F462625

General Info

Members Datasets Scaffolds Average Seq Length
551 276 1102 133

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10095186|Ga0265334_100951862
Length 149
Sequence MAHMKGKPNMQAKSDMQDIWVPVSPGELLDKITILRIKVVRITDPAKAANVRLELDLLEKTWRDAGCADFDVARDERALQAVNERLWDVEDLIRDKEAKQTFDREFIDLARAVYVSNDERAAIKKRINLQLGSRLVEEKSYKPYGPGPT

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
203 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
204 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
273 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
274 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 8.89
Rhizosphere 80.76
Stem 0
Stem Tuber 0
Unclassified 16.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10095186 3300028573 Unclassified 1083
2 SwRhRL3b_contig_893834 2162886006 Bacteria 2031
3 MRS1b_contig_452932 2162886011 Bacteria 935
4 LJNas_1011351 3300000546 Bacteria 950
5 JGI25406J46586_10010137 3300003203 Bacteria 4192
6 rootH2_10138626 3300003320 Unclassified 1815
7 Ga0065704_10546131 3300005289 Bacteria 638
8 Ga0065707_10081916 3300005295 Bacteria 29636
9 Ga0070670_100480767 3300005331 Unclassified 1103
10 Ga0068869_101386681 3300005334 Bacteria 622
11 Ga0070666_10005361 3300005335 Bacteria 7862
12 Ga0070666_10440684 3300005335 Bacteria 940
13 Ga0070680_100028917 3300005336 Bacteria 4449
14 Ga0068868_100003468 3300005338 Bacteria 10984
15 Ga0068868_100184425 3300005338 Bacteria 1733
16 Ga0070689_101182812 3300005340 Bacteria 686
17 Ga0070689_101343292 3300005340 Unclassified 645
18 Ga0070668_101371839 3300005347 Bacteria 644
19 Ga0070669_100425450 3300005353 Bacteria 1090
20 Ga0070671_100015169 3300005355 Bacteria 6223
21 Ga0070671_100039787 3300005355 Bacteria 3903
22 Ga0070671_100085202 3300005355 Bacteria 2643
23 Ga0070671_100127534 3300005355 Bacteria 2142
24 Ga0070674_100505617 3300005356 Bacteria 1007
25 Ga0070673_100146827 3300005364 Bacteria 1994
26 Ga0070673_101656056 3300005364 Bacteria 605
27 Ga0070673_101896280 3300005364 Bacteria 565
28 Ga0070667_100030898 3300005367 Bacteria 4466
29 Ga0070667_100192873 3300005367 Bacteria 1805
30 Ga0070667_100399388 3300005367 Unclassified 1251
31 Ga0070667_100445718 3300005367 Bacteria 1182
32 Ga0070709_10026260 3300005434 Bacteria 3450
33 Ga0070709_10174929 3300005434 Bacteria 1503
34 Ga0070709_11396644 3300005434 Unclassified 567
35 Ga0070714_100080696 3300005435 Bacteria 2831
36 Ga0070714_100706744 3300005435 Bacteria 973
37 Ga0070714_100746039 3300005435 Unclassified 946
38 Ga0070714_101180161 3300005435 Bacteria 747
39 Ga0070713_100012193 3300005436 Bacteria 6296
40 Ga0070713_100135278 3300005436 Bacteria 2177
41 Ga0070713_100590099 3300005436 Bacteria 1055
42 Ga0070710_10051060 3300005437 Bacteria 2321
43 Ga0070710_10452114 3300005437 Unclassified 871
44 Ga0070710_10893689 3300005437 Unclassified 641
45 Ga0070701_10168989 3300005438 Bacteria 1272
46 Ga0070701_11232945 3300005438 Bacteria 532
47 Ga0070711_100006699 3300005439 Bacteria 6968
48 Ga0070711_100024797 3300005439 Bacteria 3917
49 Ga0070711_100457678 3300005439 Bacteria 1045
50 Ga0070705_100074211 3300005440 Bacteria 2067
51 Ga0070700_100157129 3300005441 Bacteria 1561
52 Ga0070663_101005960 3300005455 Bacteria 725
53 Ga0070678_100023192 3300005456 Bacteria 4131
54 Ga0070681_10002918 3300005458 Bacteria 15836
55 Ga0070681_10313167 3300005458 Unclassified 1479
56 Ga0068867_100114389 3300005459 Bacteria 2077
57 Ga0068867_100188729 3300005459 Bacteria 1643
58 Ga0070685_10060579 3300005466 Bacteria 2214
59 Ga0070706_101863563 3300005467 Bacteria 546
60 Ga0070679_100011110 3300005530 Bacteria 8571
61 Ga0070679_100159511 3300005530 Bacteria 2230
62 Ga0070679_101557733 3300005530 Unclassified 608
63 Ga0070684_100302578 3300005535 Bacteria 1468
64 Ga0070697_100862946 3300005536 Bacteria 802
65 Ga0068853_100493799 3300005539 Bacteria 1155
66 Ga0070672_100181824 3300005543 Bacteria 1752
67 Ga0070686_100354622 3300005544 Unclassified 1103
68 Ga0070686_100579776 3300005544 Bacteria 881
69 Ga0070695_100009570 3300005545 Bacteria 5773
70 Ga0070695_100265966 3300005545 Bacteria 1254
71 Ga0070696_100105576 3300005546 Unclassified 2024
72 Ga0070696_100229215 3300005546 Bacteria 1397
73 Ga0070693_100114686 3300005547 Bacteria 1663
74 Ga0070665_100009141 3300005548 Bacteria 10040
75 Ga0070665_100012682 3300005548 Bacteria 8488
76 Ga0070665_100043648 3300005548 Bacteria 4505
77 Ga0070665_100061063 3300005548 Bacteria 3778
78 Ga0070665_100072017 3300005548 Bacteria 3463
79 Ga0070665_100753174 3300005548 Bacteria 987
80 Ga0070704_100556318 3300005549 Unclassified 1003
81 Ga0068855_100029480 3300005563 Bacteria 6559
82 Ga0068855_101379679 3300005563 Unclassified 727
83 Ga0068856_100513092 3300005614 Bacteria 1220
84 Ga0068856_100547949 3300005614 Bacteria 1178
85 Ga0070702_101621188 3300005615 Bacteria 536
86 Ga0068852_100330964 3300005616 Bacteria 1482
87 Ga0068852_100801810 3300005616 Bacteria 956
88 Ga0068859_100000607 3300005617 Bacteria 35844
89 Ga0068859_100082262 3300005617 Bacteria 3262
90 Ga0068859_100121827 3300005617 Bacteria 2675
91 Ga0068859_100172906 3300005617 Bacteria 2242
92 Ga0068864_100070000 3300005618 Bacteria 3052
93 Ga0068864_100580417 3300005618 Bacteria 1086
94 Ga0068864_100782639 3300005618 Unclassified 937
95 Ga0068864_101444348 3300005618 Bacteria 690
96 Ga0068866_10019756 3300005718 Bacteria 3074
97 Ga0068861_100176385 3300005719 Unclassified 1775
98 Ga0068861_100795596 3300005719 Bacteria 887
99 Ga0068851_10192592 3300005834 Bacteria 1134
100 Ga0068870_10000854 3300005840 Bacteria 11890
101 Ga0068863_100004570 3300005841 Bacteria 13648
102 Ga0068863_100064699 3300005841 Bacteria 3459
103 Ga0068858_100008412 3300005842 Bacteria 9924
104 Ga0068858_100010907 3300005842 Bacteria 8590
105 Ga0068858_100043779 3300005842 Bacteria 4150
106 Ga0068860_100057188 3300005843 Bacteria 3707
107 Ga0068860_100105346 3300005843 Bacteria 2693
108 Ga0068862_100062693 3300005844 Bacteria 3198
109 Ga0068862_100207150 3300005844 Bacteria 1770
110 Ga0081539_10000006 3300005985 Bacteria 534555
111 Ga0070715_10000689 3300006163 Bacteria 9059
112 Ga0070716_100010768 3300006173 Bacteria 4596
113 Ga0070716_100036957 3300006173 Bacteria 2696
114 Ga0070716_100195913 3300006173 Bacteria 1339
115 Ga0070716_100799337 3300006173 Unclassified 730
116 Ga0070716_100915210 3300006173 Bacteria 688
117 Ga0070712_100016649 3300006175 Bacteria 4750
118 Ga0070712_100359149 3300006175 Unclassified 1194
119 Ga0070712_100438742 3300006175 Bacteria 1085
120 Ga0070712_100891472 3300006175 Bacteria 766
121 Ga0070712_101455313 3300006175 Bacteria 598
122 Ga0097621_100009768 3300006237 Bacteria 6985
123 Ga0097621_100154982 3300006237 Bacteria 1966
124 Ga0097621_100256696 3300006237 Bacteria 1532
125 Ga0097621_101032880 3300006237 Bacteria 770
126 Ga0068871_100060969 3300006358 Unclassified 3079
127 Ga0068871_100209280 3300006358 Bacteria 1686
128 Ga0068871_101126950 3300006358 Bacteria 734
129 Ga0075434_100209407 3300006871 Bacteria 1970
130 Ga0068865_100002046 3300006881 Bacteria 11908
131 Ga0068865_100187965 3300006881 Bacteria 1595
132 Ga0068865_100615387 3300006881 Unclassified 919
133 Ga0075436_100357480 3300006914 Bacteria 1053
134 Ga0097620_100000607 3300006931 Bacteria 35844
135 Ga0097620_100082262 3300006931 Bacteria 3262
136 Ga0097620_100121825 3300006931 Bacteria 2675
137 Ga0097620_100172918 3300006931 Bacteria 2242
138 Ga0075435_100229630 3300007076 Bacteria 1577
139 Ga0099794_10078351 3300007265 Bacteria 1627
140 Ga0099794_10246963 3300007265 Unclassified 920
141 Ga0099795_10000018 3300007788 Bacteria 61029
142 Ga0099795_10165418 3300007788 Bacteria 916
143 Ga0099795_10455377 3300007788 Bacteria 590
144 Ga0105251_10150108 3300009011 Bacteria 1053
145 Ga0105250_10014797 3300009092 Bacteria 3200
146 Ga0105240_10027986 3300009093 Bacteria 7371
147 Ga0105240_10063221 3300009093 Bacteria 4605
148 Ga0105240_10106194 3300009093 Unclassified 3407
149 Ga0105240_10113737 3300009093 Bacteria 3270
150 Ga0105240_10153250 3300009093 Unclassified 2743
151 Ga0105240_10240033 3300009093 Bacteria 2101
152 Ga0105240_10249738 3300009093 Bacteria 2052
153 Ga0105240_10347396 3300009093 Bacteria 1684
154 Ga0105240_10360689 3300009093 Unclassified 1646
155 Ga0105240_10427067 3300009093 Bacteria 1488
156 Ga0105240_10757316 3300009093 Bacteria 1055
157 Ga0105240_11498343 3300009093 Unclassified 707
158 Ga0111539_11577593 3300009094 Unclassified 761
159 Ga0111539_12344841 3300009094 Bacteria 619
160 Ga0105245_10007272 3300009098 Bacteria 9695
161 Ga0105245_10092782 3300009098 Bacteria 2781
162 Ga0105245_10894215 3300009098 Unclassified 929
163 Ga0105245_12251255 3300009098 Bacteria 599
164 Ga0105247_10009956 3300009101 Bacteria 5758
165 Ga0105247_10014175 3300009101 Bacteria 4782
166 Ga0105247_10612797 3300009101 Bacteria 809
167 Ga0105243_11295660 3300009148 Unclassified 745
168 Ga0105241_10168782 3300009174 Bacteria 1806
169 Ga0105241_10630460 3300009174 Unclassified 971
170 Ga0105242_10020423 3300009176 Bacteria 5194
171 Ga0105248_10001780 3300009177 Bacteria 23957
172 Ga0105248_10060480 3300009177 Bacteria 4253
173 Ga0105248_10158980 3300009177 Bacteria 2549
174 Ga0105248_12053909 3300009177 Unclassified 650
175 Ga0105237_10073885 3300009545 Bacteria 3401
176 Ga0105237_10199212 3300009545 Bacteria 2002
177 Ga0105237_11379909 3300009545 Bacteria 711
178 Ga0105237_11517326 3300009545 Bacteria 677
179 Ga0105238_10147035 3300009551 Bacteria 2333
180 Ga0105238_10191255 3300009551 Bacteria 2023
181 Ga0105238_10752309 3300009551 Unclassified 989
182 Ga0105238_11054845 3300009551 Bacteria 835
183 Ga0105249_10185118 3300009553 Bacteria 2029
184 Ga0105249_10209287 3300009553 Bacteria 1913
185 Ga0105249_10388852 3300009553 Bacteria 1422
186 Ga0105249_10752677 3300009553 Bacteria 1036
187 Ga0105249_11042561 3300009553 Bacteria 887
188 Ga0099796_10000081 3300010159 Bacteria 15981
189 Ga0099796_10007269 3300010159 Bacteria 2887
190 Ga0099796_10010466 3300010159 Bacteria 2551
191 Ga0105239_10033174 3300010375 Bacteria 5670
192 Ga0105239_10350742 3300010375 Bacteria 1666
193 Ga0105239_10574323 3300010375 Bacteria 1285
194 Ga0105239_11013510 3300010375 Bacteria 955
195 Ga0157369_10013670 3300013105 Bacteria 9179
196 Ga0157369_10284182 3300013105 Bacteria 1723
197 Ga0157374_10008107 3300013296 Bacteria 8977
198 Ga0157374_10274509 3300013296 Bacteria 1663
199 Ga0157374_10679893 3300013296 Bacteria 1042
200 Ga0157378_10026649 3300013297 Bacteria 5095
201 Ga0163162_10022537 3300013306 Bacteria 6207
202 Ga0163162_10063063 3300013306 Bacteria 3748
203 Ga0163162_10074075 3300013306 Bacteria 3462
204 Ga0157372_11364467 3300013307 Bacteria 817
205 Ga0157375_10004755 3300013308 Bacteria 11801
206 Ga0157375_10532131 3300013308 Bacteria 1338
207 Ga0157375_10804413 3300013308 Unclassified 1088
208 Ga0163163_10008201 3300014325 Bacteria 9266
209 Ga0163163_10018474 3300014325 Bacteria 6528
210 Ga0163163_10091409 3300014325 Bacteria 3058
211 Ga0163163_10240717 3300014325 Bacteria 1859
212 Ga0163163_10268907 3300014325 Bacteria 1756
213 Ga0163163_10296818 3300014325 Bacteria 1668
214 Ga0163163_12334419 3300014325 Unclassified 594
215 Ga0157380_10449624 3300014326 Bacteria 1237
216 Ga0157380_10943419 3300014326 Bacteria 892
217 Ga0157377_11778335 3300014745 Unclassified 500
218 Ga0157379_10001822 3300014968 Bacteria 17598
219 Ga0157379_10029925 3300014968 Bacteria 4843
220 Ga0157379_10073458 3300014968 Bacteria 3061
221 Ga0157379_10086803 3300014968 Unclassified 2805
222 Ga0157379_10136769 3300014968 Unclassified 2208
223 Ga0157379_11063255 3300014968 Bacteria 774
224 Ga0157376_10002659 3300014969 Bacteria 12142
225 Ga0157376_10495902 3300014969 Bacteria 1199
226 Ga0157376_11485236 3300014969 Bacteria 710
227 Ga0206354_10056148 3300020081 Bacteria 730
228 Ga0213874_10004199 3300021377 Bacteria 3260
229 Ga0213874_10004484 3300021377 Bacteria 3193
230 Ga0213876_10233907 3300021384 Bacteria 977
231 Ga0213871_10061744 3300021441 Bacteria 1045
232 Ga0228598_1007062 3300024227 Bacteria 2304
233 Ga0207697_10300112 3300025315 Bacteria 712
234 Ga0207682_10009029 3300025893 Bacteria 3939
235 Ga0207692_10015390 3300025898 Bacteria 3365
236 Ga0207692_10275680 3300025898 Unclassified 1016
237 Ga0207692_10535030 3300025898 Bacteria 747
238 Ga0207692_11045128 3300025898 Unclassified 540
239 Ga0207710_10005193 3300025900 Bacteria 5629
240 Ga0207680_10418028 3300025903 Unclassified 949
241 Ga0207685_10003701 3300025905 Bacteria 3764
242 Ga0207699_10072424 3300025906 Bacteria 2110
243 Ga0207645_10364578 3300025907 Bacteria 968
244 Ga0207643_10010315 3300025908 Bacteria 5029
245 Ga0207654_10282935 3300025911 Bacteria 1122
246 Ga0207707_10009438 3300025912 Bacteria 8463
247 Ga0207707_10022001 3300025912 Bacteria 5573
248 Ga0207695_10044151 3300025913 Bacteria 4743
249 Ga0207695_10046271 3300025913 Bacteria 4612
250 Ga0207695_10085989 3300025913 Bacteria 3172
251 Ga0207695_10107041 3300025913 Unclassified 2782
252 Ga0207695_10223732 3300025913 Bacteria 1788
253 Ga0207695_10324692 3300025913 Bacteria 1428
254 Ga0207695_10374732 3300025913 Bacteria 1309
255 Ga0207695_10442953 3300025913 Bacteria 1182
256 Ga0207695_10573113 3300025913 Bacteria 1010
257 Ga0207695_11127519 3300025913 Unclassified 664
258 Ga0207671_10187409 3300025914 Unclassified 1612
259 Ga0207671_10330789 3300025914 Bacteria 1206
260 Ga0207671_10411485 3300025914 Bacteria 1076
261 Ga0207671_11394903 3300025914 Bacteria 543
262 Ga0207693_10000211 3300025915 Bacteria 53479
263 Ga0207693_10035428 3300025915 Bacteria 3935
264 Ga0207693_10444421 3300025915 Bacteria 1013
265 Ga0207693_10476143 3300025915 Unclassified 975
266 Ga0207663_10118744 3300025916 Bacteria 1807
267 Ga0207663_10140230 3300025916 Bacteria 1683
268 Ga0207663_10507431 3300025916 Unclassified 938
269 Ga0207660_10014097 3300025917 Bacteria 5248
270 Ga0207662_10263215 3300025918 Bacteria 1136
271 Ga0207652_10024931 3300025921 Bacteria 4966
272 Ga0207652_10120508 3300025921 Bacteria 2334
273 Ga0207681_10047075 3300025923 Bacteria 2903
274 Ga0207694_10209163 3300025924 Bacteria 1589
275 Ga0207694_10637849 3300025924 Bacteria 897
276 Ga0207650_10708848 3300025925 Bacteria 850
277 Ga0207687_10204962 3300025927 Bacteria 1544
278 Ga0207700_10307018 3300025928 Bacteria 1371
279 Ga0207700_10453092 3300025928 Bacteria 1131
280 Ga0207700_10540706 3300025928 Bacteria 1033
281 Ga0207700_10677142 3300025928 Bacteria 920
282 Ga0207700_11134013 3300025928 Bacteria 699
283 Ga0207664_10114109 3300025929 Bacteria 2251
284 Ga0207664_10915623 3300025929 Bacteria 787
285 Ga0207664_11974174 3300025929 Bacteria 506
286 Ga0207644_10006506 3300025931 Bacteria 7617
287 Ga0207644_10463827 3300025931 Bacteria 1042
288 Ga0207644_10921689 3300025931 Bacteria 732
289 Ga0207686_10109739 3300025934 Bacteria 1858
290 Ga0207669_10207070 3300025937 Bacteria 1429
291 Ga0207669_10930670 3300025937 Bacteria 727
292 Ga0207704_10140976 3300025938 Bacteria 1686
293 Ga0207704_10213426 3300025938 Unclassified 1422
294 Ga0207704_10478527 3300025938 Bacteria 999
295 Ga0207665_10008786 3300025939 Bacteria 6643
296 Ga0207665_10048793 3300025939 Bacteria 2843
297 Ga0207665_10143856 3300025939 Unclassified 1703
298 Ga0207665_10184106 3300025939 Bacteria 1514
299 Ga0207665_10220050 3300025939 Bacteria 1391
300 Ga0207691_10003370 3300025940 Bacteria 15547
301 Ga0207711_10005584 3300025941 Bacteria 10632
302 Ga0207711_10039357 3300025941 Bacteria 4021
303 Ga0207711_10229133 3300025941 Unclassified 1701
304 Ga0207689_10041449 3300025942 Bacteria 3810
305 Ga0207667_10159113 3300025949 Unclassified 2324
306 Ga0207667_10252858 3300025949 Bacteria 1803
307 Ga0207651_10029291 3300025960 Bacteria 3487
308 Ga0207651_10519643 3300025960 Bacteria 1031
309 Ga0207712_10061110 3300025961 Bacteria 2673
310 Ga0207712_10280585 3300025961 Bacteria 1360
311 Ga0207668_10886505 3300025972 Bacteria 793
312 Ga0207640_10967918 3300025981 Bacteria 747
313 Ga0207658_10003484 3300025986 Bacteria 11110
314 Ga0207658_10009442 3300025986 Bacteria 6616
315 Ga0207658_10227984 3300025986 Bacteria 1571
316 Ga0207658_10613037 3300025986 Unclassified 978
317 Ga0207677_10325325 3300026023 Bacteria 1279
318 Ga0207703_10000722 3300026035 Bacteria 32472
319 Ga0207703_10052240 3300026035 Bacteria 3317
320 Ga0207703_10748327 3300026035 Bacteria 931
321 Ga0207639_10452071 3300026041 Unclassified 1166
322 Ga0207678_10081741 3300026067 Unclassified 2765
323 Ga0207708_10097935 3300026075 Bacteria 2267
324 Ga0207708_10206386 3300026075 Bacteria 1569
325 Ga0207702_10093768 3300026078 Bacteria 2634
326 Ga0207641_10009487 3300026088 Bacteria 8020
327 Ga0207641_10049068 3300026088 Bacteria 3565
328 Ga0207648_10237270 3300026089 Bacteria 1623
329 Ga0207676_10038708 3300026095 Bacteria 3642
330 Ga0207676_10221661 3300026095 Bacteria 1685
331 Ga0207676_10445713 3300026095 Bacteria 1219
332 Ga0207676_10750744 3300026095 Bacteria 949
333 Ga0207675_100015967 3300026118 Bacteria 7008
334 Ga0207675_100127840 3300026118 Unclassified 2408
335 Ga0207675_100618857 3300026118 Unclassified 1087
336 Ga0207683_10005916 3300026121 Bacteria 10483
337 Ga0207683_10259142 3300026121 Bacteria 1588
338 Ga0209179_1000042 3300027512 Bacteria 26020
339 Ga0209588_1155710 3300027671 Unclassified 723
340 Ga0265356_1000274 3300028017 Bacteria 9614
341 Ga0268266_10000228 3300028379 Bacteria 97214
342 Ga0268266_10007670 3300028379 Bacteria 9695
343 Ga0268266_10015076 3300028379 Bacteria 6636
344 Ga0268266_10041330 3300028379 Bacteria 3934
345 Ga0268266_10616856 3300028379 Bacteria 1042
346 Ga0268265_10274671 3300028380 Bacteria 1505
347 Ga0268265_11532823 3300028380 Bacteria 670
348 Ga0268264_10023476 3300028381 Bacteria 5031
349 Ga0268264_10039069 3300028381 Bacteria 3920
350 Ga0268264_10568308 3300028381 Bacteria 1114
351 Ga0307515_10368766 3300028794 Bacteria 1073
352 Ga0265338_10126182 3300028800 Bacteria 2030
353 Ga0307511_10000105 3300030521 Bacteria 75047
354 Ga0265770_1000087 3300030878 Bacteria 10417
355 Ga0265765_1034504 3300030879 Unclassified 656
356 Ga0265760_10002891 3300031090 Bacteria 5020
357 Ga0265760_10138262 3300031090 Bacteria 792
358 Ga0265760_10175513 3300031090 Bacteria 713
359 Ga0265340_10041060 3300031247 Bacteria 2276
360 Ga0265340_10261411 3300031247 Bacteria 770
361 Ga0265331_10008970 3300031250 Bacteria 5652
362 Ga0307513_10012904 3300031456 Bacteria 10281
363 Ga0307513_10013928 3300031456 Bacteria 9854
364 Ga0307509_10074238 3300031507 Bacteria 3538
365 Ga0307508_10155820 3300031616 Bacteria 1887
366 Ga0307516_10000202 3300031730 Bacteria 77604
367 Ga0307405_10845704 3300031731 Unclassified 770
368 Ga0307413_10009580 3300031824 Bacteria 4644
369 Ga0307410_10004738 3300031852 Bacteria 7086
370 Ga0307407_10004537 3300031903 Bacteria 5910
371 Ga0307409_100020736 3300031995 Bacteria 4488
372 Ga0307409_100032436 3300031995 Bacteria 3787
373 Ga0307409_101643913 3300031995 Bacteria 671
374 Ga0307414_10512098 3300032004 Unclassified 1064
375 Ga0307415_101425100 3300032126 Bacteria 660
376 Ga0307510_10000002 3300033180 Bacteria 801565
377 Ga0307510_10015202 3300033180 Bacteria 9099
378 Ga0373923_0049872 3300035111 Bacteria 1752
379 Ga0373923_0313520 3300035111 Bacteria 744
380 Ga0373936_0244258 3300035113 Bacteria 801
381 Ga0373945_0023562 3300035116 Unclassified 2128
382 Ga0373945_0116744 3300035116 Bacteria 1058
383 Ga0373953_0105677 3300035117 Bacteria 1188
384 Ga0373954_0105363 3300035118 Bacteria 1362
385 Ga0373956_0408436 3300035119 Bacteria 648
386 Ga0373957_0195481 3300035120 Bacteria 842
387 Ga0373943_0265792 3300035170 Bacteria 967
388 Ga0373946_0198141 3300035171 Unclassified 961
389 Ga0373946_0632020 3300035171 Bacteria 557
390 Ga0373955_0029271 3300035172 Bacteria 2863
391 Ga0373955_0073868 3300035172 Bacteria 1912
392 Ga0373924_0110639 3300035410 Bacteria 1187
393 Ga0373935_0048814 3300035692 Bacteria 2681
394 Ga0373935_0569537 3300035692 Bacteria 827
395 Ga0373927_0079471 3300035695 Bacteria 2125
396 Ga0373927_0498529 3300035695 Unclassified 805
397 Ga0373933_0062696 3300035724 Bacteria 2246
398 Ga0373933_0188055 3300035724 Bacteria 1319
399 Ga0373933_0528025 3300035724 Unclassified 774
400 Ga0373947_0249693 3300035725 Bacteria 1173
401 Ga0373947_1039587 3300035725 Bacteria 559
402 Ga0373937_0040784 3300036401 Bacteria 4232
403 Ga0373937_0179069 3300036401 Bacteria 1990
404 Ga0373937_0215306 3300036401 Bacteria 1808
405 Ga0373937_0522090 3300036401 Bacteria 1128
406 Ga0373937_0552876 3300036401 Bacteria 1093
407 Ga0373925_0059718 3300037068 Bacteria 2861
408 Ga0373925_0142534 3300037068 Bacteria 1877
409 Ga0436365_0267105 3300039437 Unclassified 2776
410 Ga0436365_0814186 3300039437 Bacteria 1054
411 Ga0436365_1931734 3300039437 Bacteria 2129
412 Ga0436360_0403019 3300039438 Bacteria 2315
413 Ga0436360_0497597 3300039438 Unclassified 1788
414 Ga0436361_0646693 3300039447 Bacteria 2843
415 Ga0436361_1221066 3300039447 Unclassified 729
416 Ga0436363_0007967 3300039450 Bacteria 11336
417 Ga0436363_0324197 3300039450 Bacteria 2874
418 Ga0436363_0673297 3300039450 Unclassified 1317
419 Ga0436363_1168772 3300039450 Bacteria 672
420 Ga0436363_1435919 3300039450 Bacteria 21399
421 Ga0451787_695191 3300041441 Unclassified 593
422 Ga0451787_743653 3300041441 Bacteria 1050
423 Ga0451791_1661907 3300041451 Unclassified 922
424 Ga0451797_1389458 3300041453 Bacteria 2611
425 Ga0451798_0983454 3300041458 Unclassified 1712
426 Ga0451800_1001344 3300041459 Bacteria 895
427 Ga0451802_0494883 3300041460 Unclassified 600
428 Ga0451804_0067816 3300041463 Bacteria 1208
429 Ga0451804_0898164 3300041463 Archaea 660
430 Ga0451807_0405073 3300041486 Bacteria 2672
431 Ga0451807_0912081 3300041486 Unclassified 1984
432 Ga0451833_0002320 3300041491 Bacteria 1427
433 Ga0451837_0627041 3300041494 Bacteria 800
434 Ga0451843_0034490 3300041509 Bacteria 1071
435 Ga0451853_0237591 3300041512 Bacteria 1900
436 Ga0450920_125167 3300042122 Unclassified 540
437 Ga0466969_0098149 3300044656 Bacteria 1381
438 Ga0466969_0189755 3300044656 Bacteria 939
439 Ga0466972_0238230 3300044658 Unclassified 851
440 Ga0466966_0028228 3300044684 Unclassified 3657
441 Ga0466961_0024985 3300044693 Bacteria 3844
442 Ga0466961_0120697 3300044693 Unclassified 1646
443 Ga0466963_0388425 3300044694 Bacteria 984
444 Ga0466964_0004173 3300044706 Bacteria 5317
445 Ga0466971_0000676 3300044719 Bacteria 13605
446 Ga0466970_0017376 3300044765 Bacteria 3717
447 Ga0466970_0240049 3300044765 Bacteria 1014
448 Ga0466957_0035593 3300044842 Bacteria 2988
449 Ga0466957_0873917 3300044842 Unclassified 642
450 Ga0466959_0018605 3300045049 Bacteria 5102
451 Ga0466959_0023833 3300045049 Bacteria 4531
452 Ga0466959_0054474 3300045049 Unclassified 2922
453 Ga0466958_0142001 3300045836 Unclassified 1512
454 Ga0495592_0338609 3300046454 Bacteria 968
455 Ga0495592_0398757 3300046454 Bacteria 872
456 Ga0495592_0563773 3300046454 Bacteria 699
457 Ga0495580_0016436 3300046472 Bacteria 5552
458 Ga0495580_0035143 3300046472 Bacteria 3604
459 Ga0495580_0051068 3300046472 Bacteria 2923
460 Ga0495582_0791613 3300046473 Bacteria 549
461 Ga0495606_0084013 3300046507 Bacteria 1973
462 Ga0495632_0500149 3300046519 Bacteria 524
463 Ga0495652_0266355 3300046529 Bacteria 1262
464 Ga0495652_0688555 3300046529 Bacteria 689
465 Ga0495586_0215104 3300046535 Bacteria 1091
466 Ga0495633_0311907 3300046558 Unclassified 714
467 Ga0495634_0740991 3300046642 Unclassified 563
468 Ga0495658_0114181 3300046683 Bacteria 1627
469 Ga0495581_0224845 3300047315 Bacteria 1098
470 Ga0495604_0218925 3300047317 Bacteria 1312
471 Ga0495604_0538885 3300047317 Bacteria 754
472 Ga0495674_0068523 3300047319 Bacteria 3071
473 Ga0495602_0113323 3300048088 Bacteria 2198
474 Ga0496100_0031061 3300048903 Bacteria 3317
475 Ga0496100_0119462 3300048903 Bacteria 1842
476 Ga0496100_1528875 3300048903 Unclassified 527
477 Ga0496101_0377650 3300048904 Bacteria 1115
478 Ga0496102_0002674 3300048905 Bacteria 15162
479 Ga0496102_0019383 3300048905 Bacteria 5992
480 Ga0496102_0055377 3300048905 Bacteria 3617
481 Ga0496103_0034403 3300048906 Bacteria 3098
482 Ga0496103_0237663 3300048906 Bacteria 1172
483 Ga0496103_0367022 3300048906 Bacteria 925
484 Ga0496104_0090044 3300048907 Bacteria 2931
485 Ga0496104_0146985 3300048907 Bacteria 2263
486 Ga0496104_0158134 3300048907 Bacteria 2174
487 Ga0496104_0777942 3300048907 Bacteria 864
488 Ga0496105_0000582 3300048908 Bacteria 24262
489 Ga0496105_0002438 3300048908 Bacteria 13463
490 Ga0496105_0234185 3300048908 Bacteria 1491
491 Ga0496106_0009969 3300048909 Bacteria 7014
492 Ga0496106_0143402 3300048909 Bacteria 1880
493 Ga0496107_0145019 3300048910 Bacteria 1755
494 Ga0496107_0940990 3300048910 Unclassified 629
495 Ga0496108_0019137 3300048911 Bacteria 5619
496 Ga0496108_0446738 3300048911 Bacteria 1129
497 Ga0496109_0003552 3300048912 Bacteria 13011
498 Ga0496109_0016728 3300048912 Bacteria 6416
499 Ga0496110_0258642 3300048913 Bacteria 1584
500 Ga0496110_1359985 3300048913 Unclassified 619
501 Ga0496111_0109754 3300048914 Bacteria 2031
502 Ga0496111_0372437 3300048914 Unclassified 1056
503 Ga0496112_0091781 3300048915 Bacteria 3006
504 Ga0496113_0475678 3300048916 Bacteria 1004
505 Ga0496114_0018286 3300048917 Bacteria 5665
506 Ga0496114_0069579 3300048917 Bacteria 2955
507 Ga0496114_0142922 3300048917 Unclassified 2073
508 Ga0496114_0347644 3300048917 Bacteria 1311
509 Ga0496114_0366920 3300048917 Bacteria 1274
510 Ga0496115_0001693 3300048918 Bacteria 15799
511 Ga0496115_0427335 3300048918 Bacteria 1073
512 Ga0496116_0002847 3300048919 Bacteria 17736
513 Ga0496117_0000140 3300048920 Bacteria 158390
514 Ga0496118_0000102 3300048921 Bacteria 158228
515 Ga0496119_0016597 3300048922 Bacteria 5592
516 Ga0496119_0116245 3300048922 Unclassified 1476
517 Ga0496119_0245343 3300048922 Bacteria 905
518 Ga0496120_0002762 3300048923 Bacteria 17104
519 Ga0496120_0018015 3300048923 Bacteria 4562
520 Ga0496120_0380702 3300048923 Bacteria 627
521 Ga0496120_0386651 3300048923 Bacteria 621
522 Ga0496121_0007824 3300048924 Bacteria 12792
523 Ga0496121_0032954 3300048924 Bacteria 4699
524 Ga0496121_0147992 3300048924 Unclassified 1732
525 Ga0496124_0108512 3300048927 Unclassified 2238
526 Ga0496125_0014048 3300048928 Bacteria 7827
527 Ga0496125_0030118 3300048928 Bacteria 4861
528 Ga0496125_0192430 3300048928 Bacteria 1345
529 Ga0496126_0003544 3300048929 Bacteria 19629
530 Ga0496126_0005608 3300048929 Bacteria 14272
531 Ga0496126_0201262 3300048929 Bacteria 1682
532 Ga0496126_0282819 3300048929 Unclassified 1373
533 Ga0496126_0373961 3300048929 Unclassified 1161
534 Ga0496126_0547488 3300048929 Bacteria 919
535 Ga0496126_0791310 3300048929 Unclassified 728
536 Ga0501067_0037848 3300049583 Bacteria 2679
537 Ga0501070_0700840 3300049586 Bacteria 801
538 Ga0501071_1074044 3300049587 Bacteria 622
539 nmdc:mga08y16_1933760_c1 3300050511 Bacteria 540
540 Ga0495601_0516503 3300053077 Bacteria 770
541 Ga0495619_0198549 3300053085 Bacteria 1389
542 Ga0500583_0032150 3300053092 Bacteria 2313
543 Ga0500583_0072970 3300053092 Bacteria 1644
544 Ga0500651_0166802 3300053093 Bacteria 1315
545 Ga0500641_0132392 3300053096 Bacteria 1076
546 Ga0500650_0379039 3300053098 Bacteria 615
547 Ga0500660_042053 3300053100 Bacteria 2320
548 Ga0500573_0174960 3300053140 Bacteria 1158
549 Ga0500637_0063660 3300053178 Bacteria 2114
550 Ga0466962_0002561 3300061719 Bacteria 8634
551 Ga0466962_0151830 3300061719 Unclassified 1124
552 Ga0265334_10095186
553 SwRhRL3b_contig_893834
554 MRS1b_contig_452932
555 LJNas_1011351
556 JGI25406J46586_10010137
557 rootH2_10138626
558 Ga0065704_10546131
559 Ga0065707_10081916
560 Ga0070670_100480767
561 Ga0068869_101386681
562 Ga0070666_10005361
563 Ga0070666_10440684
564 Ga0070680_100028917
565 Ga0068868_100003468
566 Ga0068868_100184425
567 Ga0070689_101182812
568 Ga0070689_101343292
569 Ga0070668_101371839
570 Ga0070669_100425450
571 Ga0070671_100015169
572 Ga0070671_100039787
573 Ga0070671_100085202
574 Ga0070671_100127534
575 Ga0070674_100505617
576 Ga0070673_100146827
577 Ga0070673_101656056
578 Ga0070673_101896280
579 Ga0070667_100030898
580 Ga0070667_100192873
581 Ga0070667_100399388
582 Ga0070667_100445718
583 Ga0070709_10026260
584 Ga0070709_10174929
585 Ga0070709_11396644
586 Ga0070714_100080696
587 Ga0070714_100706744
588 Ga0070714_100746039
589 Ga0070714_101180161
590 Ga0070713_100012193
591 Ga0070713_100135278
592 Ga0070713_100590099
593 Ga0070710_10051060
594 Ga0070710_10452114
595 Ga0070710_10893689
596 Ga0070701_10168989
597 Ga0070701_11232945
598 Ga0070711_100006699
599 Ga0070711_100024797
600 Ga0070711_100457678
601 Ga0070705_100074211
602 Ga0070700_100157129
603 Ga0070663_101005960
604 Ga0070678_100023192
605 Ga0070681_10002918
606 Ga0070681_10313167
607 Ga0068867_100114389
608 Ga0068867_100188729
609 Ga0070685_10060579
610 Ga0070706_101863563
611 Ga0070679_100011110
612 Ga0070679_100159511
613 Ga0070679_101557733
614 Ga0070684_100302578
615 Ga0070697_100862946
616 Ga0068853_100493799
617 Ga0070672_100181824
618 Ga0070686_100354622
619 Ga0070686_100579776
620 Ga0070695_100009570
621 Ga0070695_100265966
622 Ga0070696_100105576
623 Ga0070696_100229215
624 Ga0070693_100114686
625 Ga0070665_100009141
626 Ga0070665_100012682
627 Ga0070665_100043648
628 Ga0070665_100061063
629 Ga0070665_100072017
630 Ga0070665_100753174
631 Ga0070704_100556318
632 Ga0068855_100029480
633 Ga0068855_101379679
634 Ga0068856_100513092
635 Ga0068856_100547949
636 Ga0070702_101621188
637 Ga0068852_100330964
638 Ga0068852_100801810
639 Ga0068859_100000607
640 Ga0068859_100082262
641 Ga0068859_100121827
642 Ga0068859_100172906
643 Ga0068864_100070000
644 Ga0068864_100580417
645 Ga0068864_100782639
646 Ga0068864_101444348
647 Ga0068866_10019756
648 Ga0068861_100176385
649 Ga0068861_100795596
650 Ga0068851_10192592
651 Ga0068870_10000854
652 Ga0068863_100004570
653 Ga0068863_100064699
654 Ga0068858_100008412
655 Ga0068858_100010907
656 Ga0068858_100043779
657 Ga0068860_100057188
658 Ga0068860_100105346
659 Ga0068862_100062693
660 Ga0068862_100207150
661 Ga0081539_10000006
662 Ga0070715_10000689
663 Ga0070716_100010768
664 Ga0070716_100036957
665 Ga0070716_100195913
666 Ga0070716_100799337
667 Ga0070716_100915210
668 Ga0070712_100016649
669 Ga0070712_100359149
670 Ga0070712_100438742
671 Ga0070712_100891472
672 Ga0070712_101455313
673 Ga0097621_100009768
674 Ga0097621_100154982
675 Ga0097621_100256696
676 Ga0097621_101032880
677 Ga0068871_100060969
678 Ga0068871_100209280
679 Ga0068871_101126950
680 Ga0075434_100209407
681 Ga0068865_100002046
682 Ga0068865_100187965
683 Ga0068865_100615387
684 Ga0075436_100357480
685 Ga0097620_100000607
686 Ga0097620_100082262
687 Ga0097620_100121825
688 Ga0097620_100172918
689 Ga0075435_100229630
690 Ga0099794_10078351
691 Ga0099794_10246963
692 Ga0099795_10000018
693 Ga0099795_10165418
694 Ga0099795_10455377
695 Ga0105251_10150108
696 Ga0105250_10014797
697 Ga0105240_10027986
698 Ga0105240_10063221
699 Ga0105240_10106194
700 Ga0105240_10113737
701 Ga0105240_10153250
702 Ga0105240_10240033
703 Ga0105240_10249738
704 Ga0105240_10347396
705 Ga0105240_10360689
706 Ga0105240_10427067
707 Ga0105240_10757316
708 Ga0105240_11498343
709 Ga0111539_11577593
710 Ga0111539_12344841
711 Ga0105245_10007272
712 Ga0105245_10092782
713 Ga0105245_10894215
714 Ga0105245_12251255
715 Ga0105247_10009956
716 Ga0105247_10014175
717 Ga0105247_10612797
718 Ga0105243_11295660
719 Ga0105241_10168782
720 Ga0105241_10630460
721 Ga0105242_10020423
722 Ga0105248_10001780
723 Ga0105248_10060480
724 Ga0105248_10158980
725 Ga0105248_12053909
726 Ga0105237_10073885
727 Ga0105237_10199212
728 Ga0105237_11379909
729 Ga0105237_11517326
730 Ga0105238_10147035
731 Ga0105238_10191255
732 Ga0105238_10752309
733 Ga0105238_11054845
734 Ga0105249_10185118
735 Ga0105249_10209287
736 Ga0105249_10388852
737 Ga0105249_10752677
738 Ga0105249_11042561
739 Ga0099796_10000081
740 Ga0099796_10007269
741 Ga0099796_10010466
742 Ga0105239_10033174
743 Ga0105239_10350742
744 Ga0105239_10574323
745 Ga0105239_11013510
746 Ga0157369_10013670
747 Ga0157369_10284182
748 Ga0157374_10008107
749 Ga0157374_10274509
750 Ga0157374_10679893
751 Ga0157378_10026649
752 Ga0163162_10022537
753 Ga0163162_10063063
754 Ga0163162_10074075
755 Ga0157372_11364467
756 Ga0157375_10004755
757 Ga0157375_10532131
758 Ga0157375_10804413
759 Ga0163163_10008201
760 Ga0163163_10018474
761 Ga0163163_10091409
762 Ga0163163_10240717
763 Ga0163163_10268907
764 Ga0163163_10296818
765 Ga0163163_12334419
766 Ga0157380_10449624
767 Ga0157380_10943419
768 Ga0157377_11778335
769 Ga0157379_10001822
770 Ga0157379_10029925
771 Ga0157379_10073458
772 Ga0157379_10086803
773 Ga0157379_10136769
774 Ga0157379_11063255
775 Ga0157376_10002659
776 Ga0157376_10495902
777 Ga0157376_11485236
778 Ga0206354_10056148
779 Ga0213874_10004199
780 Ga0213874_10004484
781 Ga0213876_10233907
782 Ga0213871_10061744
783 Ga0228598_1007062
784 Ga0207697_10300112
785 Ga0207682_10009029
786 Ga0207692_10015390
787 Ga0207692_10275680
788 Ga0207692_10535030
789 Ga0207692_11045128
790 Ga0207710_10005193
791 Ga0207680_10418028
792 Ga0207685_10003701
793 Ga0207699_10072424
794 Ga0207645_10364578
795 Ga0207643_10010315
796 Ga0207654_10282935
797 Ga0207707_10009438
798 Ga0207707_10022001
799 Ga0207695_10044151
800 Ga0207695_10046271
801 Ga0207695_10085989
802 Ga0207695_10107041
803 Ga0207695_10223732
804 Ga0207695_10324692
805 Ga0207695_10374732
806 Ga0207695_10442953
807 Ga0207695_10573113
808 Ga0207695_11127519
809 Ga0207671_10187409
810 Ga0207671_10330789
811 Ga0207671_10411485
812 Ga0207671_11394903
813 Ga0207693_10000211
814 Ga0207693_10035428
815 Ga0207693_10444421
816 Ga0207693_10476143
817 Ga0207663_10118744
818 Ga0207663_10140230
819 Ga0207663_10507431
820 Ga0207660_10014097
821 Ga0207662_10263215
822 Ga0207652_10024931
823 Ga0207652_10120508
824 Ga0207681_10047075
825 Ga0207694_10209163
826 Ga0207694_10637849
827 Ga0207650_10708848
828 Ga0207687_10204962
829 Ga0207700_10307018
830 Ga0207700_10453092
831 Ga0207700_10540706
832 Ga0207700_10677142
833 Ga0207700_11134013
834 Ga0207664_10114109
835 Ga0207664_10915623
836 Ga0207664_11974174
837 Ga0207644_10006506
838 Ga0207644_10463827
839 Ga0207644_10921689
840 Ga0207686_10109739
841 Ga0207669_10207070
842 Ga0207669_10930670
843 Ga0207704_10140976
844 Ga0207704_10213426
845 Ga0207704_10478527
846 Ga0207665_10008786
847 Ga0207665_10048793
848 Ga0207665_10143856
849 Ga0207665_10184106
850 Ga0207665_10220050
851 Ga0207691_10003370
852 Ga0207711_10005584
853 Ga0207711_10039357
854 Ga0207711_10229133
855 Ga0207689_10041449
856 Ga0207667_10159113
857 Ga0207667_10252858
858 Ga0207651_10029291
859 Ga0207651_10519643
860 Ga0207712_10061110
861 Ga0207712_10280585
862 Ga0207668_10886505
863 Ga0207640_10967918
864 Ga0207658_10003484
865 Ga0207658_10009442
866 Ga0207658_10227984
867 Ga0207658_10613037
868 Ga0207677_10325325
869 Ga0207703_10000722
870 Ga0207703_10052240
871 Ga0207703_10748327
872 Ga0207639_10452071
873 Ga0207678_10081741
874 Ga0207708_10097935
875 Ga0207708_10206386
876 Ga0207702_10093768
877 Ga0207641_10009487
878 Ga0207641_10049068
879 Ga0207648_10237270
880 Ga0207676_10038708
881 Ga0207676_10221661
882 Ga0207676_10445713
883 Ga0207676_10750744
884 Ga0207675_100015967
885 Ga0207675_100127840
886 Ga0207675_100618857
887 Ga0207683_10005916
888 Ga0207683_10259142
889 Ga0209179_1000042
890 Ga0209588_1155710
891 Ga0265356_1000274
892 Ga0268266_10000228
893 Ga0268266_10007670
894 Ga0268266_10015076
895 Ga0268266_10041330
896 Ga0268266_10616856
897 Ga0268265_10274671
898 Ga0268265_11532823
899 Ga0268264_10023476
900 Ga0268264_10039069
901 Ga0268264_10568308
902 Ga0307515_10368766
903 Ga0265338_10126182
904 Ga0307511_10000105
905 Ga0265770_1000087
906 Ga0265765_1034504
907 Ga0265760_10002891
908 Ga0265760_10138262
909 Ga0265760_10175513
910 Ga0265340_10041060
911 Ga0265340_10261411
912 Ga0265331_10008970
913 Ga0307513_10012904
914 Ga0307513_10013928
915 Ga0307509_10074238
916 Ga0307508_10155820
917 Ga0307516_10000202
918 Ga0307405_10845704
919 Ga0307413_10009580
920 Ga0307410_10004738
921 Ga0307407_10004537
922 Ga0307409_100020736
923 Ga0307409_100032436
924 Ga0307409_101643913
925 Ga0307414_10512098
926 Ga0307415_101425100
927 Ga0307510_10000002
928 Ga0307510_10015202
929 Ga0373923_0049872
930 Ga0373923_0313520
931 Ga0373936_0244258
932 Ga0373945_0023562
933 Ga0373945_0116744
934 Ga0373953_0105677
935 Ga0373954_0105363
936 Ga0373956_0408436
937 Ga0373957_0195481
938 Ga0373943_0265792
939 Ga0373946_0198141
940 Ga0373946_0632020
941 Ga0373955_0029271
942 Ga0373955_0073868
943 Ga0373924_0110639
944 Ga0373935_0048814
945 Ga0373935_0569537
946 Ga0373927_0079471
947 Ga0373927_0498529
948 Ga0373933_0062696
949 Ga0373933_0188055
950 Ga0373933_0528025
951 Ga0373947_0249693
952 Ga0373947_1039587
953 Ga0373937_0040784
954 Ga0373937_0179069
955 Ga0373937_0215306
956 Ga0373937_0522090
957 Ga0373937_0552876
958 Ga0373925_0059718
959 Ga0373925_0142534
960 Ga0436365_0267105
961 Ga0436365_0814186
962 Ga0436365_1931734
963 Ga0436360_0403019
964 Ga0436360_0497597
965 Ga0436361_0646693
966 Ga0436361_1221066
967 Ga0436363_0007967
968 Ga0436363_0324197
969 Ga0436363_0673297
970 Ga0436363_1168772
971 Ga0436363_1435919
972 Ga0451787_695191
973 Ga0451787_743653
974 Ga0451791_1661907
975 Ga0451797_1389458
976 Ga0451798_0983454
977 Ga0451800_1001344
978 Ga0451802_0494883
979 Ga0451804_0067816
980 Ga0451804_0898164
981 Ga0451807_0405073
982 Ga0451807_0912081
983 Ga0451833_0002320
984 Ga0451837_0627041
985 Ga0451843_0034490
986 Ga0451853_0237591
987 Ga0450920_125167
988 Ga0466969_0098149
989 Ga0466969_0189755
990 Ga0466972_0238230
991 Ga0466966_0028228
992 Ga0466961_0024985
993 Ga0466961_0120697
994 Ga0466963_0388425
995 Ga0466964_0004173
996 Ga0466971_0000676
997 Ga0466970_0017376
998 Ga0466970_0240049
999 Ga0466957_0035593
1000 Ga0466957_0873917
1001 Ga0466959_0018605
1002 Ga0466959_0023833
1003 Ga0466959_0054474
1004 Ga0466958_0142001
1005 Ga0495592_0338609
1006 Ga0495592_0398757
1007 Ga0495592_0563773
1008 Ga0495580_0016436
1009 Ga0495580_0035143
1010 Ga0495580_0051068
1011 Ga0495582_0791613
1012 Ga0495606_0084013
1013 Ga0495632_0500149
1014 Ga0495652_0266355
1015 Ga0495652_0688555
1016 Ga0495586_0215104
1017 Ga0495633_0311907
1018 Ga0495634_0740991
1019 Ga0495658_0114181
1020 Ga0495581_0224845
1021 Ga0495604_0218925
1022 Ga0495604_0538885
1023 Ga0495674_0068523
1024 Ga0495602_0113323
1025 Ga0496100_0031061
1026 Ga0496100_0119462
1027 Ga0496100_1528875
1028 Ga0496101_0377650
1029 Ga0496102_0002674
1030 Ga0496102_0019383
1031 Ga0496102_0055377
1032 Ga0496103_0034403
1033 Ga0496103_0237663
1034 Ga0496103_0367022
1035 Ga0496104_0090044
1036 Ga0496104_0146985
1037 Ga0496104_0158134
1038 Ga0496104_0777942
1039 Ga0496105_0000582
1040 Ga0496105_0002438
1041 Ga0496105_0234185
1042 Ga0496106_0009969
1043 Ga0496106_0143402
1044 Ga0496107_0145019
1045 Ga0496107_0940990
1046 Ga0496108_0019137
1047 Ga0496108_0446738
1048 Ga0496109_0003552
1049 Ga0496109_0016728
1050 Ga0496110_0258642
1051 Ga0496110_1359985
1052 Ga0496111_0109754
1053 Ga0496111_0372437
1054 Ga0496112_0091781
1055 Ga0496113_0475678
1056 Ga0496114_0018286
1057 Ga0496114_0069579
1058 Ga0496114_0142922
1059 Ga0496114_0347644
1060 Ga0496114_0366920
1061 Ga0496115_0001693
1062 Ga0496115_0427335
1063 Ga0496116_0002847
1064 Ga0496117_0000140
1065 Ga0496118_0000102
1066 Ga0496119_0016597
1067 Ga0496119_0116245
1068 Ga0496119_0245343
1069 Ga0496120_0002762
1070 Ga0496120_0018015
1071 Ga0496120_0380702
1072 Ga0496120_0386651
1073 Ga0496121_0007824
1074 Ga0496121_0032954
1075 Ga0496121_0147992
1076 Ga0496124_0108512
1077 Ga0496125_0014048
1078 Ga0496125_0030118
1079 Ga0496125_0192430
1080 Ga0496126_0003544
1081 Ga0496126_0005608
1082 Ga0496126_0201262
1083 Ga0496126_0282819
1084 Ga0496126_0373961
1085 Ga0496126_0547488
1086 Ga0496126_0791310
1087 Ga0501067_0037848
1088 Ga0501070_0700840
1089 Ga0501071_1074044
1090 nmdc:mga08y16_1933760_c1
1091 Ga0495601_0516503
1092 Ga0495619_0198549
1093 Ga0500583_0032150
1094 Ga0500583_0072970
1095 Ga0500651_0166802
1096 Ga0500641_0132392
1097 Ga0500650_0379039
1098 Ga0500660_042053
1099 Ga0500573_0174960
1100 Ga0500637_0063660
1101 Ga0466962_0002561
1102 Ga0466962_0151830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19662

DUF6165

Family of unknown function (DUF6165)

19

148

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zsh-assembly2.cif.gz_C the mechanism of activation of the actin binding protein ehbp1 by rab8 family members 0.9056 54 114
8hf0-assembly1.cif.gz_D dmdcr-2/r2d2/loqspd with 50bp-dsrna in dimer state 0.697 10 68
6zsh-assembly2.cif.gz_C the mechanism of activation of the actin binding protein ehbp1 by rab8 family members 0.6782 54 114
7w0a-assembly1.cif.gz_E dmdicer2-loqspd-dsrna dimer status 0.63 10 66
4k0d-assembly1.cif.gz_B periplasmic sensor domain of sensor histidine kinase, adeh_2942 0.5638 9 118
ID Description Score Start End Superfamily
4fvmA06 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.9137 10 50 1.10.287.690
1zpyF00 Special;Helix non-globular;Helix Hairpins; 0.9127 9 48 6.10.140.1960
af_F5GU36_11_158_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8176 60 118 1.20.140.150
4fvmA06 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.7792 10 50 1.10.287.690
af_A0A0B4K6B2_1_102_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7761 57 117 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A518AYM0-F1-model_v4 Uncharacterized protein 0.9695 1 126
AF-A0A2E8PI70-F1-model_v4 deleted 0.9685 2 127
AF-A0A1H3G2D2-F1-model_v4 Chaperone modulatory protein CbpM 0.9681 2 127
AF-A0A7C7SST2-F1-model_v4 Glycosyltransferase family 41 protein 0.9663 2 127 GO:0016740
AF-V6F4F0-F1-model_v4 Uncharacterized protein 0.9648 1 130

Map