81 Ga0070704_100008651 3300005549 Bacteria 6118
82 Ga0070704_100046413 3300005549 Bacteria 3029
83 Ga0070704_100072797 3300005549 Bacteria 2501
84 Ga0070704_100292057 3300005549 Bacteria 1355
85 Ga0070704_101096202 3300005549 Unclassified 723
86 Ga0070704_101368889 3300005549 Bacteria 649
87 Ga0068855_100001987 3300005563 Bacteria 25399
88 Ga0070664_100018048 3300005564 Bacteria 5793
89 Ga0068857_100026269 3300005577 Bacteria 5130
90 Ga0068854_100693776 3300005578 Bacteria 878
91 Ga0068856_100001350 3300005614 Bacteria 25785
92 Ga0068859_100059870 3300005617 Bacteria 3837
93 Ga0068859_100166295 3300005617 Bacteria 2286
94 Ga0068859_100224954 3300005617 Bacteria 1964
95 Ga0068859_101094035 3300005617 Bacteria 877
96 Ga0068864_100174685 3300005618 Bacteria 1960
97 Ga0068864_101601490 3300005618 Unclassified 655
98 Ga0068866_10134984 3300005718 Bacteria 1409
99 Ga0068861_100149919 3300005719 Bacteria 1912
100 Ga0068861_100345025 3300005719 Bacteria 1304
101 Ga0068861_101103026 3300005719 Bacteria 763
102 Ga0068861_101892377 3300005719 Bacteria 593
103 Ga0068870_10067973 3300005840 Bacteria 1935
104 Ga0068870_10873487 3300005840 Bacteria 633
105 Ga0068863_100004195 3300005841 Bacteria 14237
106 Ga0068863_100155823 3300005841 Bacteria 2187
107 Ga0068863_100492775 3300005841 Unclassified 1206
108 Ga0068860_100035095 3300005843 Bacteria 4812
109 Ga0068860_100097737 3300005843 Bacteria 2799
110 Ga0068860_100128315 3300005843 Bacteria 2432
111 Ga0068862_100155247 3300005844 Bacteria 2040
112 Ga0068862_100290578 3300005844 Bacteria 1501
113 Ga0068862_100379541 3300005844 Bacteria 1318
114 Ga0068862_100399002 3300005844 Unclassified 1286
115 Ga0068862_100826311 3300005844 Bacteria 906
116 Ga0068862_101502053 3300005844 Bacteria 679
117 Ga0081455_10071797 3300005937 Bacteria 2868
118 Ga0081455_10342401 3300005937 Bacteria 1057
119 Ga0081455_10355337 3300005937 Unclassified 1032
120 Ga0081540_1011700 3300005983 Bacteria 5842
121 Ga0081539_10000002 3300005985 Bacteria 601032
122 Ga0070715_10528702 3300006163 Unclassified 680
123 Ga0070716_100140334 3300006173 Bacteria 1540
124 Ga0070716_100974379 3300006173 Bacteria 669
125 Ga0070716_101280419 3300006173 Bacteria 592
126 Ga0068871_100208161 3300006358 Bacteria 1691
127 Ga0075428_100000227 3300006844 Bacteria 54930
128 Ga0075428_100026595 3300006844 Bacteria 6405
129 Ga0075428_100045869 3300006844 Bacteria 4802
130 Ga0075428_100047988 3300006844 Bacteria 4689
131 Ga0075428_100063398 3300006844 Unclassified 4046
132 Ga0075428_100069536 3300006844 Bacteria 3849
133 Ga0075428_100086597 3300006844 Bacteria 3417
134 Ga0075428_100187478 3300006844 Bacteria 2238
135 Ga0075430_100000123 3300006846 Bacteria 48209
136 Ga0075430_100005945 3300006846 Bacteria 10307
137 Ga0075430_100006432 3300006846 Bacteria 9903
138 Ga0075430_100024288 3300006846 Bacteria 5157
139 Ga0075430_100030069 3300006846 Bacteria 4612
140 Ga0075430_100047305 3300006846 Bacteria 3632
141 Ga0075430_100142202 3300006846 Bacteria 1998
142 Ga0075430_100304561 3300006846 Bacteria 1318
143 Ga0075431_100001277 3300006847 Bacteria 22947
144 Ga0075431_100002346 3300006847 Bacteria 18180
145 Ga0075431_100004293 3300006847 Bacteria 13973
146 Ga0075431_100004929 3300006847 Bacteria 13144
147 Ga0075431_100005228 3300006847 Bacteria 12780
148 Ga0075431_100006664 3300006847 Bacteria 11471
149 Ga0075431_100030682 3300006847 Bacteria 5537
150 Ga0075431_100037500 3300006847 Bacteria 4993
151 Ga0075431_100199789 3300006847 Bacteria 2046
152 Ga0075431_100298567 3300006847 Unclassified 1627
153 Ga0075431_100841989 3300006847 Bacteria 889
154 Ga0075433_10004904 3300006852 Bacteria 10473
155 Ga0075433_10042123 3300006852 Bacteria 3960
156 Ga0075433_10069093 3300006852 Bacteria 3102
157 Ga0075433_10183575 3300006852 Unclassified 1861
158 Ga0075433_10211967 3300006852 Bacteria 1721
159 Ga0075433_10571117 3300006852 Bacteria 993
160 Ga0075433_10703806 3300006852 Bacteria 885
161 Ga0075433_11030167 3300006852 Bacteria 717
162 Ga0075433_11206102 3300006852 Viruses 657
163 Ga0075434_100006728 3300006871 Bacteria 10563
164 Ga0075434_100026631 3300006871 Bacteria 5667
165 Ga0075434_100041714 3300006871 Bacteria 4546
166 Ga0075434_100049606 3300006871 Bacteria 4169
167 Ga0075434_100093883 3300006871 Bacteria 3004
168 Ga0075434_100327064 3300006871 Bacteria 1553
169 Ga0075434_100446273 3300006871 Bacteria 1315
170 Ga0075434_100549241 3300006871 Bacteria 1175
171 Ga0075434_100751007 3300006871 Bacteria 992
172 Ga0075429_100006235 3300006880 Bacteria 10320
173 Ga0075429_100007789 3300006880 Bacteria 9303
174 Ga0075429_100008036 3300006880 Bacteria 9170
175 Ga0075429_100010967 3300006880 Bacteria 7841
176 Ga0075429_100012282 3300006880 Bacteria 7427
177 Ga0075429_100036725 3300006880 Bacteria 4263
178 Ga0075429_100447730 3300006880 Bacteria 1132
179 Ga0075429_100603573 3300006880 Bacteria 962
180 Ga0075429_101130818 3300006880 Bacteria 684
181 Ga0068865_100040484 3300006881 Bacteria 3167
182 Ga0075436_100003235 3300006914 Bacteria 11164
183 Ga0075436_100057619 3300006914 Bacteria 2683
184 Ga0075436_100125685 3300006914 Bacteria 1796
185 Ga0097620_100059869 3300006931 Bacteria 3837
186 Ga0097620_100166303 3300006931 Bacteria 2286
187 Ga0097620_100224958 3300006931 Bacteria 1964
188 Ga0097620_101093876 3300006931 Bacteria 877
189 Ga0075435_100001344 3300007076 Bacteria 15827
190 Ga0075435_100027365 3300007076 Bacteria 4459
191 Ga0075435_100031041 3300007076 Bacteria 4206
192 Ga0075435_100071830 3300007076 Bacteria 2827
193 Ga0075435_100156163 3300007076 Unclassified 1920
194 Ga0075435_100355530 3300007076 Bacteria 1256
195 Ga0099794_10025977 3300007265 Bacteria 2703
196 Ga0099794_10080853 3300007265 Bacteria 1603
197 Ga0099794_10122045 3300007265 Bacteria 1311
198 Ga0099794_10547082 3300007265 Bacteria 611
199 Ga0111539_10054463 3300009094 Bacteria 4760
200 Ga0111539_10097399 3300009094 Bacteria 3455
201 Ga0111539_10131654 3300009094 Bacteria 2929
202 Ga0111539_10661479 3300009094 Bacteria 1216
203 Ga0105245_10592780 3300009098 Bacteria 1134
204 Ga0114129_10000037 3300009147 Bacteria 108744
205 Ga0114129_10000479 3300009147 Bacteria 48277
206 Ga0114129_10004120 3300009147 Bacteria 20541
207 Ga0114129_10013284 3300009147 Bacteria 11734
208 Ga0114129_10013954 3300009147 Bacteria 11447
209 Ga0114129_10016825 3300009147 Bacteria 10410
210 Ga0114129_10059442 3300009147 Bacteria 5344
211 Ga0114129_10065760 3300009147 Bacteria 5060
212 Ga0114129_10132735 3300009147 Bacteria 3419
213 Ga0114129_10205344 3300009147 Bacteria 2666
214 Ga0114129_10580302 3300009147 Bacteria 1455
215 Ga0114129_10813253 3300009147 Bacteria 1191
216 Ga0114129_11067504 3300009147 Bacteria 1013
217 Ga0114129_11415265 3300009147 Bacteria 857
218 Ga0114129_11794920 3300009147 Bacteria 746
219 Ga0105243_10030545 3300009148 Bacteria 4149
220 Ga0105243_11052471 3300009148 Bacteria 819
221 Ga0105241_10002462 3300009174 Bacteria 13914
222 Ga0105241_10028884 3300009174 Bacteria 4133
223 Ga0105248_10189107 3300009177 Bacteria 2320
224 Ga0105248_10884797 3300009177 Bacteria 1008
225 Ga0105238_10684200 3300009551 Bacteria 1037
226 Ga0105249_10041393 3300009553 Bacteria 4188
227 Ga0105239_10124089 3300010375 Bacteria 2869
228 Ga0105246_10199004 3300011119 Bacteria 1556
229 Ga0157373_10056784 3300013100 Bacteria 2778
230 Ga0157370_10167949 3300013104 Bacteria 2040
231 Ga0157369_10822197 3300013105 Bacteria 954
232 Ga0157378_10130279 3300013297 Bacteria 2328
233 Ga0157378_10463117 3300013297 Bacteria 1260
234 Ga0163162_10009498 3300013306 Bacteria 9459
235 Ga0163162_10965103 3300013306 Bacteria 963
236 Ga0163162_11858224 3300013306 Bacteria 689
237 Ga0157372_10000738 3300013307 Bacteria 35645
238 Ga0157375_11710512 3300013308 Bacteria 745
239 Ga0157380_10170067 3300014326 Bacteria 1903
240 Ga0182008_10148595 3300014497 Bacteria 1175
241 Ga0157377_10871163 3300014745 Unclassified 671
242 Ga0182007_10048894 3300015262 Bacteria 1397
243 Ga0163161_10224737 3300017792 Bacteria 1455
244 Ga0206353_11776028 3300020082 Unclassified 994
245 Ga0207642_10081784 3300025899 Bacteria 1571
246 Ga0207642_10146552 3300025899 Bacteria 1251
247 Ga0207647_10470288 3300025904 Bacteria 703
248 Ga0207645_10092883 3300025907 Bacteria 1941
249 Ga0207643_10022078 3300025908 Bacteria 3502
250 Ga0207643_10469762 3300025908 Bacteria 802
251 Ga0207684_10000105 3300025910 Bacteria 160905
252 Ga0207684_10009895 3300025910 Bacteria 8409
253 Ga0207684_10050557 3300025910 Bacteria 3526
254 Ga0207654_10020533 3300025911 Bacteria 3503
255 Ga0207654_10105929 3300025911 Bacteria 1740
256 Ga0207707_10000169 3300025912 Bacteria 68558
257 Ga0207707_10392027 3300025912 Bacteria 1193
258 Ga0207660_10001109 3300025917 Bacteria 17992
259 Ga0207660_10021963 3300025917 Bacteria 4296
260 Ga0207660_10292594 3300025917 Bacteria 1295
261 Ga0207657_10018039 3300025919 Bacteria 6752
262 Ga0207649_10022765 3300025920 Bacteria 3621
263 Ga0207652_10001388 3300025921 Bacteria 21542
264 Ga0207646_10004489 3300025922 Bacteria 15135
265 Ga0207646_10021381 3300025922 Bacteria 5979
266 Ga0207646_10514006 3300025922 Bacteria 1078
267 Ga0207646_10851732 3300025922 Bacteria 810
268 Ga0207681_10274753 3300025923 Bacteria 1324
269 Ga0207650_11324326 3300025925 Bacteria 613
270 Ga0207690_10004668 3300025932 Bacteria 8096
271 Ga0207706_10000910 3300025933 Bacteria 30403
272 Ga0207706_10027875 3300025933 Bacteria 5049
273 Ga0207686_10489853 3300025934 Bacteria 952
274 Ga0207670_10021424 3300025936 Bacteria 3988
275 Ga0207704_10076419 3300025938 Bacteria 2146
276 Ga0207704_10276702 3300025938 Bacteria 1274
277 Ga0207665_10383035 3300025939 Bacteria 1068
278 Ga0207665_10574013 3300025939 Bacteria 878
279 Ga0207691_10037619 3300025940 Bacteria 4481
280 Ga0207689_10000006 3300025942 Bacteria 133746
281 Ga0207679_10012675 3300025945 Bacteria 5503
282 Ga0207667_10000482 3300025949 Bacteria 52841
283 Ga0207651_10886376 3300025960 Bacteria 794
284 Ga0207668_10810711 3300025972 Bacteria 829
285 Ga0207640_10051676 3300025981 Bacteria 2673
286 Ga0207678_10020274 3300026067 Bacteria 5834
287 Ga0207708_10099031 3300026075 Bacteria 2254
288 Ga0207702_10006067 3300026078 Bacteria 10481
289 Ga0207641_10111349 3300026088 Bacteria 2427
290 Ga0207641_10275911 3300026088 Bacteria 1579
291 Ga0207641_10356191 3300026088 Bacteria 1396
292 Ga0207648_10082043 3300026089 Bacteria 2812
293 Ga0207648_10450253 3300026089 Bacteria 1172
294 Ga0207676_10100425 3300026095 Bacteria 2397
295 Ga0207676_11429748 3300026095 Bacteria 688
296 Ga0207674_10031159 3300026116 Bacteria 5604
297 Ga0207675_100037335 3300026118 Bacteria 4532
298 Ga0207675_100038549 3300026118 Bacteria 4460
299 Ga0207675_100443314 3300026118 Bacteria 1285
300 Ga0207675_100728124 3300026118 Bacteria 1002
301 Ga0207675_101520452 3300026118 Bacteria 690
302 Ga0207675_102004156 3300026118 Bacteria 596
303 Ga0207675_102097434 3300026118 Unclassified 582
304 Ga0207683_11908728 3300026121 Unclassified 543
305 Ga0209983_1055271 3300027665 Bacteria 872
306 Ga0209588_1035337 3300027671 Bacteria 1606
307 Ga0209971_1039305 3300027682 Bacteria 1139
308 Ga0209966_1015600 3300027695 Bacteria 1428
309 Ga0207428_10026634 3300027907 Bacteria 4823
310 Ga0207428_10356352 3300027907 Unclassified 1076
311 Ga0268265_10034543 3300028380 Bacteria 3687
312 Ga0268265_10247127 3300028380 Bacteria 1578
313 Ga0268265_10331099 3300028380 Bacteria 1383
314 Ga0268265_10335384 3300028380 Bacteria 1375
315 Ga0268265_10814252 3300028380 Bacteria 911
316 Ga0268264_10001879 3300028381 Bacteria 19069
317 Ga0268264_10168077 3300028381 Bacteria 1981
318 Ga0268264_10431926 3300028381 Bacteria 1272
319 Ga0268264_11351219 3300028381 Unclassified 723
320 Ga0307408_100004291 3300031548 Bacteria 9677
321 Ga0307408_100024078 3300031548 Bacteria 4153
322 Ga0307408_100785058 3300031548 Bacteria 863
323 Ga0307405_10608201 3300031731 Unclassified 893
324 Ga0307413_11911282 3300031824 Bacteria 533
325 Ga0307406_10366544 3300031901 Bacteria 1131
326 Ga0307412_10311054 3300031911 Bacteria 1249
327 Ga0307409_100058051 3300031995 Bacteria 3003
328 Ga0307409_100451925 3300031995 Bacteria 1240
329 Ga0307409_100946802 3300031995 Bacteria 877
330 Ga0307416_100168890 3300032002 Bacteria 2033
331 Ga0307414_10205754 3300032004 Bacteria 1605
332 Ga0307411_11131695 3300032005 Bacteria 707
333 Ga0373948_0031749 3300034817 Bacteria 1068
334 Ga0373959_0046788 3300034820 Bacteria 923
335 Ga0373940_0126191 3300035088 Bacteria 798
336 Ga0373939_0081036 3300035114 Bacteria 1078
337 Ga0373939_0484100 3300035114 Bacteria 526
338 Ga0373941_0205330 3300035115 Bacteria 751
339 Ga0373961_0009508 3300035241 Bacteria 2381
340 Ga0373961_0137528 3300035241 Bacteria 823
341 Ga0373931_0002597 3300035691 Bacteria 8050
342 Ga0395899_0214547 3300037312 Bacteria 1336
343 Ga0395900_0004055 3300037418 Bacteria 15630
344 Ga0395898_0053961 3300037466 Bacteria 3924
345 Ga0395905_0371136 3300037471 Bacteria 1324
346 Ga0395905_0987133 3300037471 Bacteria 745
347 Ga0395901_0004871 3300038443 Bacteria 13553
348 Ga0242420_012430 3300038996 Bacteria 1442
349 Ga0242420_047897 3300038996 Bacteria 830
350 Ga0436365_0346878 3300039437 Bacteria 1236
351 Ga0439441_080243 3300042001 Bacteria 710
352 Ga0439448_0001714 3300042005 Bacteria 5780
353 Ga0439459_0003393 3300042438 Bacteria 2524
354 Ga0439460_0009793 3300042461 Bacteria 2441
355 Ga0451577_0162378 3300042876 Bacteria 2012
356 Ga0453683_0291744 3300044673 Bacteria 1043
357 Ga0453684_0316146 3300044712 Bacteria 1770
358 Ga0453684_1726323 3300044712 Bacteria 639
359 Ga0451576_0011860 3300045051 Bacteria 9862
360 Ga0451576_0430211 3300045051 Bacteria 1385
361 Ga0451576_0748371 3300045051 Unclassified 1027
362 Ga0495603_0187535 3300046455 Bacteria 1196
363 Ga0495580_0000443 3300046472 Bacteria 34172
364 Ga0495584_0311296 3300046491 Bacteria 800
365 Ga0495584_0623202 3300046491 Bacteria 550
366 Ga0495642_0014719 3300046528 Bacteria 3035
367 Ga0495642_0546555 3300046528 Unclassified 514
368 Ga0495656_0190956 3300046615 Bacteria 1011
369 Ga0495611_0336228 3300046648 Bacteria 694
370 Ga0495659_0015276 3300046664 Bacteria 2523
371 Ga0495659_0068030 3300046664 Bacteria 1329
372 Ga0495669_0052847 3300046684 Bacteria 1826
373 Ga0495669_0347858 3300046684 Bacteria 716
374 Ga0495636_0025108 3300047318 Bacteria 2418
375 Ga0495636_0184531 3300047318 Bacteria 948
376 Ga0496102_0016688 3300048905 Bacteria 6422
377 Ga0496102_0069317 3300048905 Bacteria 3237
378 Ga0496103_0212631 3300048906 Bacteria 1243
379 Ga0496103_0235790 3300048906 Bacteria 1177
380 Ga0496106_0126172 3300048909 Bacteria 2004
381 Ga0496107_0606989 3300048910 Unclassified 808
382 Ga0496108_1160405 3300048911 Bacteria 654
383 Ga0501031_0368126 3300049568 Bacteria 930
384 Ga0501033_0828959 3300049570 Bacteria 624
385 Ga0501036_0080571 3300049572 Bacteria 2752
386 Ga0501036_0470197 3300049572 Bacteria 1047
387 Ga0501036_1166553 3300049572 Bacteria 628
388 Ga0501038_0394152 3300049574 Bacteria 1072
389 Ga0501039_0242281 3300049575 Bacteria 1418
390 Ga0501039_0282330 3300049575 Bacteria 1305
391 Ga0501039_0326615 3300049575 Bacteria 1206
392 Ga0501039_0541790 3300049575 Unclassified 913
393 Ga0501039_0851366 3300049575 Bacteria 710
394 Ga0501040_0039297 3300049576 Bacteria 3218
395 Ga0501040_0084055 3300049576 Bacteria 2208
396 Ga0501040_0141582 3300049576 Bacteria 1694
397 Ga0501040_0407781 3300049576 Bacteria 976
398 Ga0501041_0103497 3300049577 Bacteria 1763
399 Ga0501042_0090087 3300049578 Bacteria 2201
400 Ga0501042_0226942 3300049578 Bacteria 1347
401 Ga0501042_1034708 3300049578 Unclassified 599
402 Ga0501043_0630598 3300049579 Bacteria 789
403 Ga0501043_1031648 3300049579 Bacteria 584
404 Ga0501046_0412475 3300049580 Unclassified 974
405 Ga0501046_0640443 3300049580 Bacteria 752
406 Ga0501046_0691353 3300049580 Bacteria 719
407 Ga0501048_0065526 3300049582 Bacteria 2568
408 Ga0501048_0067974 3300049582 Bacteria 2518
409 Ga0501048_0106666 3300049582 Bacteria 1978
410 Ga0501048_0548566 3300049582 Bacteria 829
411 Ga0501067_0007210 3300049583 Bacteria 6176
412 Ga0501067_0087305 3300049583 Bacteria 1731
413 Ga0501067_0104493 3300049583 Bacteria 1574
414 Ga0501068_0344109 3300049584 Bacteria 958
415 Ga0501068_0346258 3300049584 Unclassified 955
416 Ga0501068_0670621 3300049584 Bacteria 677
417 Ga0501068_0874516 3300049584 Bacteria 591
418 Ga0501069_0019306 3300049585 Bacteria 3685
419 Ga0501070_0289882 3300049586 Bacteria 1334
420 Ga0501071_0022220 3300049587 Bacteria 4422
421 Ga0501071_0175978 3300049587 Bacteria 1603
422 Ga0501071_0452686 3300049587 Bacteria 982
423 Ga0501071_0501656 3300049587 Bacteria 931
424 Ga0501072_0020501 3300049588 Bacteria 5123
425 Ga0501072_0039047 3300049588 Bacteria 3727
426 Ga0501072_0062484 3300049588 Bacteria 2938
427 Ga0501072_0064476 3300049588 Bacteria 2889
428 Ga0501072_1273884 3300049588 Unclassified 570
429 Ga0501074_0022640 3300049590 Bacteria 4568
430 Ga0501074_0080386 3300049590 Bacteria 2339
431 Ga0501074_0457872 3300049590 Bacteria 904
432 Ga0501074_0609262 3300049590 Bacteria 772
433 Ga0501075_0002649 3300049591 Bacteria 11965
434 Ga0501075_0109879 3300049591 Bacteria 2096
435 Ga0501075_0186840 3300049591 Bacteria 1581
436 Ga0501075_0306861 3300049591 Bacteria 1209
437 Ga0501075_0676959 3300049591 Unclassified 786
438 Ga0501076_0041982 3300049592 Bacteria 3601
439 Ga0501076_0048675 3300049592 Bacteria 3350
440 Ga0501076_0200562 3300049592 Bacteria 1629
441 Ga0501076_0678692 3300049592 Bacteria 850
442 Ga0501076_0757288 3300049592 Bacteria 801
443 Ga0501077_0036226 3300049593 Bacteria 3143
444 Ga0501077_0058115 3300049593 Bacteria 2455
445 Ga0501077_0131414 3300049593 Bacteria 1587
446 Ga0501077_0674861 3300049593 Bacteria 664
447 Ga0501225_0183069 3300049705 Unclassified 656
448 Ga0501079_0005032 3300049741 Bacteria 9812
449 Ga0501079_0007643 3300049741 Bacteria 8189
450 Ga0501079_0128453 3300049741 Bacteria 1972
451 Ga0501079_0411684 3300049741 Bacteria 1061
452 Ga0501079_0430131 3300049741 Bacteria 1036
453 Ga0501079_1151752 3300049741 Bacteria 611
454 Ga0501080_0241496 3300049742 Bacteria 1649
455 Ga0501080_0755643 3300049742 Bacteria 855
456 Ga0501081_0003039 3300049743 Bacteria 10650
457 Ga0501081_0051082 3300049743 Bacteria 2850
458 Ga0501081_0087438 3300049743 Bacteria 2189
459 Ga0501081_0204499 3300049743 Bacteria 1433
460 Ga0501081_0214668 3300049743 Bacteria 1398
461 Ga0501081_0423774 3300049743 Bacteria 987
462 Ga0501083_0296424 3300049744 Bacteria 1052
463 Ga0501083_0354815 3300049744 Bacteria 953
464 Ga0501045_0064474 3300049824 Bacteria 2689
465 Ga0501045_0146760 3300049824 Bacteria 1755
466 Ga0501045_0520074 3300049824 Bacteria 883
467 Ga0501045_0680844 3300049824 Bacteria 759
468 nmdc:mga05p37_1216637_c1 3300050507 Bacteria 777
469 nmdc:mga05p37_125624_c1 3300050507 Bacteria 3150
470 nmdc:mga05p37_1404966_c1 3300050507 Bacteria 703
471 nmdc:mga05p37_14502_c1 3300050507 Bacteria 9463
472 nmdc:mga05p37_1715993_c1 3300050507 Bacteria 611
473 nmdc:mga05p37_1721682_c1 3300050507 Bacteria 610
474 nmdc:mga05p37_181236_c1 3300050507 Bacteria 2562
475 nmdc:mga05p37_19180_c1 3300050507 Bacteria 8272
476 nmdc:mga05p37_345_c1 3300050507 Bacteria 49775
477 nmdc:mga05p37_371308_c1 3300050507 Bacteria 1679
478 nmdc:mga05p37_39564_c1 3300050507 Bacteria 5790
479 nmdc:mga05p37_554633_c1 3300050507 Bacteria 1307
480 nmdc:mga05p37_558164_c1 3300050507 Bacteria 1302
481 nmdc:mga05p37_6832_c1 3300050507 Bacteria 13446
482 nmdc:mga05p37_9241_c1 3300050507 Bacteria 11648
483 nmdc:mga09592_1072_c1 3300050508 Bacteria 21749
484 nmdc:mga09592_1098704_c1 3300050508 Bacteria 661
485 nmdc:mga09592_136326_c1 3300050508 Bacteria 2114
486 nmdc:mga09592_149936_c1 3300050508 Unclassified 2012
487 nmdc:mga09592_24786_c1 3300050508 Bacteria 4961
488 nmdc:mga09592_4926_c1 3300050508 Bacteria 10826
489 nmdc:mga09592_514835_c1 3300050508 Bacteria 1029
490 nmdc:mga09592_66238_c1 3300050508 Bacteria 3061
491 nmdc:mga09592_7091_c1 3300050508 Bacteria 9108
492 nmdc:mga0qj67_118681_c1 3300050509 Bacteria 2139
493 nmdc:mga0qj67_1443_c1 3300050509 Bacteria 16637
494 nmdc:mga0qj67_166435_c1 3300050509 Bacteria 1790
495 nmdc:mga0qj67_187503_c1 3300050509 Bacteria 1680
496 nmdc:mga0qj67_24399_c1 3300050509 Bacteria 4660
497 nmdc:mga0qj67_67396_c1 3300050509 Bacteria 2852
498 nmdc:mga06r32_1734_c1 3300050510 Bacteria 19615
499 nmdc:mga06r32_18298_c1 3300050510 Bacteria 6413
500 nmdc:mga06r32_22219_c1 3300050510 Bacteria 5862
501 nmdc:mga06r32_2337_c1 3300050510 Bacteria 17000
502 nmdc:mga06r32_285431_c1 3300050510 Unclassified 1637
503 nmdc:mga06r32_310365_c1 3300050510 Bacteria 1563
504 nmdc:mga06r32_46567_c1 3300050510 Bacteria 4138
505 nmdc:mga06r32_475670_c1 3300050510 Bacteria 1228
506 nmdc:mga06r32_913664_c1 3300050510 Bacteria 834
507 nmdc:mga06r32_97088_c1 3300050510 Bacteria 2887
508 nmdc:mga08y16_101430_c1 3300050511 Bacteria 2996
509 nmdc:mga08y16_14073_c1 3300050511 Bacteria 8422
510 nmdc:mga08y16_1870_c1 3300050511 Bacteria 21400
511 nmdc:mga08y16_716102_c1 3300050511 Bacteria 999
512 nmdc:mga0n895_1059683_c1 3300050512 Bacteria 790
513 nmdc:mga0n895_180685_c1 3300050512 Bacteria 2141
514 nmdc:mga0n895_24497_c1 3300050512 Bacteria 5688
515 nmdc:mga0n895_24560_c1 3300050512 Bacteria 5682
516 nmdc:mga0n895_249176_c1 3300050512 Unclassified 1802
517 nmdc:mga0n895_298727_c1 3300050512 Bacteria 1632
518 nmdc:mga0n895_399031_c1 3300050512 Bacteria 1391
519 nmdc:mga0n895_613445_c1 3300050512 Bacteria 1089
520 nmdc:mga0n895_634952_c1 3300050512 Unclassified 1068
521 nmdc:mga0n895_6919_c1 3300050512 Bacteria 9689
522 nmdc:mga0n895_695217_c1 3300050512 Bacteria 1013
523 nmdc:mga0n895_793691_c1 3300050512 Bacteria 938
524 nmdc:mga0rr50_39247_c1 3300050513 Bacteria 3433
525 nmdc:mga0rr50_39537_c1 3300050513 Bacteria 3422
526 nmdc:mga0rr50_41656_c1 3300050513 Bacteria 3348
527 nmdc:mga0rr50_439653_c1 3300050513 Bacteria 1105
528 nmdc:mga0rr50_526_c1 3300050513 Bacteria 20432
529 nmdc:mga0rr50_75314_c1 3300050513 Bacteria 2587
530 nmdc:mga08x19_108924_c1 3300050514 Bacteria 1846
531 nmdc:mga08x19_110622_c1 3300050514 Bacteria 1832
532 nmdc:mga08x19_4413_c1 3300050514 Bacteria 8342
533 nmdc:mga0a205_126988_c1 3300050515 Bacteria 2450
534 nmdc:mga0a205_127688_c1 3300050515 Bacteria 2443
535 nmdc:mga0a205_176389_c1 3300050515 Unclassified 2032
536 nmdc:mga0a205_21343_c1 3300050515 Bacteria 6127
537 nmdc:mga0a205_305143_c1 3300050515 Bacteria 1464
538 nmdc:mga0a205_440171_c1 3300050515 Bacteria 1164
539 nmdc:mga0a205_629486_c1 3300050515 Bacteria 925
540 nmdc:mga0a205_859856_c1 3300050515 Bacteria 754
541 nmdc:mga0a205_94360_c1 3300050515 Bacteria 2890
542 Ga0501084_0003155 3300054114 Bacteria 13331
543 Ga0501084_0005030 3300054114 Bacteria 10815
544 Ga0501084_0040729 3300054114 Bacteria 3887
545 Ga0501084_0158319 3300054114 Bacteria 1910
546 Ga0501084_0788288 3300054114 Unclassified 801
547 Ga0501084_1260306 3300054114 Bacteria 620
548 Ga0590071_022263 3300059421 Bacteria 1496
549 Ga0590074_054904 3300059423 Bacteria 733
550 Ga0590074_064327 3300059423 Bacteria 685
551 Ga0590075_062690 3300059424 Bacteria 958
552 Ga0590077_011480 3300059426 Bacteria 1830
553 Ga0501082_0145392 3300060353 Bacteria 2058
554 Ga0501082_0269306 3300060353 Bacteria 1482
555 Ga0501082_0299315 3300060353 Bacteria 1401
556 Ga0501082_0379029 3300060353 Bacteria 1234
557 Ga0530510_0037853 3300061734 Bacteria 3480
558 Ga0530510_0059782 3300061734 Bacteria 2757
559 Ga0530510_0107398 3300061734 Unclassified 2043
560 Ga0530510_0137478 3300061734 Bacteria 1799
561 Ga0530510_0173033 3300061734 Bacteria 1600
562 Ga0530510_0314544 3300061734 Bacteria 1173
563 Ga0530510_0435896 3300061734 Unclassified 990
564 Ga0530510_0698047 3300061734 Unclassified 773
565 Ga0075436_100065022
566 JGI25405J52794_10109551
567 Ga0065712_10402305
568 Ga0065715_10198706
569 Ga0065707_10143437
570 Ga0065707_10494215
571 Ga0070690_100143841
572 Ga0070690_100147992
573 Ga0068869_100000172
574 Ga0070680_100001506
575 Ga0070680_100012847
576 Ga0070680_100623906
577 Ga0070682_100000273
578 Ga0070689_100078316
579 Ga0070689_100911183
580 Ga0070691_10020593
581 Ga0070687_100701489
582 Ga0070661_100009656
583 Ga0070692_10010295
584 Ga0070692_10138199
585 Ga0070668_100812050
586 Ga0070669_100037663
587 Ga0070669_100084639
588 Ga0070673_100733600
589 Ga0070659_100009310
590 Ga0070705_100004628
591 Ga0070705_100011166
592 Ga0070705_100039180
593 Ga0070705_101097158
594 Ga0070700_100843096
595 Ga0070694_100003162
596 Ga0070694_100007918
597 Ga0070694_100094477
598 Ga0070694_100305728
599 Ga0070708_100034282
600 Ga0070708_100051373
601 Ga0070708_100083842
602 Ga0070708_100249792
603 Ga0070708_100338739
604 Ga0070708_100508239
605 Ga0070708_100591112
606 Ga0070708_101333643
607 Ga0070663_100165356
608 Ga0070662_100056647
609 Ga0070662_100216235
610 Ga0070681_10010009
611 Ga0068867_100205725
612 Ga0068867_100677592
613 Ga0070706_100004837
614 Ga0070706_100063011
615 Ga0070706_100218422
616 Ga0070707_100000549
617 Ga0070707_100005757
618 Ga0070707_100546459
619 Ga0070698_100116897
620 Ga0070698_100391062
621 Ga0070699_100000309
622 Ga0070699_100068167
623 Ga0070699_100081715
624 Ga0070699_100232073
625 Ga0070699_100263997
626 Ga0070679_100000834
627 Ga0070679_100268374
628 Ga0070697_100010942
629 Ga0070697_100064723
630 Ga0070697_100085244
631 Ga0070672_100038225
632 Ga0070686_100120859
633 Ga0070695_100003200
634 Ga0070695_100017126
635 Ga0070695_100098175
636 Ga0070695_101476953
637 Ga0070696_100008412
638 Ga0070696_100009494
639 Ga0070696_100056446
640 Ga0070696_100059755
641 Ga0070696_100210259
642 Ga0070693_100007985
643 Ga0070693_100528858
644 Ga0070704_100005191
645 Ga0070704_100008651
646 Ga0070704_100046413
647 Ga0070704_100072797
648 Ga0070704_100292057
649 Ga0070704_101096202
650 Ga0070704_101368889
651 Ga0068855_100001987
652 Ga0070664_100018048
653 Ga0068857_100026269
654 Ga0068854_100693776
655 Ga0068856_100001350
656 Ga0068859_100059870
657 Ga0068859_100166295
658 Ga0068859_100224954
659 Ga0068859_101094035
660 Ga0068864_100174685
661 Ga0068864_101601490
662 Ga0068866_10134984
663 Ga0068861_100149919
664 Ga0068861_100345025
665 Ga0068861_101103026
666 Ga0068861_101892377
667 Ga0068870_10067973
668 Ga0068870_10873487
669 Ga0068863_100004195
670 Ga0068863_100155823
671 Ga0068863_100492775
672 Ga0068860_100035095
673 Ga0068860_100097737
674 Ga0068860_100128315
675 Ga0068862_100155247
676 Ga0068862_100290578
677 Ga0068862_100379541
678 Ga0068862_100399002
679 Ga0068862_100826311
680 Ga0068862_101502053
681 Ga0081455_10071797
682 Ga0081455_10342401
683 Ga0081455_10355337
684 Ga0081540_1011700
685 Ga0081539_10000002
686 Ga0070715_10528702
687 Ga0070716_100140334
688 Ga0070716_100974379
689 Ga0070716_101280419
690 Ga0068871_100208161
691 Ga0075428_100000227
692 Ga0075428_100026595
693 Ga0075428_100045869
694 Ga0075428_100047988
695 Ga0075428_100063398
696 Ga0075428_100069536
697 Ga0075428_100086597
698 Ga0075428_100187478
699 Ga0075430_100000123
700 Ga0075430_100005945
701 Ga0075430_100006432
702 Ga0075430_100024288
703 Ga0075430_100030069
704 Ga0075430_100047305
705 Ga0075430_100142202
706 Ga0075430_100304561
707 Ga0075431_100001277
708 Ga0075431_100002346
709 Ga0075431_100004293
710 Ga0075431_100004929
711 Ga0075431_100005228
712 Ga0075431_100006664
713 Ga0075431_100030682
714 Ga0075431_100037500
715 Ga0075431_100199789
716 Ga0075431_100298567
717 Ga0075431_100841989
718 Ga0075433_10004904
719 Ga0075433_10042123
720 Ga0075433_10069093
721 Ga0075433_10183575
722 Ga0075433_10211967
723 Ga0075433_10571117
724 Ga0075433_10703806
725 Ga0075433_11030167
726 Ga0075433_11206102
727 Ga0075434_100006728
728 Ga0075434_100026631
729 Ga0075434_100041714
730 Ga0075434_100049606
731 Ga0075434_100093883
732 Ga0075434_100327064
733 Ga0075434_100446273
734 Ga0075434_100549241
735 Ga0075434_100751007
736 Ga0075429_100006235
737 Ga0075429_100007789
738 Ga0075429_100008036
739 Ga0075429_100010967
740 Ga0075429_100012282
741 Ga0075429_100036725
742 Ga0075429_100447730
743 Ga0075429_100603573
744 Ga0075429_101130818
745 Ga0068865_100040484
746 Ga0075436_100003235
747 Ga0075436_100057619
748 Ga0075436_100125685
749 Ga0097620_100059869
750 Ga0097620_100166303
751 Ga0097620_100224958
752 Ga0097620_101093876
753 Ga0075435_100001344
754 Ga0075435_100027365
755 Ga0075435_100031041
756 Ga0075435_100071830
757 Ga0075435_100156163
758 Ga0075435_100355530
759 Ga0099794_10025977
760 Ga0099794_10080853
761 Ga0099794_10122045
762 Ga0099794_10547082
763 Ga0111539_10054463
764 Ga0111539_10097399
765 Ga0111539_10131654
766 Ga0111539_10661479
767 Ga0105245_10592780
768 Ga0114129_10000037
769 Ga0114129_10000479
770 Ga0114129_10004120
771 Ga0114129_10013284
772 Ga0114129_10013954
773 Ga0114129_10016825
774 Ga0114129_10059442
775 Ga0114129_10065760
776 Ga0114129_10132735
777 Ga0114129_10205344
778 Ga0114129_10580302
779 Ga0114129_10813253
780 Ga0114129_11067504
781 Ga0114129_11415265
782 Ga0114129_11794920
783 Ga0105243_10030545
784 Ga0105243_11052471
785 Ga0105241_10002462
786 Ga0105241_10028884
787 Ga0105248_10189107
788 Ga0105248_10884797
789 Ga0105238_10684200
790 Ga0105249_10041393
791 Ga0105239_10124089
792 Ga0105246_10199004
793 Ga0157373_10056784
794 Ga0157370_10167949
795 Ga0157369_10822197
796 Ga0157378_10130279
797 Ga0157378_10463117
798 Ga0163162_10009498
799 Ga0163162_10965103
800 Ga0163162_11858224
801 Ga0157372_10000738
802 Ga0157375_11710512
803 Ga0157380_10170067
804 Ga0182008_10148595
805 Ga0157377_10871163
806 Ga0182007_10048894
807 Ga0163161_10224737
808 Ga0206353_11776028
809 Ga0207642_10081784
810 Ga0207642_10146552
811 Ga0207647_10470288
812 Ga0207645_10092883
813 Ga0207643_10022078
814 Ga0207643_10469762
815 Ga0207684_10000105
816 Ga0207684_10009895
817 Ga0207684_10050557
818 Ga0207654_10020533
819 Ga0207654_10105929
820 Ga0207707_10000169
821 Ga0207707_10392027
822 Ga0207660_10001109
823 Ga0207660_10021963
824 Ga0207660_10292594
825 Ga0207657_10018039
826 Ga0207649_10022765
827 Ga0207652_10001388
828 Ga0207646_10004489
829 Ga0207646_10021381
830 Ga0207646_10514006
831 Ga0207646_10851732
832 Ga0207681_10274753
833 Ga0207650_11324326
834 Ga0207690_10004668
835 Ga0207706_10000910
836 Ga0207706_10027875
837 Ga0207686_10489853
838 Ga0207670_10021424
839 Ga0207704_10076419
840 Ga0207704_10276702
841 Ga0207665_10383035
842 Ga0207665_10574013
843 Ga0207691_10037619
844 Ga0207689_10000006
845 Ga0207679_10012675
846 Ga0207667_10000482
847 Ga0207651_10886376
848 Ga0207668_10810711
849 Ga0207640_10051676
850 Ga0207678_10020274
851 Ga0207708_10099031
852 Ga0207702_10006067
853 Ga0207641_10111349
854 Ga0207641_10275911
855 Ga0207641_10356191
856 Ga0207648_10082043
857 Ga0207648_10450253
858 Ga0207676_10100425
859 Ga0207676_11429748
860 Ga0207674_10031159
861 Ga0207675_100037335
862 Ga0207675_100038549
863 Ga0207675_100443314
864 Ga0207675_100728124
865 Ga0207675_101520452
866 Ga0207675_102004156
867 Ga0207675_102097434
868 Ga0207683_11908728
869 Ga0209983_1055271
870 Ga0209588_1035337
871 Ga0209971_1039305
872 Ga0209966_1015600
873 Ga0207428_10026634
874 Ga0207428_10356352
875 Ga0268265_10034543
876 Ga0268265_10247127
877 Ga0268265_10331099
878 Ga0268265_10335384
879 Ga0268265_10814252
880 Ga0268264_10001879
881 Ga0268264_10168077
882 Ga0268264_10431926
883 Ga0268264_11351219
884 Ga0307408_100004291
885 Ga0307408_100024078
886 Ga0307408_100785058
887 Ga0307405_10608201
888 Ga0307413_11911282
889 Ga0307406_10366544
890 Ga0307412_10311054
891 Ga0307409_100058051
892 Ga0307409_100451925
893 Ga0307409_100946802
894 Ga0307416_100168890
895 Ga0307414_10205754
896 Ga0307411_11131695
897 Ga0373948_0031749
898 Ga0373959_0046788
899 Ga0373940_0126191
900 Ga0373939_0081036
901 Ga0373939_0484100
902 Ga0373941_0205330
903 Ga0373961_0009508
904 Ga0373961_0137528
905 Ga0373931_0002597
906 Ga0395899_0214547
907 Ga0395900_0004055
908 Ga0395898_0053961
909 Ga0395905_0371136
910 Ga0395905_0987133
911 Ga0395901_0004871
912 Ga0242420_012430
913 Ga0242420_047897
914 Ga0436365_0346878
915 Ga0439441_080243
916 Ga0439448_0001714
917 Ga0439459_0003393
918 Ga0439460_0009793
919 Ga0451577_0162378
920 Ga0453683_0291744
921 Ga0453684_0316146
922 Ga0453684_1726323
923 Ga0451576_0011860
924 Ga0451576_0430211
925 Ga0451576_0748371
926 Ga0495603_0187535
927 Ga0495580_0000443
928 Ga0495584_0311296
929 Ga0495584_0623202
930 Ga0495642_0014719
931 Ga0495642_0546555
932 Ga0495656_0190956
933 Ga0495611_0336228
934 Ga0495659_0015276
935 Ga0495659_0068030
936 Ga0495669_0052847
937 Ga0495669_0347858
938 Ga0495636_0025108
939 Ga0495636_0184531
940 Ga0496102_0016688
941 Ga0496102_0069317
942 Ga0496103_0212631
943 Ga0496103_0235790
944 Ga0496106_0126172
945 Ga0496107_0606989
946 Ga0496108_1160405
947 Ga0501031_0368126
948 Ga0501033_0828959
949 Ga0501036_0080571
950 Ga0501036_0470197
951 Ga0501036_1166553
952 Ga0501038_0394152
953 Ga0501039_0242281
954 Ga0501039_0282330
955 Ga0501039_0326615
956 Ga0501039_0541790
957 Ga0501039_0851366
958 Ga0501040_0039297
959 Ga0501040_0084055
960 Ga0501040_0141582
961 Ga0501040_0407781
962 Ga0501041_0103497
963 Ga0501042_0090087
964 Ga0501042_0226942
965 Ga0501042_1034708
966 Ga0501043_0630598
967 Ga0501043_1031648
968 Ga0501046_0412475
969 Ga0501046_0640443
970 Ga0501046_0691353
971 Ga0501048_0065526
972 Ga0501048_0067974
973 Ga0501048_0106666
974 Ga0501048_0548566
975 Ga0501067_0007210
976 Ga0501067_0087305
977 Ga0501067_0104493
978 Ga0501068_0344109
979 Ga0501068_0346258
980 Ga0501068_0670621
981 Ga0501068_0874516
982 Ga0501069_0019306
983 Ga0501070_0289882
984 Ga0501071_0022220
985 Ga0501071_0175978
986 Ga0501071_0452686
987 Ga0501071_0501656
988 Ga0501072_0020501
989 Ga0501072_0039047
990 Ga0501072_0062484
991 Ga0501072_0064476
992 Ga0501072_1273884
993 Ga0501074_0022640
994 Ga0501074_0080386
995 Ga0501074_0457872
996 Ga0501074_0609262
997 Ga0501075_0002649
998 Ga0501075_0109879
999 Ga0501075_0186840
1000 Ga0501075_0306861
1001 Ga0501075_0676959
1002 Ga0501076_0041982
1003 Ga0501076_0048675
1004 Ga0501076_0200562
1005 Ga0501076_0678692
1006 Ga0501076_0757288
1007 Ga0501077_0036226
1008 Ga0501077_0058115
1009 Ga0501077_0131414
1010 Ga0501077_0674861
1011 Ga0501225_0183069
1012 Ga0501079_0005032
1013 Ga0501079_0007643
1014 Ga0501079_0128453
1015 Ga0501079_0411684
1016 Ga0501079_0430131
1017 Ga0501079_1151752
1018 Ga0501080_0241496
1019 Ga0501080_0755643
1020 Ga0501081_0003039
1021 Ga0501081_0051082
1022 Ga0501081_0087438
1023 Ga0501081_0204499
1024 Ga0501081_0214668
1025 Ga0501081_0423774
1026 Ga0501083_0296424
1027 Ga0501083_0354815
1028 Ga0501045_0064474
1029 Ga0501045_0146760
1030 Ga0501045_0520074
1031 Ga0501045_0680844
1032 nmdc:mga05p37_1216637_c1
1033 nmdc:mga05p37_125624_c1
1034 nmdc:mga05p37_1404966_c1
1035 nmdc:mga05p37_14502_c1
1036 nmdc:mga05p37_1715993_c1
1037 nmdc:mga05p37_1721682_c1
1038 nmdc:mga05p37_181236_c1
1039 nmdc:mga05p37_19180_c1
1040 nmdc:mga05p37_345_c1
1041 nmdc:mga05p37_371308_c1
1042 nmdc:mga05p37_39564_c1
1043 nmdc:mga05p37_554633_c1
1044 nmdc:mga05p37_558164_c1
1045 nmdc:mga05p37_6832_c1
1046 nmdc:mga05p37_9241_c1
1047 nmdc:mga09592_1072_c1
1048 nmdc:mga09592_1098704_c1
1049 nmdc:mga09592_136326_c1
1050 nmdc:mga09592_149936_c1
1051 nmdc:mga09592_24786_c1
1052 nmdc:mga09592_4926_c1
1053 nmdc:mga09592_514835_c1
1054 nmdc:mga09592_66238_c1
1055 nmdc:mga09592_7091_c1
1056 nmdc:mga0qj67_118681_c1
1057 nmdc:mga0qj67_1443_c1
1058 nmdc:mga0qj67_166435_c1
1059 nmdc:mga0qj67_187503_c1
1060 nmdc:mga0qj67_24399_c1
1061 nmdc:mga0qj67_67396_c1
1062 nmdc:mga06r32_1734_c1
1063 nmdc:mga06r32_18298_c1
1064 nmdc:mga06r32_22219_c1
1065 nmdc:mga06r32_2337_c1
1066 nmdc:mga06r32_285431_c1
1067 nmdc:mga06r32_310365_c1
1068 nmdc:mga06r32_46567_c1
1069 nmdc:mga06r32_475670_c1
1070 nmdc:mga06r32_913664_c1
1071 nmdc:mga06r32_97088_c1
1072 nmdc:mga08y16_101430_c1
1073 nmdc:mga08y16_14073_c1
1074 nmdc:mga08y16_1870_c1
1075 nmdc:mga08y16_716102_c1
1076 nmdc:mga0n895_1059683_c1
1077 nmdc:mga0n895_180685_c1
1078 nmdc:mga0n895_24497_c1
1079 nmdc:mga0n895_24560_c1
1080 nmdc:mga0n895_249176_c1
1081 nmdc:mga0n895_298727_c1
1082 nmdc:mga0n895_399031_c1
1083 nmdc:mga0n895_613445_c1
1084 nmdc:mga0n895_634952_c1
1085 nmdc:mga0n895_6919_c1
1086 nmdc:mga0n895_695217_c1
1087 nmdc:mga0n895_793691_c1
1088 nmdc:mga0rr50_39247_c1
1089 nmdc:mga0rr50_39537_c1
1090 nmdc:mga0rr50_41656_c1
1091 nmdc:mga0rr50_439653_c1
1092 nmdc:mga0rr50_526_c1
1093 nmdc:mga0rr50_75314_c1
1094 nmdc:mga08x19_108924_c1
1095 nmdc:mga08x19_110622_c1
1096 nmdc:mga08x19_4413_c1
1097 nmdc:mga0a205_126988_c1
1098 nmdc:mga0a205_127688_c1
1099 nmdc:mga0a205_176389_c1
1100 nmdc:mga0a205_21343_c1
1101 nmdc:mga0a205_305143_c1
1102 nmdc:mga0a205_440171_c1
1103 nmdc:mga0a205_629486_c1
1104 nmdc:mga0a205_859856_c1
1105 nmdc:mga0a205_94360_c1
1106 Ga0501084_0003155
1107 Ga0501084_0005030
1108 Ga0501084_0040729
1109 Ga0501084_0158319
1110 Ga0501084_0788288
1111 Ga0501084_1260306
1112 Ga0590071_022263
1113 Ga0590074_054904
1114 Ga0590074_064327
1115 Ga0590075_062690
1116 Ga0590077_011480
1117 Ga0501082_0145392
1118 Ga0501082_0269306
1119 Ga0501082_0299315
1120 Ga0501082_0379029
1121 Ga0530510_0037853
1122 Ga0530510_0059782
1123 Ga0530510_0107398
1124 Ga0530510_0137478
1125 Ga0530510_0173033
1126 Ga0530510_0314544
1127 Ga0530510_0435896
1128 Ga0530510_0698047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

21

156

0.95

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

60

163

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.8548 8 156
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.8486 6 156
7svt-assembly4.cif.gz_V mycobacterium tuberculosis 3-hydroxyl-acp dehydratase hadab in complex with 1,3-diarylpyrazolyl-acylsulfonamide inhibitor 0.8482 6 156
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8478 6 157
4rlu-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with 2',4,4'-trihydroxychalcone 0.8431 3 157
ID Description Score Start End Superfamily
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8656 91 153 3.10.129.10
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8396 91 153 3.10.129.10
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8387 6 156 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8362 3 156 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8198 9 153 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3B8XGC4-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9362 91 156
AF-A0A538R9T4-F1-model_v4 MaoC family dehydratase 0.9346 1 157
AF-A0A2S9F2V6-F1-model_v4 Acyl dehydratase 0.9294 90 157
AF-A0A2V7CZF9-F1-model_v4 MaoC family dehydratase 0.9286 1 157
AF-X0X662-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9256 90 155

Map