F461986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 546 | 348 | 512 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10004619|Ga0105240_1000461915 |
| Length | 428 |
| Sequence | LGWPGGNSVSAATAKAAGGFVRPREGRTSLPRDNRGFRPARPGRDPLQIIDPTGDIRMLLSRVPFAARSLVVAGAAEAISGPAGQYGQSIRNGFQLAVDEINAAGGVKGNKIALQVEDEQGKKEQAIDVFKKLIFQDKVLMLFGPTLSNSAQAADPIAQAAKVVVFGTSNTADGITSIGDYVFRNSVTEADVLPETLRVAAKHTGLKKVAVMYGNDDVFTKSGYDAFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKASGADAIVLSALIAEGAPIMVQARQLGIDLPVIGGNGMNSAKIFDLAKEKSDNLWVGSPWALGNQTKENEHFVVAYTQKYKAAPDQFSAQAYDAMNIAAQALGKIKLSGDLAADRKALRDALPSVTWTGATGAFKFRQAMDKSGKPAGHDAQQAAIVSVTKGGKYSIEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 3 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 4 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 14 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 15 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 16 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 17 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 18 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 19 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 20 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 21 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 22 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 23 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 24 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 25 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 26 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 27 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 28 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 29 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 30 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 31 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 32 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 37 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 38 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 39 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 40 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 42 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 43 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 44 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 45 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 46 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 59 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 70 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 155 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 232 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 233 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 343 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 0.92 |
| Isolates | 6.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.5 |
| Nodule | 0.55 |
| Rhizoplane | 2.38 |
| Rhizosphere | 64.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000196 | 3300001915 | Bacteria | 17817 |
| 2 | JGI24740J21852_10002700 | 3300001979 | Bacteria | 7967 |
| 3 | JGI24740J21852_10003016 | 3300001979 | Bacteria | 7454 |
| 4 | JGI25156J39149_1000060 | 3300002705 | Bacteria | 84857 |
| 5 | JGI25156J39149_1000175 | 3300002705 | Bacteria | 47051 |
| 6 | JGI25156J39149_1001779 | 3300002705 | Bacteria | 8529 |
| 7 | JGI25156J39149_1016653 | 3300002705 | Bacteria | 1422 |
| 8 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 9 | JGI25154J39366_1000129 | 3300002738 | Bacteria | 59399 |
| 10 | JGI25154J39366_1002385 | 3300002738 | Bacteria | 4930 |
| 11 | JGI25157J39369_1000029 | 3300002741 | Bacteria | 146928 |
| 12 | JGI25164J39214_1003957 | 3300002772 | Bacteria | 1772 |
| 13 | JGI25151J46595_10000137 | 3300003187 | Bacteria | 96370 |
| 14 | JGI25151J46595_10030179 | 3300003187 | Bacteria | 2135 |
| 15 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 16 | rootH1_10009484 | 3300003316 | Bacteria | 3739 |
| 17 | rootH1_10017612 | 3300003316 | Bacteria | 3441 |
| 18 | rootH2_10006384 | 3300003320 | Bacteria | 8049 |
| 19 | rootH2_10082770 | 3300003320 | Bacteria | 3290 |
| 20 | rootH1_10024154 | 3300003323 | Bacteria | 5841 |
| 21 | rootH1_10142259 | 3300003323 | Bacteria | 3751 |
| 22 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 23 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 24 | Ga0055539_1000081 | 3300003752 | Bacteria | 122891 |
| 25 | Ga0055539_1000118 | 3300003752 | Bacteria | 86566 |
| 26 | Ga0055539_1000739 | 3300003752 | Bacteria | 8155 |
| 27 | Ga0055533_1000010 | 3300003756 | Bacteria | 491196 |
| 28 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 29 | Ga0055533_1000421 | 3300003756 | Bacteria | 16356 |
| 30 | Ga0055532_1000048 | 3300003758 | Bacteria | 175560 |
| 31 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 32 | Ga0055525_1000273 | 3300003759 | Bacteria | 48163 |
| 33 | Ga0055525_1000415 | 3300003759 | Bacteria | 25986 |
| 34 | Ga0055527_1003308 | 3300003760 | Bacteria | 2435 |
| 35 | Ga0055535_1000035 | 3300003761 | Bacteria | 175560 |
| 36 | Ga0055535_1000076 | 3300003761 | Bacteria | 111203 |
| 37 | Ga0055535_1000282 | 3300003761 | Bacteria | 53559 |
| 38 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 39 | Ga0055542_1000724 | 3300003762 | Bacteria | 25809 |
| 40 | Ga0055529_1000101 | 3300003763 | Bacteria | 130709 |
| 41 | Ga0055529_1000491 | 3300003763 | Bacteria | 36152 |
| 42 | Ga0055529_1000810 | 3300003763 | Bacteria | 18955 |
| 43 | Ga0055530_10020060 | 3300003791 | Bacteria | 2008 |
| 44 | Ga0055540_1008797 | 3300003792 | Bacteria | 3582 |
| 45 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 46 | Ga0055541_1001235 | 3300003841 | Bacteria | 5646 |
| 47 | Ga0065712_10000421 | 3300005290 | Bacteria | 18901 |
| 48 | Ga0065712_10002802 | 3300005290 | Bacteria | 10865 |
| 49 | Ga0065715_10012795 | 3300005293 | Bacteria | 4959 |
| 50 | Ga0065715_10089174 | 3300005293 | Bacteria | 13129 |
| 51 | Ga0065707_10190054 | 3300005295 | Bacteria | 1350 |
| 52 | Ga0070658_10016597 | 3300005327 | Bacteria | 5892 |
| 53 | Ga0070658_10129050 | 3300005327 | Bacteria | 2106 |
| 54 | Ga0070676_10024807 | 3300005328 | Bacteria | 3382 |
| 55 | Ga0070676_10038698 | 3300005328 | Unclassified | 2755 |
| 56 | Ga0070690_100041526 | 3300005330 | Unclassified | 2912 |
| 57 | Ga0070690_100064191 | 3300005330 | Bacteria | 2371 |
| 58 | Ga0070670_100000191 | 3300005331 | Bacteria | 56346 |
| 59 | Ga0070670_100068546 | 3300005331 | Bacteria | 3045 |
| 60 | Ga0070677_10018449 | 3300005333 | Bacteria | 2512 |
| 61 | Ga0070666_10020261 | 3300005335 | Bacteria | 4299 |
| 62 | Ga0070666_10200122 | 3300005335 | Bacteria | 1405 |
| 63 | Ga0070680_100002615 | 3300005336 | Bacteria | 13332 |
| 64 | Ga0070682_100011098 | 3300005337 | Bacteria | 5139 |
| 65 | Ga0068868_100010559 | 3300005338 | Bacteria | 6692 |
| 66 | Ga0070687_100051249 | 3300005343 | Unclassified | 2136 |
| 67 | Ga0070661_100000370 | 3300005344 | Bacteria | 35389 |
| 68 | Ga0070661_100003806 | 3300005344 | Bacteria | 10397 |
| 69 | Ga0070669_100064626 | 3300005353 | Unclassified | 2695 |
| 70 | Ga0070675_100054510 | 3300005354 | Bacteria | 3290 |
| 71 | Ga0070675_100070187 | 3300005354 | Unclassified | 2903 |
| 72 | Ga0070671_100005369 | 3300005355 | Bacteria | 10216 |
| 73 | Ga0070671_100025924 | 3300005355 | Bacteria | 4814 |
| 74 | Ga0070671_100034890 | 3300005355 | Unclassified | 4165 |
| 75 | Ga0070671_100161985 | 3300005355 | Bacteria | 1891 |
| 76 | Ga0070674_100007062 | 3300005356 | Bacteria | 6603 |
| 77 | Ga0070673_100055185 | 3300005364 | Bacteria | 3130 |
| 78 | Ga0070673_100071309 | 3300005364 | Bacteria | 2791 |
| 79 | Ga0070659_100014344 | 3300005366 | Bacteria | 5921 |
| 80 | Ga0070659_100037086 | 3300005366 | Bacteria | 3800 |
| 81 | Ga0070667_100063802 | 3300005367 | Bacteria | 3123 |
| 82 | Ga0070667_100081858 | 3300005367 | Bacteria | 2763 |
| 83 | Ga0070705_100020941 | 3300005440 | Unclassified | 3471 |
| 84 | Ga0070700_100006624 | 3300005441 | Bacteria | 6202 |
| 85 | Ga0070694_100015923 | 3300005444 | Bacteria | 4730 |
| 86 | Ga0070708_100000336 | 3300005445 | Bacteria | 35498 |
| 87 | Ga0070663_100000024 | 3300005455 | Bacteria | 108544 |
| 88 | Ga0070663_100043513 | 3300005455 | Unclassified | 3161 |
| 89 | Ga0070678_100030127 | 3300005456 | Bacteria | 3725 |
| 90 | Ga0070678_100030389 | 3300005456 | Unclassified | 3713 |
| 91 | Ga0070662_100026282 | 3300005457 | Unclassified | 4030 |
| 92 | Ga0070662_100059309 | 3300005457 | Bacteria | 2788 |
| 93 | Ga0070681_10018223 | 3300005458 | Bacteria | 7018 |
| 94 | Ga0070681_10079034 | 3300005458 | Bacteria | 3246 |
| 95 | Ga0068867_100022324 | 3300005459 | Unclassified | 4524 |
| 96 | Ga0070706_100002692 | 3300005467 | Bacteria | 17790 |
| 97 | Ga0070698_100251532 | 3300005471 | Bacteria | 1700 |
| 98 | Ga0070698_100291246 | 3300005471 | Bacteria | 1564 |
| 99 | Ga0070699_100139989 | 3300005518 | Bacteria | 2136 |
| 100 | Ga0070679_100024625 | 3300005530 | Bacteria | 5899 |
| 101 | Ga0070679_100052774 | 3300005530 | Bacteria | 4047 |
| 102 | Ga0070697_100022408 | 3300005536 | Bacteria | 5013 |
| 103 | Ga0070672_100064127 | 3300005543 | Bacteria | 2902 |
| 104 | Ga0070695_100005789 | 3300005545 | Bacteria | 7283 |
| 105 | Ga0070696_100014843 | 3300005546 | Bacteria | 5228 |
| 106 | Ga0070696_100018017 | 3300005546 | Bacteria | 4770 |
| 107 | Ga0070693_100044899 | 3300005547 | Unclassified | 2502 |
| 108 | Ga0070665_100008996 | 3300005548 | Bacteria | 10112 |
| 109 | Ga0070665_100219927 | 3300005548 | Bacteria | 1900 |
| 110 | Ga0070704_100034440 | 3300005549 | Unclassified | 3435 |
| 111 | Ga0070664_100000022 | 3300005564 | Bacteria | 108544 |
| 112 | Ga0070664_100016829 | 3300005564 | Bacteria | 6002 |
| 113 | Ga0068857_100026215 | 3300005577 | Bacteria | 5136 |
| 114 | Ga0068857_100111768 | 3300005577 | Bacteria | 2456 |
| 115 | Ga0068857_100166686 | 3300005577 | Bacteria | 2001 |
| 116 | Ga0068854_100000336 | 3300005578 | Bacteria | 30476 |
| 117 | Ga0068854_100004203 | 3300005578 | Bacteria | 9067 |
| 118 | Ga0068854_100016099 | 3300005578 | Bacteria | 4974 |
| 119 | Ga0068854_100077689 | 3300005578 | Bacteria | 2443 |
| 120 | Ga0068856_100000049 | 3300005614 | Bacteria | 108544 |
| 121 | Ga0068856_100005146 | 3300005614 | Bacteria | 12913 |
| 122 | Ga0068856_100097086 | 3300005614 | Unclassified | 2935 |
| 123 | Ga0068859_100111632 | 3300005617 | Bacteria | 2797 |
| 124 | Ga0068864_100009857 | 3300005618 | Bacteria | 7877 |
| 125 | Ga0068870_10011924 | 3300005840 | Bacteria | 4045 |
| 126 | Ga0068863_100308158 | 3300005841 | Bacteria | 1537 |
| 127 | Ga0068858_100213312 | 3300005842 | Bacteria | 1827 |
| 128 | Ga0068860_100123403 | 3300005843 | Bacteria | 2481 |
| 129 | Ga0075365_10004760 | 3300006038 | Bacteria | 7235 |
| 130 | Ga0075363_100016697 | 3300006048 | Bacteria | 3630 |
| 131 | Ga0075364_10204542 | 3300006051 | Bacteria | 1339 |
| 132 | Ga0070712_100044125 | 3300006175 | Bacteria | 3073 |
| 133 | Ga0075362_10000766 | 3300006177 | Bacteria | 9569 |
| 134 | Ga0075367_10019273 | 3300006178 | Bacteria | 3781 |
| 135 | Ga0075367_10058564 | 3300006178 | Bacteria | 2292 |
| 136 | Ga0075366_10024677 | 3300006195 | Bacteria | 3507 |
| 137 | Ga0097621_100221734 | 3300006237 | Bacteria | 1648 |
| 138 | Ga0075370_10002838 | 3300006353 | Bacteria | 8130 |
| 139 | Ga0075370_10033148 | 3300006353 | Bacteria | 2891 |
| 140 | Ga0068871_100333652 | 3300006358 | Bacteria | 1338 |
| 141 | Ga0075430_100208405 | 3300006846 | Bacteria | 1622 |
| 142 | Ga0075431_100003080 | 3300006847 | Bacteria | 16154 |
| 143 | Ga0075433_10041459 | 3300006852 | Bacteria | 3989 |
| 144 | Ga0075433_10082925 | 3300006852 | Bacteria | 2829 |
| 145 | Ga0075434_100025998 | 3300006871 | Bacteria | 5731 |
| 146 | Ga0075434_100063792 | 3300006871 | Bacteria | 3667 |
| 147 | Ga0075429_100025185 | 3300006880 | Bacteria | 5165 |
| 148 | Ga0068865_100042100 | 3300006881 | Bacteria | 3112 |
| 149 | Ga0068865_100086607 | 3300006881 | Bacteria | 2262 |
| 150 | Ga0097620_100111626 | 3300006931 | Bacteria | 2797 |
| 151 | Ga0075435_100113729 | 3300007076 | Bacteria | 2253 |
| 152 | Ga0099794_10003558 | 3300007265 | Bacteria | 5965 |
| 153 | Ga0099794_10014932 | 3300007265 | Bacteria | 3415 |
| 154 | Ga0105244_10025014 | 3300009036 | Bacteria | 3251 |
| 155 | Ga0105240_10004619 | 3300009093 | Bacteria | 20879 |
| 156 | Ga0105240_10078101 | 3300009093 | Bacteria | 4077 |
| 157 | Ga0105240_10098010 | 3300009093 | Bacteria | 3571 |
| 158 | Ga0111539_10102731 | 3300009094 | Unclassified | 3355 |
| 159 | Ga0105245_10006581 | 3300009098 | Bacteria | 10200 |
| 160 | Ga0105245_10022850 | 3300009098 | Bacteria | 5487 |
| 161 | Ga0114129_10003918 | 3300009147 | Bacteria | 21004 |
| 162 | Ga0114129_10057414 | 3300009147 | Bacteria | 5447 |
| 163 | Ga0114129_10403563 | 3300009147 | Bacteria | 1801 |
| 164 | Ga0105243_10354979 | 3300009148 | Bacteria | 1347 |
| 165 | Ga0105241_10046984 | 3300009174 | Unclassified | 3280 |
| 166 | Ga0105241_10315112 | 3300009174 | Bacteria | 1347 |
| 167 | Ga0105242_10091188 | 3300009176 | Bacteria | 2565 |
| 168 | Ga0105242_10134701 | 3300009176 | Bacteria | 2137 |
| 169 | Ga0105237_10003650 | 3300009545 | Bacteria | 18149 |
| 170 | Ga0105237_10178738 | 3300009545 | Bacteria | 2122 |
| 171 | Ga0105237_10200135 | 3300009545 | Bacteria | 1997 |
| 172 | Ga0105238_10038373 | 3300009551 | Bacteria | 4865 |
| 173 | Ga0105238_10076445 | 3300009551 | Bacteria | 3339 |
| 174 | Ga0105239_10009773 | 3300010375 | Bacteria | 10783 |
| 175 | Ga0105239_10026856 | 3300010375 | Bacteria | 6336 |
| 176 | Ga0105239_10122142 | 3300010375 | Bacteria | 2893 |
| 177 | Ga0105239_10148129 | 3300010375 | Bacteria | 2619 |
| 178 | Ga0105246_10051850 | 3300011119 | Bacteria | 2818 |
| 179 | Ga0105246_10083087 | 3300011119 | Bacteria | 2287 |
| 180 | Ga0157373_10003934 | 3300013100 | Bacteria | 11217 |
| 181 | Ga0157373_10008463 | 3300013100 | Bacteria | 7639 |
| 182 | Ga0157373_10014407 | 3300013100 | Bacteria | 5796 |
| 183 | Ga0157371_10000089 | 3300013102 | Bacteria | 145483 |
| 184 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 185 | Ga0157369_10018918 | 3300013105 | Bacteria | 7718 |
| 186 | Ga0157374_10016308 | 3300013296 | Bacteria | 6526 |
| 187 | Ga0157378_10013757 | 3300013297 | Bacteria | 7077 |
| 188 | Ga0157378_10021758 | 3300013297 | Bacteria | 5639 |
| 189 | Ga0157378_10091596 | 3300013297 | Bacteria | 2765 |
| 190 | Ga0157378_10106430 | 3300013297 | Bacteria | 2566 |
| 191 | Ga0163162_10044858 | 3300013306 | Bacteria | 4429 |
| 192 | Ga0163162_10059556 | 3300013306 | Bacteria | 3851 |
| 193 | Ga0163162_10115914 | 3300013306 | Bacteria | 2780 |
| 194 | Ga0163162_10159051 | 3300013306 | Unclassified | 2380 |
| 195 | Ga0157372_10000149 | 3300013307 | Bacteria | 76796 |
| 196 | Ga0157372_10145094 | 3300013307 | Bacteria | 2737 |
| 197 | Ga0157380_10063112 | 3300014326 | Unclassified | 2970 |
| 198 | Ga0182008_10003693 | 3300014497 | Bacteria | 9130 |
| 199 | Ga0182008_10007653 | 3300014497 | Bacteria | 5953 |
| 200 | Ga0157379_10048868 | 3300014968 | Bacteria | 3776 |
| 201 | Ga0157376_10024430 | 3300014969 | Bacteria | 4744 |
| 202 | Ga0182006_1027763 | 3300015261 | Bacteria | 2307 |
| 203 | Ga0182007_10000908 | 3300015262 | Bacteria | 16394 |
| 204 | Ga0182007_10036058 | 3300015262 | Bacteria | 1665 |
| 205 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 206 | Ga0206351_10088450 | 3300020077 | Bacteria | 1682 |
| 207 | Ga0213872_10000453 | 3300021361 | Bacteria | 33422 |
| 208 | Ga0213872_10011834 | 3300021361 | Bacteria | 4122 |
| 209 | Ga0224712_10054704 | 3300022467 | Bacteria | 1568 |
| 210 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 211 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 212 | Ga0209784_100435 | 3300025224 | Bacteria | 18206 |
| 213 | Ga0209784_100569 | 3300025224 | Bacteria | 12778 |
| 214 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 215 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 216 | Ga0209566_100251 | 3300025225 | Bacteria | 51274 |
| 217 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 218 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 219 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 220 | Ga0209674_100135 | 3300025226 | Bacteria | 113826 |
| 221 | Ga0209672_100240 | 3300025228 | Bacteria | 41226 |
| 222 | Ga0209672_104301 | 3300025228 | Bacteria | 2674 |
| 223 | Ga0209672_105991 | 3300025228 | Bacteria | 2025 |
| 224 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 225 | Ga0209147_101067 | 3300025229 | Bacteria | 11568 |
| 226 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 227 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 228 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 229 | Ga0207427_100158 | 3300025231 | Bacteria | 76687 |
| 230 | Ga0207427_100679 | 3300025231 | Bacteria | 16155 |
| 231 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 232 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 233 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 234 | Ga0209258_100258 | 3300025242 | Bacteria | 92469 |
| 235 | Ga0209258_100977 | 3300025242 | Bacteria | 13291 |
| 236 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 237 | Ga0209646_1000111 | 3300025246 | Bacteria | 155786 |
| 238 | Ga0209026_1000054 | 3300025250 | Bacteria | 242508 |
| 239 | Ga0209026_1001871 | 3300025250 | Bacteria | 8583 |
| 240 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 241 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 242 | Ga0209677_100050 | 3300025253 | Bacteria | 176828 |
| 243 | Ga0209677_100105 | 3300025253 | Bacteria | 89277 |
| 244 | Ga0209677_107594 | 3300025253 | Bacteria | 2267 |
| 245 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 246 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 247 | Ga0209148_1006163 | 3300025254 | Bacteria | 2632 |
| 248 | Ga0209759_1000043 | 3300025256 | Bacteria | 242513 |
| 249 | Ga0209759_1000332 | 3300025256 | Bacteria | 62148 |
| 250 | Ga0209759_1001539 | 3300025256 | Bacteria | 12648 |
| 251 | Ga0209759_1002064 | 3300025256 | Bacteria | 9414 |
| 252 | Ga0209759_1008320 | 3300025256 | Bacteria | 3244 |
| 253 | Ga0209129_1014394 | 3300025258 | Bacteria | 1686 |
| 254 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 255 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 256 | Ga0209455_1000092 | 3300025272 | Bacteria | 220516 |
| 257 | Ga0209455_1000633 | 3300025272 | Bacteria | 21704 |
| 258 | Ga0209676_1003758 | 3300025292 | Bacteria | 8999 |
| 259 | Ga0209025_1000071 | 3300025294 | Bacteria | 287297 |
| 260 | Ga0209025_1000103 | 3300025294 | Bacteria | 228054 |
| 261 | Ga0209050_1001375 | 3300025298 | Bacteria | 26556 |
| 262 | Ga0209051_1003989 | 3300025303 | Bacteria | 9370 |
| 263 | Ga0209051_1011937 | 3300025303 | Bacteria | 4243 |
| 264 | Ga0209257_1024765 | 3300025304 | Bacteria | 2068 |
| 265 | Ga0209257_1043462 | 3300025304 | Bacteria | 1318 |
| 266 | Ga0207697_10009381 | 3300025315 | Unclassified | 4231 |
| 267 | Ga0207656_10008342 | 3300025321 | Bacteria | 3809 |
| 268 | Ga0207682_10014762 | 3300025893 | Bacteria | 3043 |
| 269 | Ga0207645_10001291 | 3300025907 | Bacteria | 20581 |
| 270 | Ga0207645_10002413 | 3300025907 | Bacteria | 14716 |
| 271 | Ga0207705_10177364 | 3300025909 | Bacteria | 1607 |
| 272 | Ga0207684_10005030 | 3300025910 | Bacteria | 12325 |
| 273 | Ga0207654_10085115 | 3300025911 | Bacteria | 1913 |
| 274 | Ga0207707_10007506 | 3300025912 | Bacteria | 9502 |
| 275 | Ga0207707_10012673 | 3300025912 | Bacteria | 7327 |
| 276 | Ga0207707_10114551 | 3300025912 | Bacteria | 2356 |
| 277 | Ga0207707_10297557 | 3300025912 | Bacteria | 1396 |
| 278 | Ga0207695_10004273 | 3300025913 | Bacteria | 19616 |
| 279 | Ga0207695_10057661 | 3300025913 | Bacteria | 4034 |
| 280 | Ga0207695_10094630 | 3300025913 | Bacteria | 2994 |
| 281 | Ga0207660_10013064 | 3300025917 | Bacteria | 5437 |
| 282 | Ga0207662_10056815 | 3300025918 | Bacteria | 2338 |
| 283 | Ga0207657_10015456 | 3300025919 | Bacteria | 7394 |
| 284 | Ga0207657_10027582 | 3300025919 | Bacteria | 5200 |
| 285 | Ga0207649_10000075 | 3300025920 | Bacteria | 83915 |
| 286 | Ga0207649_10012065 | 3300025920 | Bacteria | 4781 |
| 287 | Ga0207652_10016085 | 3300025921 | Bacteria | 6101 |
| 288 | Ga0207694_10034447 | 3300025924 | Bacteria | 3882 |
| 289 | Ga0207694_10188288 | 3300025924 | Bacteria | 1676 |
| 290 | Ga0207694_10195598 | 3300025924 | Bacteria | 1644 |
| 291 | Ga0207694_10202774 | 3300025924 | Bacteria | 1614 |
| 292 | Ga0207650_10000481 | 3300025925 | Bacteria | 33253 |
| 293 | Ga0207650_10055843 | 3300025925 | Bacteria | 2933 |
| 294 | Ga0207650_10090967 | 3300025925 | Bacteria | 2331 |
| 295 | Ga0207659_10065912 | 3300025926 | Bacteria | 2626 |
| 296 | Ga0207687_10005774 | 3300025927 | Bacteria | 8190 |
| 297 | Ga0207644_10028163 | 3300025931 | Unclassified | 3886 |
| 298 | Ga0207644_10039695 | 3300025931 | Bacteria | 3324 |
| 299 | Ga0207690_10014714 | 3300025932 | Bacteria | 4731 |
| 300 | Ga0207690_10024118 | 3300025932 | Bacteria | 3806 |
| 301 | Ga0207706_10003089 | 3300025933 | Bacteria | 16000 |
| 302 | Ga0207706_10238285 | 3300025933 | Bacteria | 1591 |
| 303 | Ga0207704_10067847 | 3300025938 | Bacteria | 2246 |
| 304 | Ga0207691_10002287 | 3300025940 | Bacteria | 18750 |
| 305 | Ga0207691_10107041 | 3300025940 | Bacteria | 2490 |
| 306 | Ga0207711_10265421 | 3300025941 | Bacteria | 1579 |
| 307 | Ga0207689_10041479 | 3300025942 | Bacteria | 3808 |
| 308 | Ga0207689_10062154 | 3300025942 | Bacteria | 3071 |
| 309 | Ga0207661_10194671 | 3300025944 | Bacteria | 1779 |
| 310 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 311 | Ga0207679_10003108 | 3300025945 | Bacteria | 10278 |
| 312 | Ga0207679_10130171 | 3300025945 | Bacteria | 2017 |
| 313 | Ga0207667_10009547 | 3300025949 | Bacteria | 11417 |
| 314 | Ga0207651_10042178 | 3300025960 | Bacteria | 3035 |
| 315 | Ga0207651_10122395 | 3300025960 | Bacteria | 1975 |
| 316 | Ga0207712_10048412 | 3300025961 | Unclassified | 2957 |
| 317 | Ga0207640_10000084 | 3300025981 | Bacteria | 74504 |
| 318 | Ga0207640_10000813 | 3300025981 | Bacteria | 17745 |
| 319 | Ga0207640_10015942 | 3300025981 | Bacteria | 4361 |
| 320 | Ga0207658_10285067 | 3300025986 | Bacteria | 1417 |
| 321 | Ga0207703_10294716 | 3300026035 | Bacteria | 1477 |
| 322 | Ga0207639_10050298 | 3300026041 | Unclassified | 3165 |
| 323 | Ga0207678_10000012 | 3300026067 | Bacteria | 145324 |
| 324 | Ga0207678_10048694 | 3300026067 | Unclassified | 3663 |
| 325 | Ga0207708_10020329 | 3300026075 | Bacteria | 5008 |
| 326 | Ga0207702_10000020 | 3300026078 | Bacteria | 203299 |
| 327 | Ga0207702_10000376 | 3300026078 | Bacteria | 50989 |
| 328 | Ga0207641_10083691 | 3300026088 | Bacteria | 2775 |
| 329 | Ga0207648_10033728 | 3300026089 | Bacteria | 4515 |
| 330 | Ga0207648_10052066 | 3300026089 | Unclassified | 3579 |
| 331 | Ga0207676_10034239 | 3300026095 | Bacteria | 3845 |
| 332 | Ga0207676_10188715 | 3300026095 | Bacteria | 1812 |
| 333 | Ga0207674_10006196 | 3300026116 | Bacteria | 14099 |
| 334 | Ga0207674_10139974 | 3300026116 | Bacteria | 2380 |
| 335 | Ga0207675_100040471 | 3300026118 | Bacteria | 4352 |
| 336 | Ga0207675_100288250 | 3300026118 | Bacteria | 1597 |
| 337 | Ga0207683_10003551 | 3300026121 | Bacteria | 13603 |
| 338 | Ga0207683_10206555 | 3300026121 | Bacteria | 1786 |
| 339 | Ga0207698_10102209 | 3300026142 | Bacteria | 2379 |
| 340 | Ga0209371_1020996 | 3300027312 | Bacteria | 1593 |
| 341 | Ga0209588_1002366 | 3300027671 | Bacteria | 5111 |
| 342 | Ga0209588_1010407 | 3300027671 | Bacteria | 2796 |
| 343 | Ga0209588_1028256 | 3300027671 | Bacteria | 1785 |
| 344 | Ga0209971_1005267 | 3300027682 | Bacteria | 3075 |
| 345 | Ga0209974_10012579 | 3300027876 | Bacteria | 2828 |
| 346 | Ga0268265_10400740 | 3300028380 | Bacteria | 1268 |
| 347 | Ga0268264_10079495 | 3300028381 | Bacteria | 2798 |
| 348 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 349 | Ga0307517_10058531 | 3300028786 | Bacteria | 3710 |
| 350 | Ga0307515_10002038 | 3300028794 | Bacteria | 44609 |
| 351 | Ga0307515_10038038 | 3300028794 | Bacteria | 7713 |
| 352 | Ga0307515_10038364 | 3300028794 | Bacteria | 7666 |
| 353 | Ga0307515_10054315 | 3300028794 | Bacteria | 5884 |
| 354 | Ga0265324_10000948 | 3300029957 | Bacteria | 18150 |
| 355 | Ga0307512_10011610 | 3300030522 | Bacteria | 8338 |
| 356 | Ga0307512_10070739 | 3300030522 | Bacteria | 2596 |
| 357 | Ga0307512_10118226 | 3300030522 | Bacteria | 1715 |
| 358 | Ga0265327_10037005 | 3300031251 | Bacteria | 2677 |
| 359 | Ga0307513_10011503 | 3300031456 | Bacteria | 10994 |
| 360 | Ga0307513_10090506 | 3300031456 | Bacteria | 3120 |
| 361 | Ga0307509_10001216 | 3300031507 | Bacteria | 43713 |
| 362 | Ga0307509_10011687 | 3300031507 | Bacteria | 10603 |
| 363 | Ga0307509_10139579 | 3300031507 | Bacteria | 2362 |
| 364 | Ga0307509_10179594 | 3300031507 | Bacteria | 1984 |
| 365 | Ga0307408_100038541 | 3300031548 | Unclassified | 3373 |
| 366 | Ga0307408_100059739 | 3300031548 | Bacteria | 2776 |
| 367 | Ga0307514_10164679 | 3300031649 | Bacteria | 1461 |
| 368 | Ga0265342_10000556 | 3300031712 | Bacteria | 39445 |
| 369 | Ga0307516_10001684 | 3300031730 | Bacteria | 30439 |
| 370 | Ga0307516_10015404 | 3300031730 | Bacteria | 8047 |
| 371 | Ga0307405_10008752 | 3300031731 | Bacteria | 5149 |
| 372 | Ga0307412_10000137 | 3300031911 | Bacteria | 53231 |
| 373 | Ga0307412_10132441 | 3300031911 | Bacteria | 1813 |
| 374 | Ga0307414_10012293 | 3300032004 | Bacteria | 5056 |
| 375 | Ga0307411_10019342 | 3300032005 | Bacteria | 3932 |
| 376 | Ga0307415_100110802 | 3300032126 | Unclassified | 2036 |
| 377 | Ga0307507_10051280 | 3300033179 | Bacteria | 3973 |
| 378 | Ga0307510_10159712 | 3300033180 | Bacteria | 1853 |
| 379 | Ga0373928_0020336 | 3300035084 | Bacteria | 1391 |
| 380 | Ga0373934_0066414 | 3300035086 | Bacteria | 1440 |
| 381 | Ga0373956_0042395 | 3300035119 | Bacteria | 2023 |
| 382 | Ga0373931_0004078 | 3300035691 | Bacteria | 6625 |
| 383 | Ga0395899_0234069 | 3300037312 | Bacteria | 1267 |
| 384 | Ga0395898_0108732 | 3300037466 | Bacteria | 2658 |
| 385 | Ga0395905_0016422 | 3300037471 | Bacteria | 7035 |
| 386 | Ga0395905_0052879 | 3300037471 | Bacteria | 3802 |
| 387 | Ga0395901_0034836 | 3300038443 | Bacteria | 5200 |
| 388 | Ga0436361_0837231 | 3300039447 | Bacteria | 44100 |
| 389 | Ga0451795_1108175 | 3300041456 | Bacteria | 1852 |
| 390 | Ga0451802_0838037 | 3300041460 | Bacteria | 2362 |
| 391 | Ga0451841_0285088 | 3300041498 | Bacteria | 1828 |
| 392 | Ga0451577_0413014 | 3300042876 | Bacteria | 1225 |
| 393 | Ga0495592_0000563 | 3300046454 | Bacteria | 26400 |
| 394 | Ga0495651_0001276 | 3300046462 | Bacteria | 19507 |
| 395 | Ga0495580_0015568 | 3300046472 | Bacteria | 5732 |
| 396 | Ga0495639_0004301 | 3300046475 | Bacteria | 6107 |
| 397 | Ga0495607_0000009 | 3300046501 | Bacteria | 216674 |
| 398 | Ga0495608_0018334 | 3300046511 | Bacteria | 4830 |
| 399 | Ga0495610_0039051 | 3300046512 | Bacteria | 2404 |
| 400 | Ga0495620_0017477 | 3300046515 | Bacteria | 3574 |
| 401 | Ga0495628_0001650 | 3300046516 | Bacteria | 20411 |
| 402 | Ga0495628_0026135 | 3300046516 | Bacteria | 4766 |
| 403 | Ga0495632_0049653 | 3300046519 | Bacteria | 2073 |
| 404 | Ga0495648_0065979 | 3300046524 | Bacteria | 2124 |
| 405 | Ga0495666_0056612 | 3300046526 | Bacteria | 1878 |
| 406 | Ga0495642_0015016 | 3300046528 | Bacteria | 3006 |
| 407 | Ga0495642_0106169 | 3300046528 | Bacteria | 1198 |
| 408 | Ga0495652_0003089 | 3300046529 | Bacteria | 16662 |
| 409 | Ga0495625_0000602 | 3300046660 | Bacteria | 52321 |
| 410 | Ga0495659_0038979 | 3300046664 | Bacteria | 1689 |
| 411 | Ga0495661_0029227 | 3300046665 | Bacteria | 3521 |
| 412 | Ga0495623_0001311 | 3300046679 | Bacteria | 16923 |
| 413 | Ga0495623_0011379 | 3300046679 | Bacteria | 5757 |
| 414 | Ga0495646_0001063 | 3300046680 | Bacteria | 15918 |
| 415 | Ga0495658_0048392 | 3300046683 | Bacteria | 2397 |
| 416 | Ga0495600_0020177 | 3300046809 | Bacteria | 4262 |
| 417 | Ga0495687_013016 | 3300047443 | Bacteria | 4363 |
| 418 | Ga0495686_0011776 | 3300047472 | Bacteria | 6154 |
| 419 | Ga0495602_0017442 | 3300048088 | Bacteria | 7199 |
| 420 | Ga0496100_0083360 | 3300048903 | Bacteria | 2164 |
| 421 | Ga0496101_0056881 | 3300048904 | Bacteria | 2827 |
| 422 | Ga0496102_0144584 | 3300048905 | Unclassified | 2231 |
| 423 | Ga0496103_0112413 | 3300048906 | Bacteria | 1731 |
| 424 | Ga0496108_0079585 | 3300048911 | Bacteria | 2775 |
| 425 | Ga0496109_0242694 | 3300048912 | Bacteria | 1696 |
| 426 | Ga0496111_0042150 | 3300048914 | Bacteria | 3277 |
| 427 | Ga0496112_0019288 | 3300048915 | Bacteria | 6434 |
| 428 | Ga0496112_0031926 | 3300048915 | Bacteria | 5111 |
| 429 | Ga0496116_0039211 | 3300048919 | Bacteria | 3277 |
| 430 | Ga0496117_0012798 | 3300048920 | Bacteria | 7359 |
| 431 | Ga0496117_0062034 | 3300048920 | Bacteria | 2565 |
| 432 | Ga0496121_0000411 | 3300048924 | Bacteria | 85089 |
| 433 | Ga0496121_0130845 | 3300048924 | Bacteria | 1878 |
| 434 | Ga0496122_0001568 | 3300048925 | Bacteria | 36083 |
| 435 | Ga0496122_0111268 | 3300048925 | Bacteria | 1796 |
| 436 | Ga0496123_0080219 | 3300048926 | Bacteria | 1990 |
| 437 | Ga0496123_0082706 | 3300048926 | Bacteria | 1945 |
| 438 | Ga0496124_0000103 | 3300048927 | Bacteria | 179162 |
| 439 | Ga0496124_0067965 | 3300048927 | Bacteria | 2963 |
| 440 | Ga0496125_0000096 | 3300048928 | Bacteria | 205618 |
| 441 | Ga0496125_0007183 | 3300048928 | Bacteria | 11877 |
| 442 | Ga0496126_0037790 | 3300048929 | Bacteria | 4499 |
| 443 | Ga0501031_0014987 | 3300049568 | Bacteria | 5035 |
| 444 | Ga0501032_0009263 | 3300049569 | Bacteria | 7138 |
| 445 | Ga0501033_0004879 | 3300049570 | Bacteria | 10682 |
| 446 | Ga0501033_0045764 | 3300049570 | Bacteria | 3255 |
| 447 | Ga0501041_0023036 | 3300049577 | Bacteria | 3732 |
| 448 | Ga0501043_0000010 | 3300049579 | Bacteria | 206374 |
| 449 | Ga0501043_0018580 | 3300049579 | Bacteria | 5454 |
| 450 | Ga0501043_0130414 | 3300049579 | Bacteria | 1970 |
| 451 | Ga0501046_0000132 | 3300049580 | Bacteria | 79506 |
| 452 | Ga0501046_0080947 | 3300049580 | Bacteria | 2508 |
| 453 | Ga0501047_0000026 | 3300049581 | Bacteria | 225296 |
| 454 | Ga0501047_0014502 | 3300049581 | Bacteria | 7495 |
| 455 | Ga0501048_0002295 | 3300049582 | Bacteria | 14590 |
| 456 | Ga0501068_0095979 | 3300049584 | Bacteria | 1833 |
| 457 | Ga0501070_0014719 | 3300049586 | Bacteria | 6582 |
| 458 | Ga0501070_0051865 | 3300049586 | Bacteria | 3404 |
| 459 | Ga0501071_0192313 | 3300049587 | Bacteria | 1531 |
| 460 | Ga0501072_0118147 | 3300049588 | Bacteria | 2112 |
| 461 | Ga0501073_0024666 | 3300049589 | Bacteria | 4318 |
| 462 | Ga0501074_0012356 | 3300049590 | Bacteria | 6206 |
| 463 | Ga0501076_0166138 | 3300049592 | Bacteria | 1798 |
| 464 | Ga0501077_0030023 | 3300049593 | Bacteria | 3457 |
| 465 | Ga0501079_0074034 | 3300049741 | Bacteria | 2632 |
| 466 | Ga0501079_0122229 | 3300049741 | Bacteria | 2025 |
| 467 | Ga0501035_0005340 | 3300049822 | Bacteria | 12155 |
| 468 | Ga0501035_0009597 | 3300049822 | Bacteria | 9000 |
| 469 | Ga0501044_0000045 | 3300049823 | Bacteria | 148353 |
| 470 | Ga0501044_0006513 | 3300049823 | Bacteria | 12897 |
| 471 | Ga0501044_0047658 | 3300049823 | Bacteria | 4432 |
| 472 | nmdc:mga0yw44_131515_c1 | 3300050492 | Bacteria | 1620 |
| 473 | nmdc:mga0k408_118405_c1 | 3300050493 | Bacteria | 1568 |
| 474 | nmdc:mga0k408_27666_c1 | 3300050493 | Bacteria | 3221 |
| 475 | nmdc:mga0k408_732_c1 | 3300050493 | Bacteria | 18001 |
| 476 | nmdc:mga06z11_6883_c1 | 3300050494 | Bacteria | 4651 |
| 477 | nmdc:mga07m45_32159_c1 | 3300050496 | Bacteria | 2910 |
| 478 | nmdc:mga07m45_434_c1 | 3300050496 | Bacteria | 17366 |
| 479 | nmdc:mga07m45_50697_c1 | 3300050496 | Bacteria | 2340 |
| 480 | nmdc:mga05p37_202878_c1 | 3300050507 | Bacteria | 2400 |
| 481 | nmdc:mga09592_107867_c1 | 3300050508 | Bacteria | 2388 |
| 482 | nmdc:mga0qj67_189184_c1 | 3300050509 | Bacteria | 1673 |
| 483 | nmdc:mga06r32_100409_c1 | 3300050510 | Bacteria | 2839 |
| 484 | nmdc:mga06r32_36209_c1 | 3300050510 | Bacteria | 4661 |
| 485 | nmdc:mga08y16_86176_c1 | 3300050511 | Bacteria | 3273 |
| 486 | nmdc:mga0n895_116726_c1 | 3300050512 | Unclassified | 2688 |
| 487 | nmdc:mga0n895_15430_c1 | 3300050512 | Bacteria | 6966 |
| 488 | nmdc:mga0n895_16785_c1 | 3300050512 | Bacteria | 6727 |
| 489 | nmdc:mga0n895_686744_c1 | 3300050512 | Unclassified | 1020 |
| 490 | nmdc:mga0n895_8459_c1 | 3300050512 | Bacteria | 8910 |
| 491 | nmdc:mga0rr50_254317_c1 | 3300050513 | Bacteria | 1460 |
| 492 | nmdc:mga0rr50_34582_c1 | 3300050513 | Bacteria | 3620 |
| 493 | nmdc:mga0rr50_9819_c1 | 3300050513 | Bacteria | 6043 |
| 494 | nmdc:mga08x19_71890_c1 | 3300050514 | Bacteria | 2256 |
| 495 | nmdc:mga0a205_158611_c1 | 3300050515 | Bacteria | 2160 |
| 496 | nmdc:mga0a205_169288_c1 | 3300050515 | Bacteria | 2080 |
| 497 | nmdc:mga0a205_31569_c1 | 3300050515 | Bacteria | 5075 |
| 498 | Ga0500635_0000007 | 3300053080 | Bacteria | 169379 |
| 499 | Ga0500644_0002663 | 3300053088 | Bacteria | 4459 |
| 500 | Ga0500651_0015446 | 3300053093 | Bacteria | 4685 |
| 501 | Ga0500594_0001534 | 3300053118 | Bacteria | 5029 |
| 502 | Ga0500574_001794 | 3300053141 | Bacteria | 3328 |
| 503 | Ga0500622_0000585 | 3300053156 | Bacteria | 33068 |
| 504 | Ga0500634_0003843 | 3300053161 | Bacteria | 6800 |
| 505 | Ga0501084_0071460 | 3300054114 | Bacteria | 2906 |
| 506 | Ga0590077_012424 | 3300059426 | Bacteria | 1765 |
| 507 | Ga0587067_003515 | 3300059640 | Bacteria | 1966 |
| 508 | Ga0587068_003846 | 3300059641 | Bacteria | 1950 |
| 509 | Ga0587072_001638 | 3300059643 | Bacteria | 2833 |
| 510 | Ga0501082_0012399 | 3300060353 | Bacteria | 7325 |
| 511 | Ga0466962_0006170 | 3300061719 | Bacteria | 5758 |
| 512 | Ga0530510_0122412 | 3300061734 | Bacteria | 1910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005343 | Ga0070687_100051249 | Ga0070687_1000512492 | 289 |
| 2 | 3300050512 | nmdc:mga0n895_686744_c1 | nmdc:mga0n895_686744_c1_16_948 | 293 |
| 3 | 3300005458 | Ga0070681_10079034 | Ga0070681_100790343 | 328 |
| 4 | 3300009147 | Ga0114129_10003918 | Ga0114129_1000391815 | 329 |
| 5 | 3300025912 | Ga0207707_10114551 | Ga0207707_101145512 | 330 |
| 6 | 3300027671 | Ga0209588_1002366 | Ga0209588_10023663 | 332 |
| 7 | 3300007265 | Ga0099794_10003558 | Ga0099794_100035582 | 336 |
| 8 | 3300026121 | Ga0207683_10206555 | Ga0207683_102065552 | 336 |
| 9 | 3300003320 | rootH2_10006384 | rootH2_100063846 | 337 |
| 10 | 3300037466 | Ga0395898_0108732 | Ga0395898_0108732_922_2085 | 337 |
| 11 | 3300038443 | Ga0395901_0034836 | Ga0395901_0034836_3489_4652 | 337 |
| 12 | 3300041498 | Ga0451841_0285088 | Ga0451841_0285088_209_1297 | 338 |
| 13 | 3300002772 | JGI25164J39214_1003957 | JGI25164J39214_10039571 | 340 |
| 14 | 3300009147 | Ga0114129_10403563 | Ga0114129_104035631 | 340 |
| 15 | 3300013297 | Ga0157378_10091596 | Ga0157378_100915963 | 340 |
| 16 | 3300025231 | Ga0207427_100158 | Ga0207427_10015829 | 340 |
| 17 | 3300026118 | Ga0207675_100040471 | Ga0207675_1000404713 | 340 |
| 18 | 3300028380 | Ga0268265_10400740 | Ga0268265_104007401 | 340 |
| 19 | 3300003752 | Ga0055539_1000118 | Ga0055539_10001188 | 341 |
| 20 | 3300003756 | Ga0055533_1000010 | Ga0055533_1000010368 | 341 |
| 21 | 3300003759 | Ga0055525_1000415 | Ga0055525_10004156 | 341 |
| 22 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031702 | 341 |
| 23 | 3300025230 | Ga0209563_100049 | Ga0209563_100049164 | 341 |
| 24 | 3300025253 | Ga0209677_100050 | Ga0209677_100050121 | 341 |
| 25 | 3300025941 | Ga0207711_10265421 | Ga0207711_102654211 | 341 |
| 26 | 3300002705 | JGI25156J39149_1000060 | JGI25156J39149_100006068 | 342 |
| 27 | 3300002705 | JGI25156J39149_1000175 | JGI25156J39149_100017531 | 342 |
| 28 | 3300002738 | JGI25154J39366_1002385 | JGI25154J39366_10023855 | 342 |
| 29 | 3300002741 | JGI25157J39369_1000029 | JGI25157J39369_1000029100 | 342 |
| 30 | 3300003752 | Ga0055539_1000739 | Ga0055539_10007397 | 342 |
| 31 | 3300005578 | Ga0068854_100004203 | Ga0068854_1000042035 | 342 |
| 32 | 3300005614 | Ga0068856_100005146 | Ga0068856_1000051467 | 342 |
| 33 | 3300009551 | Ga0105238_10038373 | Ga0105238_100383733 | 342 |
| 34 | 3300010375 | Ga0105239_10009773 | Ga0105239_100097738 | 342 |
| 35 | 3300025246 | Ga0209646_1000111 | Ga0209646_1000111140 | 342 |
| 36 | 3300025250 | Ga0209026_1000054 | Ga0209026_100005487 | 342 |
| 37 | 3300025253 | Ga0209677_100105 | Ga0209677_1001059 | 342 |
| 38 | 3300025256 | Ga0209759_1000043 | Ga0209759_1000043140 | 342 |
| 39 | 3300025911 | Ga0207654_10085115 | Ga0207654_100851152 | 342 |
| 40 | 3300025924 | Ga0207694_10034447 | Ga0207694_100344473 | 342 |
| 41 | 3300025944 | Ga0207661_10194671 | Ga0207661_101946712 | 342 |
| 42 | 3300025981 | Ga0207640_10000813 | Ga0207640_1000081311 | 342 |
| 43 | 3300026078 | Ga0207702_10000376 | Ga0207702_100003765 | 342 |
| 44 | 3300037312 | Ga0395899_0234069 | Ga0395899_0234069_83_1246 | 342 |
| 45 | 3300007265 | Ga0099794_10014932 | Ga0099794_100149322 | 343 |
| 46 | 3300025949 | Ga0207667_10009547 | Ga0207667_100095472 | 343 |
| 47 | 3300027671 | Ga0209588_1010407 | Ga0209588_10104073 | 343 |
| 48 | 3300027671 | Ga0209588_1028256 | Ga0209588_10282562 | 343 |
| 49 | 3300035086 | Ga0373934_0066414 | Ga0373934_0066414_57_1220 | 343 |
| 50 | 3300003761 | Ga0055535_1000282 | Ga0055535_100028241 | 344 |
| 51 | 3300003763 | Ga0055529_1000491 | Ga0055529_100049127 | 344 |
| 52 | 3300025228 | Ga0209672_105991 | Ga0209672_1059911 | 344 |
| 53 | 3300025242 | Ga0209258_100258 | Ga0209258_10025810 | 344 |
| 54 | 3300025254 | Ga0209148_1006163 | Ga0209148_10061632 | 344 |
| 55 | 3300025256 | Ga0209759_1001539 | Ga0209759_100153910 | 344 |
| 56 | 3300025272 | Ga0209455_1000092 | Ga0209455_1000092194 | 344 |
| 57 | 3300025303 | Ga0209051_1011937 | Ga0209051_10119372 | 344 |
| 58 | 3300030522 | Ga0307512_10118226 | Ga0307512_101182261 | 344 |
| 59 | 3300005445 | Ga0070708_100000336 | Ga0070708_10000033616 | 345 |
| 60 | 3300005518 | Ga0070699_100139989 | Ga0070699_1001399892 | 345 |
| 61 | 3300005536 | Ga0070697_100022408 | Ga0070697_1000224083 | 345 |
| 62 | 3300028666 | Ga0265336_10000006 | Ga0265336_10000006162 | 345 |
| 63 | 3300029957 | Ga0265324_10000948 | Ga0265324_100009482 | 345 |
| 64 | 3300031507 | Ga0307509_10179594 | Ga0307509_101795941 | 345 |
| 65 | 3300049586 | Ga0501070_0051865 | Ga0501070_0051865_1475_2686 | 345 |
| 66 | 3300049582 | Ga0501048_0002295 | Ga0501048_0002295_20_1129 | 346 |
| 67 | 3300006852 | Ga0075433_10082925 | Ga0075433_100829251 | 347 |
| 68 | 3300046475 | Ga0495639_0004301 | Ga0495639_0004301_4100_5251 | 347 |
| 69 | 3300050512 | nmdc:mga0n895_16785_c1 | nmdc:mga0n895_16785_c1_1635_2786 | 347 |
| 70 | 3300050515 | nmdc:mga0a205_31569_c1 | nmdc:mga0a205_31569_c1_3682_4833 | 347 |
| 71 | 3300005335 | Ga0070666_10020261 | Ga0070666_100202613 | 348 |
| 72 | 3300005367 | Ga0070667_100081858 | Ga0070667_1000818581 | 348 |
| 73 | 3300005841 | Ga0068863_100308158 | Ga0068863_1003081581 | 348 |
| 74 | 3300009148 | Ga0105243_10354979 | Ga0105243_103549791 | 348 |
| 75 | 3300009176 | Ga0105242_10091188 | Ga0105242_100911882 | 348 |
| 76 | 3300013306 | Ga0163162_10044858 | Ga0163162_100448583 | 348 |
| 77 | 3300014497 | Ga0182008_10003693 | Ga0182008_100036937 | 348 |
| 78 | 3300015262 | Ga0182007_10000908 | Ga0182007_1000090815 | 348 |
| 79 | 3300025942 | Ga0207689_10041479 | Ga0207689_100414792 | 348 |
| 80 | 3300025960 | Ga0207651_10042178 | Ga0207651_100421782 | 348 |
| 81 | 3300025986 | Ga0207658_10285067 | Ga0207658_102850671 | 348 |
| 82 | 3300046528 | Ga0495642_0106169 | Ga0495642_0106169_14_1165 | 348 |
| 83 | 3300025924 | Ga0207694_10195598 | Ga0207694_101955982 | 349 |
| 84 | 3300046462 | Ga0495651_0001276 | Ga0495651_0001276_11207_12364 | 349 |
| 85 | 3300046516 | Ga0495628_0001650 | Ga0495628_0001650_17466_18623 | 349 |
| 86 | 3300046529 | Ga0495652_0003089 | Ga0495652_0003089_14927_16084 | 349 |
| 87 | 3300046679 | Ga0495623_0001311 | Ga0495623_0001311_15091_16248 | 349 |
| 88 | 3300048088 | Ga0495602_0017442 | Ga0495602_0017442_1321_2478 | 349 |
| 89 | 3300048912 | Ga0496109_0242694 | Ga0496109_0242694_206_1375 | 349 |
| 90 | 3300015683 | Ga0183362_10003 | Ga0183362_10003371 | 350 |
| 91 | 3300025924 | Ga0207694_10188288 | Ga0207694_101882882 | 350 |
| 92 | iso_pu_bacteria | 2857576091 | 2857578059 | 350 |
| 93 | 3300006847 | Ga0075431_100003080 | Ga0075431_1000030802 | 351 |
| 94 | 3300050510 | nmdc:mga06r32_100409_c1 | nmdc:mga06r32_100409_c1_1664_2782 | 351 |
| 95 | 3300009545 | Ga0105237_10200135 | Ga0105237_102001352 | 352 |
| 96 | 3300005327 | Ga0070658_10016597 | Ga0070658_100165973 | 353 |
| 97 | 3300048903 | Ga0496100_0083360 | Ga0496100_0083360_872_2023 | 353 |
| 98 | 3300048911 | Ga0496108_0079585 | Ga0496108_0079585_1160_2311 | 353 |
| 99 | 3300048928 | Ga0496125_0007183 | Ga0496125_0007183_1209_2360 | 353 |
| 100 | 3300005327 | Ga0070658_10129050 | Ga0070658_101290502 | 354 |
| 101 | 3300013306 | Ga0163162_10115914 | Ga0163162_101159142 | 354 |
| 102 | 3300003187 | JGI25151J46595_10030179 | JGI25151J46595_100301792 | 355 |
| 103 | 3300003316 | rootH1_10009484 | rootH1_100094844 | 355 |
| 104 | 3300003320 | rootH2_10082770 | rootH2_100827702 | 355 |
| 105 | 3300003323 | rootH1_10024154 | rootH1_100241544 | 355 |
| 106 | 3300003761 | Ga0055535_1000076 | Ga0055535_10000768 | 355 |
| 107 | 3300003762 | Ga0055542_1000009 | Ga0055542_1000009204 | 355 |
| 108 | 3300005578 | Ga0068854_100077689 | Ga0068854_1000776893 | 355 |
| 109 | 3300006195 | Ga0075366_10024677 | Ga0075366_100246772 | 355 |
| 110 | 3300009093 | Ga0105240_10004619 | Ga0105240_1000461915 | 355 |
| 111 | 3300009093 | Ga0105240_10098010 | Ga0105240_100980102 | 355 |
| 112 | 3300009545 | Ga0105237_10003650 | Ga0105237_1000365016 | 355 |
| 113 | 3300009551 | Ga0105238_10076445 | Ga0105238_100764452 | 355 |
| 114 | 3300010375 | Ga0105239_10026856 | Ga0105239_100268562 | 355 |
| 115 | 3300010375 | Ga0105239_10122142 | Ga0105239_101221423 | 355 |
| 116 | 3300010375 | Ga0105239_10148129 | Ga0105239_101481293 | 355 |
| 117 | 3300013100 | Ga0157373_10008463 | Ga0157373_100084635 | 355 |
| 118 | 3300013307 | Ga0157372_10145094 | Ga0157372_101450942 | 355 |
| 119 | 3300025229 | Ga0209147_101067 | Ga0209147_1010672 | 355 |
| 120 | 3300025242 | Ga0209258_100009 | Ga0209258_100009448 | 355 |
| 121 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007448 | 355 |
| 122 | 3300025256 | Ga0209759_1000332 | Ga0209759_10003326 | 355 |
| 123 | 3300025258 | Ga0209129_1014394 | Ga0209129_10143942 | 355 |
| 124 | 3300025294 | Ga0209025_1000103 | Ga0209025_100010361 | 355 |
| 125 | 3300025304 | Ga0209257_1024765 | Ga0209257_10247653 | 355 |
| 126 | 3300025321 | Ga0207656_10008342 | Ga0207656_100083424 | 355 |
| 127 | 3300025913 | Ga0207695_10094630 | Ga0207695_100946303 | 355 |
| 128 | 3300025924 | Ga0207694_10202774 | Ga0207694_102027742 | 355 |
| 129 | 3300031456 | Ga0307513_10011503 | Ga0307513_100115033 | 355 |
| 130 | 3300048906 | Ga0496103_0112413 | Ga0496103_0112413_14_1141 | 355 |
| 131 | 3300048926 | Ga0496123_0082706 | Ga0496123_0082706_51_1205 | 355 |
| 132 | 3300048927 | Ga0496124_0067965 | Ga0496124_0067965_448_1602 | 355 |
| 133 | 3300050493 | nmdc:mga0k408_27666_c1 | nmdc:mga0k408_27666_c1_1759_2922 | 355 |
| 134 | 3300050512 | nmdc:mga0n895_8459_c1 | nmdc:mga0n895_8459_c1_2769_3899 | 355 |
| 135 | 3300050513 | nmdc:mga0rr50_9819_c1 | nmdc:mga0rr50_9819_c1_2592_3722 | 355 |
| 136 | 3300050515 | nmdc:mga0a205_158611_c1 | nmdc:mga0a205_158611_c1_391_1521 | 355 |
| 137 | 3300001979 | JGI24740J21852_10002700 | JGI24740J21852_100027004 | 356 |
| 138 | 3300002705 | JGI25156J39149_1001779 | JGI25156J39149_10017796 | 356 |
| 139 | 3300002738 | JGI25154J39366_1000129 | JGI25154J39366_100012929 | 356 |
| 140 | 3300003323 | rootH1_10142259 | rootH1_101422592 | 356 |
| 141 | 3300003756 | Ga0055533_1000421 | Ga0055533_10004218 | 356 |
| 142 | 3300003762 | Ga0055542_1000724 | Ga0055542_100072420 | 356 |
| 143 | 3300005338 | Ga0068868_100010559 | Ga0068868_1000105594 | 356 |
| 144 | 3300005355 | Ga0070671_100005369 | Ga0070671_1000053694 | 356 |
| 145 | 3300005456 | Ga0070678_100030127 | Ga0070678_1000301273 | 356 |
| 146 | 3300005618 | Ga0068864_100009857 | Ga0068864_1000098577 | 356 |
| 147 | 3300005842 | Ga0068858_100213312 | Ga0068858_1002133121 | 356 |
| 148 | 3300005843 | Ga0068860_100123403 | Ga0068860_1001234032 | 356 |
| 149 | 3300006237 | Ga0097621_100221734 | Ga0097621_1002217342 | 356 |
| 150 | 3300009098 | Ga0105245_10006581 | Ga0105245_100065814 | 356 |
| 151 | 3300013306 | Ga0163162_10059556 | Ga0163162_100595562 | 356 |
| 152 | 3300014968 | Ga0157379_10048868 | Ga0157379_100488682 | 356 |
| 153 | 3300025224 | Ga0209784_100569 | Ga0209784_1005695 | 356 |
| 154 | 3300025225 | Ga0209566_100251 | Ga0209566_10025145 | 356 |
| 155 | 3300025226 | Ga0209674_100135 | Ga0209674_10013559 | 356 |
| 156 | 3300025246 | Ga0209646_1000027 | Ga0209646_1000027273 | 356 |
| 157 | 3300025250 | Ga0209026_1001871 | Ga0209026_10018712 | 356 |
| 158 | 3300025253 | Ga0209677_107594 | Ga0209677_1075942 | 356 |
| 159 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019367 | 356 |
| 160 | 3300025256 | Ga0209759_1002064 | Ga0209759_10020644 | 356 |
| 161 | 3300025909 | Ga0207705_10177364 | Ga0207705_101773641 | 356 |
| 162 | 3300025927 | Ga0207687_10005774 | Ga0207687_100057742 | 356 |
| 163 | 3300026035 | Ga0207703_10294716 | Ga0207703_102947162 | 356 |
| 164 | 3300026088 | Ga0207641_10083691 | Ga0207641_100836913 | 356 |
| 165 | 3300026095 | Ga0207676_10034239 | Ga0207676_100342393 | 356 |
| 166 | 3300028381 | Ga0268264_10079495 | Ga0268264_100794952 | 356 |
| 167 | iso_pu_bacteria | 2904479285 | 2904481508 | 356 |
| 168 | 3300005290 | Ga0065712_10000421 | Ga0065712_100004216 | 357 |
| 169 | 3300005293 | Ga0065715_10089174 | Ga0065715_100891746 | 357 |
| 170 | 3300005295 | Ga0065707_10190054 | Ga0065707_101900541 | 357 |
| 171 | 3300005328 | Ga0070676_10038698 | Ga0070676_100386983 | 357 |
| 172 | 3300005355 | Ga0070671_100161985 | Ga0070671_1001619852 | 357 |
| 173 | 3300005366 | Ga0070659_100014344 | Ga0070659_1000143444 | 357 |
| 174 | 3300005457 | Ga0070662_100059309 | Ga0070662_1000593095 | 357 |
| 175 | 3300005577 | Ga0068857_100166686 | Ga0068857_1001666862 | 357 |
| 176 | 3300006852 | Ga0075433_10041459 | Ga0075433_100414596 | 357 |
| 177 | 3300006871 | Ga0075434_100025998 | Ga0075434_1000259982 | 357 |
| 178 | 3300006871 | Ga0075434_100063792 | Ga0075434_1000637923 | 357 |
| 179 | 3300007076 | Ga0075435_100113729 | Ga0075435_1001137292 | 357 |
| 180 | 3300009147 | Ga0114129_10057414 | Ga0114129_100574141 | 357 |
| 181 | 3300014497 | Ga0182008_10007653 | Ga0182008_100076534 | 357 |
| 182 | 3300025919 | Ga0207657_10027582 | Ga0207657_100275822 | 357 |
| 183 | 3300025925 | Ga0207650_10090967 | Ga0207650_100909673 | 357 |
| 184 | 3300025933 | Ga0207706_10238285 | Ga0207706_102382852 | 357 |
| 185 | 3300025945 | Ga0207679_10130171 | Ga0207679_101301712 | 357 |
| 186 | 3300035691 | Ga0373931_0004078 | Ga0373931_0004078_3260_4402 | 357 |
| 187 | 3300042876 | Ga0451577_0413014 | Ga0451577_0413014_47_1189 | 357 |
| 188 | 3300048914 | Ga0496111_0042150 | Ga0496111_0042150_1575_2717 | 357 |
| 189 | 3300048915 | Ga0496112_0031926 | Ga0496112_0031926_466_1608 | 357 |
| 190 | 3300050507 | nmdc:mga05p37_202878_c1 | nmdc:mga05p37_202878_c1_1083_2228 | 357 |
| 191 | 3300050511 | nmdc:mga08y16_86176_c1 | nmdc:mga08y16_86176_c1_2109_3251 | 357 |
| 192 | 3300050512 | nmdc:mga0n895_15430_c1 | nmdc:mga0n895_15430_c1_850_1992 | 357 |
| 193 | 3300050513 | nmdc:mga0rr50_34582_c1 | nmdc:mga0rr50_34582_c1_2078_3220 | 357 |
| 194 | 3300050514 | nmdc:mga08x19_71890_c1 | nmdc:mga08x19_71890_c1_902_2044 | 357 |
| 195 | 3300050515 | nmdc:mga0a205_169288_c1 | nmdc:mga0a205_169288_c1_319_1461 | 357 |
| 196 | 3300003763 | Ga0055529_1000810 | Ga0055529_100081016 | 358 |
| 197 | 3300005335 | Ga0070666_10200122 | Ga0070666_102001221 | 358 |
| 198 | 3300006178 | Ga0075367_10019273 | Ga0075367_100192733 | 358 |
| 199 | 3300013297 | Ga0157378_10013757 | Ga0157378_100137577 | 358 |
| 200 | 3300025228 | Ga0209672_104301 | Ga0209672_1043011 | 358 |
| 201 | 3300025272 | Ga0209455_1000633 | Ga0209455_100063315 | 358 |
| 202 | 3300028794 | Ga0307515_10002038 | Ga0307515_1000203825 | 358 |
| 203 | 3300028794 | Ga0307515_10054315 | Ga0307515_100543154 | 358 |
| 204 | 3300030522 | Ga0307512_10070739 | Ga0307512_100707392 | 358 |
| 205 | 3300031730 | Ga0307516_10015404 | Ga0307516_100154045 | 358 |
| 206 | 3300031911 | Ga0307412_10132441 | Ga0307412_101324413 | 358 |
| 207 | 3300032004 | Ga0307414_10012293 | Ga0307414_100122937 | 358 |
| 208 | 3300032005 | Ga0307411_10019342 | Ga0307411_100193422 | 358 |
| 209 | 3300032126 | Ga0307415_100110802 | Ga0307415_1001108022 | 358 |
| 210 | 3300041456 | Ga0451795_1108175 | Ga0451795_1108175_604_1764 | 358 |
| 211 | 3300041460 | Ga0451802_0838037 | Ga0451802_0838037_919_2079 | 358 |
| 212 | 3300046515 | Ga0495620_0017477 | Ga0495620_0017477_562_1722 | 358 |
| 213 | 3300046519 | Ga0495632_0049653 | Ga0495632_0049653_855_2015 | 358 |
| 214 | 3300046660 | Ga0495625_0000602 | Ga0495625_0000602_49351_50511 | 358 |
| 215 | 3300049822 | Ga0501035_0009597 | Ga0501035_0009597_7722_8873 | 358 |
| 216 | 3300049823 | Ga0501044_0000045 | Ga0501044_0000045_101665_102816 | 358 |
| 217 | 3300050493 | nmdc:mga0k408_118405_c1 | nmdc:mga0k408_118405_c1_69_1229 | 358 |
| 218 | 3300053080 | Ga0500635_0000007 | Ga0500635_0000007_73319_74497 | 358 |
| 219 | iso_pu_bacteria | 2585428062 | 2587755844 | 358 |
| 220 | iso_pu_bacteria | 2818991436 | 2819542599 | 358 |
| 221 | 3300003791 | Ga0055530_10020060 | Ga0055530_100200602 | 359 |
| 222 | 3300005471 | Ga0070698_100291246 | Ga0070698_1002912462 | 359 |
| 223 | 3300006846 | Ga0075430_100208405 | Ga0075430_1002084052 | 359 |
| 224 | 3300006880 | Ga0075429_100025185 | Ga0075429_1000251852 | 359 |
| 225 | 3300025304 | Ga0209257_1043462 | Ga0209257_10434622 | 359 |
| 226 | 3300027682 | Ga0209971_1005267 | Ga0209971_10052673 | 359 |
| 227 | 3300027876 | Ga0209974_10012579 | Ga0209974_100125792 | 359 |
| 228 | 3300031548 | Ga0307408_100038541 | Ga0307408_1000385413 | 359 |
| 229 | 3300031548 | Ga0307408_100059739 | Ga0307408_1000597391 | 359 |
| 230 | 3300031712 | Ga0265342_10000556 | Ga0265342_1000055613 | 359 |
| 231 | 3300031731 | Ga0307405_10008752 | Ga0307405_100087522 | 359 |
| 232 | 3300035119 | Ga0373956_0042395 | Ga0373956_0042395_171_1325 | 359 |
| 233 | 3300037471 | Ga0395905_0016422 | Ga0395905_0016422_3650_4789 | 359 |
| 234 | 3300037471 | Ga0395905_0052879 | Ga0395905_0052879_2165_3304 | 359 |
| 235 | 3300046528 | Ga0495642_0015016 | Ga0495642_0015016_802_1956 | 359 |
| 236 | 3300046665 | Ga0495661_0029227 | Ga0495661_0029227_1246_2400 | 359 |
| 237 | 3300047443 | Ga0495687_013016 | Ga0495687_013016_3117_4271 | 359 |
| 238 | 3300048904 | Ga0496101_0056881 | Ga0496101_0056881_917_2071 | 359 |
| 239 | 3300048919 | Ga0496116_0039211 | Ga0496116_0039211_1347_2501 | 359 |
| 240 | 3300048920 | Ga0496117_0012798 | Ga0496117_0012798_1468_2622 | 359 |
| 241 | 3300048924 | Ga0496121_0130845 | Ga0496121_0130845_479_1633 | 359 |
| 242 | 3300048925 | Ga0496122_0111268 | Ga0496122_0111268_488_1642 | 359 |
| 243 | 3300048926 | Ga0496123_0080219 | Ga0496123_0080219_689_1843 | 359 |
| 244 | 3300049741 | Ga0501079_0122229 | Ga0501079_0122229_257_1405 | 359 |
| 245 | 3300050508 | nmdc:mga09592_107867_c1 | nmdc:mga09592_107867_c1_550_1698 | 359 |
| 246 | 3300050509 | nmdc:mga0qj67_189184_c1 | nmdc:mga0qj67_189184_c1_87_1238 | 359 |
| 247 | 3300050510 | nmdc:mga06r32_36209_c1 | nmdc:mga06r32_36209_c1_546_1694 | 359 |
| 248 | 3300054114 | Ga0501084_0071460 | Ga0501084_0071460_1515_2663 | 359 |
| 249 | iso_pu_bacteria | 2596583598 | 2597027979 | 359 |
| 250 | iso_pu_bacteria | 2599185178 | 2599444652 | 359 |
| 251 | iso_pu_bacteria | 2599185292 | 2599904618 | 359 |
| 252 | iso_pu_bacteria | 2643221569 | 2643861165 | 359 |
| 253 | iso_pu_bacteria | 2643221594 | 2643983373 | 359 |
| 254 | iso_pu_bacteria | 2643221621 | 2644124513 | 359 |
| 255 | iso_pu_bacteria | 2643221654 | 2644301855 | 359 |
| 256 | iso_pu_bacteria | 2808606395 | 2809032709 | 359 |
| 257 | iso_pu_bacteria | 2855730933 | 2855735070 | 359 |
| 258 | iso_pu_bacteria | 2855767633 | 2855770854 | 359 |
| 259 | iso_pu_bacteria | 2857537821 | 2857540529 | 359 |
| 260 | iso_pu_bacteria | 2857542790 | 2857543447 | 359 |
| 261 | iso_pu_bacteria | 2858950400 | 2858951315 | 359 |
| 262 | iso_pu_bacteria | 2881412998 | 2881418244 | 359 |
| 263 | iso_pu_bacteria | 2885266251 | 2885266425 | 359 |
| 264 | iso_pu_bacteria | 2900577576 | 2900580034 | 359 |
| 265 | iso_pu_bacteria | 2928058823 | 2928059790 | 359 |
| 266 | iso_pu_bacteria | 2941479691 | 2941485355 | 359 |
| 267 | 3300002737 | JGI25162J39368_1000036 | JGI25162J39368_100003643 | 360 |
| 268 | 3300003214 | JGI25165J46597_1000022 | JGI25165J46597_1000022315 | 360 |
| 269 | 3300003751 | Ga0055538_1000011 | Ga0055538_100001142 | 360 |
| 270 | 3300003752 | Ga0055539_1000016 | Ga0055539_1000016315 | 360 |
| 271 | 3300003756 | Ga0055533_1000019 | Ga0055533_1000019315 | 360 |
| 272 | 3300003759 | Ga0055525_1000042 | Ga0055525_100004243 | 360 |
| 273 | 3300003841 | Ga0055541_1000017 | Ga0055541_1000017250 | 360 |
| 274 | 3300005328 | Ga0070676_10024807 | Ga0070676_100248073 | 360 |
| 275 | 3300005331 | Ga0070670_100068546 | Ga0070670_1000685462 | 360 |
| 276 | 3300005333 | Ga0070677_10018449 | Ga0070677_100184492 | 360 |
| 277 | 3300005354 | Ga0070675_100054510 | Ga0070675_1000545103 | 360 |
| 278 | 3300005355 | Ga0070671_100025924 | Ga0070671_1000259249 | 360 |
| 279 | 3300005364 | Ga0070673_100071309 | Ga0070673_1000713093 | 360 |
| 280 | 3300005530 | Ga0070679_100052774 | Ga0070679_1000527743 | 360 |
| 281 | 3300005543 | Ga0070672_100064127 | Ga0070672_1000641273 | 360 |
| 282 | 3300005546 | Ga0070696_100014843 | Ga0070696_1000148435 | 360 |
| 283 | 3300005617 | Ga0068859_100111632 | Ga0068859_1001116322 | 360 |
| 284 | 3300005840 | Ga0068870_10011924 | Ga0068870_100119242 | 360 |
| 285 | 3300006353 | Ga0075370_10033148 | Ga0075370_100331482 | 360 |
| 286 | 3300006358 | Ga0068871_100333652 | Ga0068871_1003336521 | 360 |
| 287 | 3300006881 | Ga0068865_100086607 | Ga0068865_1000866071 | 360 |
| 288 | 3300006931 | Ga0097620_100111626 | Ga0097620_1001116264 | 360 |
| 289 | 3300009176 | Ga0105242_10134701 | Ga0105242_101347012 | 360 |
| 290 | 3300011119 | Ga0105246_10051850 | Ga0105246_100518504 | 360 |
| 291 | 3300013297 | Ga0157378_10106430 | Ga0157378_101064303 | 360 |
| 292 | 3300015262 | Ga0182007_10036058 | Ga0182007_100360581 | 360 |
| 293 | 3300025224 | Ga0209784_100019 | Ga0209784_100019392 | 360 |
| 294 | 3300025225 | Ga0209566_100017 | Ga0209566_100017392 | 360 |
| 295 | 3300025226 | Ga0209674_100031 | Ga0209674_100031392 | 360 |
| 296 | 3300025230 | Ga0209563_100035 | Ga0209563_100035392 | 360 |
| 297 | 3300025231 | Ga0207427_100679 | Ga0207427_1006796 | 360 |
| 298 | 3300025233 | Ga0209437_100038 | Ga0209437_100038392 | 360 |
| 299 | 3300025253 | Ga0209677_100020 | Ga0209677_100020392 | 360 |
| 300 | 3300025261 | Ga0209233_1000049 | Ga0209233_1000049392 | 360 |
| 301 | 3300025893 | Ga0207682_10014762 | Ga0207682_100147623 | 360 |
| 302 | 3300025907 | Ga0207645_10002413 | Ga0207645_1000241314 | 360 |
| 303 | 3300025912 | Ga0207707_10012673 | Ga0207707_100126737 | 360 |
| 304 | 3300025912 | Ga0207707_10297557 | Ga0207707_102975572 | 360 |
| 305 | 3300025925 | Ga0207650_10055843 | Ga0207650_100558431 | 360 |
| 306 | 3300025926 | Ga0207659_10065912 | Ga0207659_100659122 | 360 |
| 307 | 3300025931 | Ga0207644_10039695 | Ga0207644_100396952 | 360 |
| 308 | 3300025938 | Ga0207704_10067847 | Ga0207704_100678472 | 360 |
| 309 | 3300025940 | Ga0207691_10107041 | Ga0207691_101070412 | 360 |
| 310 | 3300025942 | Ga0207689_10062154 | Ga0207689_100621543 | 360 |
| 311 | 3300025960 | Ga0207651_10122395 | Ga0207651_101223952 | 360 |
| 312 | 3300026089 | Ga0207648_10033728 | Ga0207648_100337282 | 360 |
| 313 | 3300026095 | Ga0207676_10188715 | Ga0207676_101887152 | 360 |
| 314 | 3300026116 | Ga0207674_10139974 | Ga0207674_101399743 | 360 |
| 315 | 3300035084 | Ga0373928_0020336 | Ga0373928_0020336_123_1298 | 360 |
| 316 | 3300046472 | Ga0495580_0015568 | Ga0495580_0015568_3278_4429 | 360 |
| 317 | 3300046511 | Ga0495608_0018334 | Ga0495608_0018334_1068_2240 | 360 |
| 318 | 3300046516 | Ga0495628_0026135 | Ga0495628_0026135_1370_2542 | 360 |
| 319 | 3300046664 | Ga0495659_0038979 | Ga0495659_0038979_108_1259 | 360 |
| 320 | 3300046679 | Ga0495623_0011379 | Ga0495623_0011379_763_1935 | 360 |
| 321 | 3300046680 | Ga0495646_0001063 | Ga0495646_0001063_13888_15060 | 360 |
| 322 | 3300046809 | Ga0495600_0020177 | Ga0495600_0020177_948_2120 | 360 |
| 323 | 3300049568 | Ga0501031_0014987 | Ga0501031_0014987_3207_4358 | 360 |
| 324 | 3300049569 | Ga0501032_0009263 | Ga0501032_0009263_4502_5653 | 360 |
| 325 | 3300049570 | Ga0501033_0045764 | Ga0501033_0045764_739_1890 | 360 |
| 326 | 3300049577 | Ga0501041_0023036 | Ga0501041_0023036_2231_3382 | 360 |
| 327 | 3300049579 | Ga0501043_0018580 | Ga0501043_0018580_864_2015 | 360 |
| 328 | 3300049580 | Ga0501046_0080947 | Ga0501046_0080947_1316_2467 | 360 |
| 329 | 3300049584 | Ga0501068_0095979 | Ga0501068_0095979_20_1171 | 360 |
| 330 | 3300049586 | Ga0501070_0014719 | Ga0501070_0014719_1138_2289 | 360 |
| 331 | 3300049587 | Ga0501071_0192313 | Ga0501071_0192313_154_1308 | 360 |
| 332 | 3300049588 | Ga0501072_0118147 | Ga0501072_0118147_611_1762 | 360 |
| 333 | 3300049589 | Ga0501073_0024666 | Ga0501073_0024666_3089_4240 | 360 |
| 334 | 3300049590 | Ga0501074_0012356 | Ga0501074_0012356_663_1814 | 360 |
| 335 | 3300049592 | Ga0501076_0166138 | Ga0501076_0166138_297_1448 | 360 |
| 336 | 3300049593 | Ga0501077_0030023 | Ga0501077_0030023_1230_2381 | 360 |
| 337 | 3300049741 | Ga0501079_0074034 | Ga0501079_0074034_135_1286 | 360 |
| 338 | 3300049823 | Ga0501044_0047658 | Ga0501044_0047658_1031_2182 | 360 |
| 339 | 3300050496 | nmdc:mga07m45_50697_c1 | nmdc:mga07m45_50697_c1_60_1223 | 360 |
| 340 | 3300053141 | Ga0500574_001794 | Ga0500574_001794_647_1819 | 360 |
| 341 | 3300059426 | Ga0590077_012424 | Ga0590077_012424_238_1392 | 360 |
| 342 | 3300060353 | Ga0501082_0012399 | Ga0501082_0012399_4393_5544 | 360 |
| 343 | 3300061734 | Ga0530510_0122412 | Ga0530510_0122412_209_1360 | 360 |
| 344 | iso_pu_bacteria | 2721755763 | 2723876959 | 360 |
| 345 | 3300003841 | Ga0055541_1001235 | Ga0055541_10012353 | 361 |
| 346 | 3300006051 | Ga0075364_10204542 | Ga0075364_102045421 | 361 |
| 347 | 3300025292 | Ga0209676_1003758 | Ga0209676_10037588 | 361 |
| 348 | 3300025298 | Ga0209050_1001375 | Ga0209050_10013758 | 361 |
| 349 | 3300048927 | Ga0496124_0000103 | Ga0496124_0000103_47381_48535 | 361 |
| 350 | iso_pu_bacteria | 2738541277 | 2738719628 | 361 |
| 351 | iso_pu_bacteria | 2738541307 | 2738879937 | 361 |
| 352 | iso_pu_bacteria | 2738543019 | 2739278827 | 361 |
| 353 | iso_pu_bacteria | 2818991446 | 2819599377 | 361 |
| 354 | iso_pu_bacteria | 2899924645 | 2899925883 | 361 |
| 355 | iso_pu_bacteria | 2904541872 | 2904544298 | 361 |
| 356 | iso_pu_bacteria | 2928037797 | 2928041729 | 361 |
| 357 | iso_pu_bacteria | 2928044640 | 2928049293 | 361 |
| 358 | iso_pu_bacteria | 2928051484 | 2928052099 | 361 |
| 359 | iso_pu_bacteria | 2928064002 | 2928065221 | 361 |
| 360 | iso_pu_bacteria | 2929160207 | 2929162130 | 361 |
| 361 | 3300005290 | Ga0065712_10002802 | Ga0065712_1000280210 | 362 |
| 362 | 3300005293 | Ga0065715_10012795 | Ga0065715_100127955 | 362 |
| 363 | 3300005330 | Ga0070690_100041526 | Ga0070690_1000415263 | 362 |
| 364 | 3300005330 | Ga0070690_100064191 | Ga0070690_1000641913 | 362 |
| 365 | 3300005331 | Ga0070670_100000191 | Ga0070670_10000019141 | 362 |
| 366 | 3300005336 | Ga0070680_100002615 | Ga0070680_10000261513 | 362 |
| 367 | 3300005337 | Ga0070682_100011098 | Ga0070682_1000110985 | 362 |
| 368 | 3300005344 | Ga0070661_100003806 | Ga0070661_1000038064 | 362 |
| 369 | 3300005353 | Ga0070669_100064626 | Ga0070669_1000646264 | 362 |
| 370 | 3300005354 | Ga0070675_100070187 | Ga0070675_1000701872 | 362 |
| 371 | 3300005355 | Ga0070671_100034890 | Ga0070671_1000348903 | 362 |
| 372 | 3300005356 | Ga0070674_100007062 | Ga0070674_1000070627 | 362 |
| 373 | 3300005364 | Ga0070673_100055185 | Ga0070673_1000551853 | 362 |
| 374 | 3300005440 | Ga0070705_100020941 | Ga0070705_1000209412 | 362 |
| 375 | 3300005441 | Ga0070700_100006624 | Ga0070700_1000066244 | 362 |
| 376 | 3300005444 | Ga0070694_100015923 | Ga0070694_1000159235 | 362 |
| 377 | 3300005455 | Ga0070663_100043513 | Ga0070663_1000435132 | 362 |
| 378 | 3300005456 | Ga0070678_100030389 | Ga0070678_1000303893 | 362 |
| 379 | 3300005457 | Ga0070662_100026282 | Ga0070662_1000262823 | 362 |
| 380 | 3300005458 | Ga0070681_10018223 | Ga0070681_100182236 | 362 |
| 381 | 3300005459 | Ga0068867_100022324 | Ga0068867_1000223243 | 362 |
| 382 | 3300005530 | Ga0070679_100024625 | Ga0070679_1000246256 | 362 |
| 383 | 3300005545 | Ga0070695_100005789 | Ga0070695_1000057893 | 362 |
| 384 | 3300005546 | Ga0070696_100018017 | Ga0070696_1000180174 | 362 |
| 385 | 3300005547 | Ga0070693_100044899 | Ga0070693_1000448992 | 362 |
| 386 | 3300005548 | Ga0070665_100219927 | Ga0070665_1002199272 | 362 |
| 387 | 3300005549 | Ga0070704_100034440 | Ga0070704_1000344403 | 362 |
| 388 | 3300005564 | Ga0070664_100016829 | Ga0070664_1000168293 | 362 |
| 389 | 3300005578 | Ga0068854_100016099 | Ga0068854_1000160995 | 362 |
| 390 | 3300005614 | Ga0068856_100097086 | Ga0068856_1000970862 | 362 |
| 391 | 3300006175 | Ga0070712_100044125 | Ga0070712_1000441252 | 362 |
| 392 | 3300006881 | Ga0068865_100042100 | Ga0068865_1000421002 | 362 |
| 393 | 3300009094 | Ga0111539_10102731 | Ga0111539_101027312 | 362 |
| 394 | 3300009098 | Ga0105245_10022850 | Ga0105245_100228504 | 362 |
| 395 | 3300009174 | Ga0105241_10046984 | Ga0105241_100469843 | 362 |
| 396 | 3300009174 | Ga0105241_10315112 | Ga0105241_103151122 | 362 |
| 397 | 3300009545 | Ga0105237_10178738 | Ga0105237_101787382 | 362 |
| 398 | 3300013100 | Ga0157373_10014407 | Ga0157373_100144074 | 362 |
| 399 | 3300013296 | Ga0157374_10016308 | Ga0157374_100163087 | 362 |
| 400 | 3300013297 | Ga0157378_10021758 | Ga0157378_100217586 | 362 |
| 401 | 3300013306 | Ga0163162_10159051 | Ga0163162_101590512 | 362 |
| 402 | 3300014326 | Ga0157380_10063112 | Ga0157380_100631122 | 362 |
| 403 | 3300014969 | Ga0157376_10024430 | Ga0157376_100244302 | 362 |
| 404 | 3300021361 | Ga0213872_10000453 | Ga0213872_100004535 | 362 |
| 405 | 3300025315 | Ga0207697_10009381 | Ga0207697_100093814 | 362 |
| 406 | 3300025907 | Ga0207645_10001291 | Ga0207645_1000129124 | 362 |
| 407 | 3300025912 | Ga0207707_10007506 | Ga0207707_100075065 | 362 |
| 408 | 3300025917 | Ga0207660_10013064 | Ga0207660_100130642 | 362 |
| 409 | 3300025918 | Ga0207662_10056815 | Ga0207662_100568152 | 362 |
| 410 | 3300025919 | Ga0207657_10015456 | Ga0207657_100154565 | 362 |
| 411 | 3300025920 | Ga0207649_10012065 | Ga0207649_100120653 | 362 |
| 412 | 3300025921 | Ga0207652_10016085 | Ga0207652_100160855 | 362 |
| 413 | 3300025925 | Ga0207650_10000481 | Ga0207650_1000048138 | 362 |
| 414 | 3300025931 | Ga0207644_10028163 | Ga0207644_100281634 | 362 |
| 415 | 3300025932 | Ga0207690_10014714 | Ga0207690_100147142 | 362 |
| 416 | 3300025933 | Ga0207706_10003089 | Ga0207706_100030896 | 362 |
| 417 | 3300025940 | Ga0207691_10002287 | Ga0207691_100022878 | 362 |
| 418 | 3300025945 | Ga0207679_10003108 | Ga0207679_100031086 | 362 |
| 419 | 3300025961 | Ga0207712_10048412 | Ga0207712_100484123 | 362 |
| 420 | 3300025981 | Ga0207640_10015942 | Ga0207640_100159422 | 362 |
| 421 | 3300026041 | Ga0207639_10050298 | Ga0207639_100502982 | 362 |
| 422 | 3300026067 | Ga0207678_10048694 | Ga0207678_100486943 | 362 |
| 423 | 3300026075 | Ga0207708_10020329 | Ga0207708_100203293 | 362 |
| 424 | 3300026089 | Ga0207648_10052066 | Ga0207648_100520663 | 362 |
| 425 | 3300026121 | Ga0207683_10003551 | Ga0207683_1000355118 | 362 |
| 426 | 3300039447 | Ga0436361_0837231 | Ga0436361_0837231_14935_16086 | 362 |
| 427 | 3300048905 | Ga0496102_0144584 | Ga0496102_0144584_340_1503 | 362 |
| 428 | 3300048915 | Ga0496112_0019288 | Ga0496112_0019288_1753_2916 | 362 |
| 429 | 3300049570 | Ga0501033_0004879 | Ga0501033_0004879_4879_6036 | 362 |
| 430 | 3300049579 | Ga0501043_0130414 | Ga0501043_0130414_243_1400 | 362 |
| 431 | 3300049581 | Ga0501047_0014502 | Ga0501047_0014502_4625_5782 | 362 |
| 432 | 3300049822 | Ga0501035_0005340 | Ga0501035_0005340_7836_8993 | 362 |
| 433 | 3300049823 | Ga0501044_0006513 | Ga0501044_0006513_7132_8289 | 362 |
| 434 | 3300050512 | nmdc:mga0n895_116726_c1 | nmdc:mga0n895_116726_c1_1319_2482 | 362 |
| 435 | 3300050513 | nmdc:mga0rr50_254317_c1 | nmdc:mga0rr50_254317_c1_270_1433 | 362 |
| 436 | 3300001915 | JGI24741J21665_1000196 | JGI24741J21665_10001964 | 363 |
| 437 | 3300001979 | JGI24740J21852_10003016 | JGI24740J21852_100030166 | 363 |
| 438 | 3300002705 | JGI25156J39149_1016653 | JGI25156J39149_10166531 | 363 |
| 439 | 3300003187 | JGI25151J46595_10000137 | JGI25151J46595_1000013788 | 363 |
| 440 | 3300003316 | rootH1_10017612 | rootH1_100176122 | 363 |
| 441 | 3300003752 | Ga0055539_1000081 | Ga0055539_100008176 | 363 |
| 442 | 3300003758 | Ga0055532_1000048 | Ga0055532_100004861 | 363 |
| 443 | 3300003759 | Ga0055525_1000273 | Ga0055525_100027349 | 363 |
| 444 | 3300003760 | Ga0055527_1003308 | Ga0055527_10033083 | 363 |
| 445 | 3300003761 | Ga0055535_1000035 | Ga0055535_100003561 | 363 |
| 446 | 3300003763 | Ga0055529_1000101 | Ga0055529_1000101110 | 363 |
| 447 | 3300003792 | Ga0055540_1008797 | Ga0055540_10087972 | 363 |
| 448 | 3300005344 | Ga0070661_100000370 | Ga0070661_1000003707 | 363 |
| 449 | 3300005366 | Ga0070659_100037086 | Ga0070659_1000370861 | 363 |
| 450 | 3300005367 | Ga0070667_100063802 | Ga0070667_1000638023 | 363 |
| 451 | 3300005455 | Ga0070663_100000024 | Ga0070663_10000002481 | 363 |
| 452 | 3300005467 | Ga0070706_100002692 | Ga0070706_1000026924 | 363 |
| 453 | 3300005471 | Ga0070698_100251532 | Ga0070698_1002515321 | 363 |
| 454 | 3300005548 | Ga0070665_100008996 | Ga0070665_1000089967 | 363 |
| 455 | 3300005564 | Ga0070664_100000022 | Ga0070664_10000002281 | 363 |
| 456 | 3300005577 | Ga0068857_100026215 | Ga0068857_1000262154 | 363 |
| 457 | 3300005577 | Ga0068857_100111768 | Ga0068857_1001117683 | 363 |
| 458 | 3300005578 | Ga0068854_100000336 | Ga0068854_10000033619 | 363 |
| 459 | 3300005614 | Ga0068856_100000049 | Ga0068856_10000004981 | 363 |
| 460 | 3300006038 | Ga0075365_10004760 | Ga0075365_100047604 | 363 |
| 461 | 3300006048 | Ga0075363_100016697 | Ga0075363_1000166974 | 363 |
| 462 | 3300006177 | Ga0075362_10000766 | Ga0075362_100007664 | 363 |
| 463 | 3300006178 | Ga0075367_10058564 | Ga0075367_100585642 | 363 |
| 464 | 3300006353 | Ga0075370_10002838 | Ga0075370_100028388 | 363 |
| 465 | 3300009036 | Ga0105244_10025014 | Ga0105244_100250141 | 363 |
| 466 | 3300009093 | Ga0105240_10078101 | Ga0105240_100781011 | 363 |
| 467 | 3300011119 | Ga0105246_10083087 | Ga0105246_100830872 | 363 |
| 468 | 3300013100 | Ga0157373_10003934 | Ga0157373_1000393410 | 363 |
| 469 | 3300013102 | Ga0157371_10000089 | Ga0157371_1000008979 | 363 |
| 470 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002322 | 363 |
| 471 | 3300013105 | Ga0157369_10018918 | Ga0157369_100189183 | 363 |
| 472 | 3300013307 | Ga0157372_10000149 | Ga0157372_1000014950 | 363 |
| 473 | 3300015261 | Ga0182006_1027763 | Ga0182006_10277632 | 363 |
| 474 | 3300020077 | Ga0206351_10088450 | Ga0206351_100884501 | 363 |
| 475 | 3300021361 | Ga0213872_10011834 | Ga0213872_100118342 | 363 |
| 476 | 3300022467 | Ga0224712_10054704 | Ga0224712_100547041 | 363 |
| 477 | 3300025224 | Ga0209784_100024 | Ga0209784_100024297 | 363 |
| 478 | 3300025224 | Ga0209784_100435 | Ga0209784_10043513 | 363 |
| 479 | 3300025225 | Ga0209566_100018 | Ga0209566_100018297 | 363 |
| 480 | 3300025226 | Ga0209674_100046 | Ga0209674_10004666 | 363 |
| 481 | 3300025228 | Ga0209672_100240 | Ga0209672_10024029 | 363 |
| 482 | 3300025229 | Ga0209147_100008 | Ga0209147_10000880 | 363 |
| 483 | 3300025230 | Ga0209563_100039 | Ga0209563_10003966 | 363 |
| 484 | 3300025242 | Ga0209258_100013 | Ga0209258_10001380 | 363 |
| 485 | 3300025242 | Ga0209258_100977 | Ga0209258_1009777 | 363 |
| 486 | 3300025253 | Ga0209677_100024 | Ga0209677_10002464 | 363 |
| 487 | 3300025256 | Ga0209759_1008320 | Ga0209759_10083202 | 363 |
| 488 | 3300025272 | Ga0209455_1000042 | Ga0209455_100004280 | 363 |
| 489 | 3300025294 | Ga0209025_1000071 | Ga0209025_1000071172 | 363 |
| 490 | 3300025303 | Ga0209051_1003989 | Ga0209051_10039893 | 363 |
| 491 | 3300025910 | Ga0207684_10005030 | Ga0207684_1000503012 | 363 |
| 492 | 3300025913 | Ga0207695_10004273 | Ga0207695_100042732 | 363 |
| 493 | 3300025913 | Ga0207695_10057661 | Ga0207695_100576612 | 363 |
| 494 | 3300025920 | Ga0207649_10000075 | Ga0207649_100000757 | 363 |
| 495 | 3300025932 | Ga0207690_10024118 | Ga0207690_100241184 | 363 |
| 496 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004489 | 363 |
| 497 | 3300025981 | Ga0207640_10000084 | Ga0207640_1000008459 | 363 |
| 498 | 3300026067 | Ga0207678_10000012 | Ga0207678_1000001279 | 363 |
| 499 | 3300026078 | Ga0207702_10000020 | Ga0207702_10000020132 | 363 |
| 500 | 3300026116 | Ga0207674_10006196 | Ga0207674_100061963 | 363 |
| 501 | 3300026118 | Ga0207675_100288250 | Ga0207675_1002882501 | 363 |
| 502 | 3300026142 | Ga0207698_10102209 | Ga0207698_101022092 | 363 |
| 503 | 3300027312 | Ga0209371_1020996 | Ga0209371_10209962 | 363 |
| 504 | 3300028786 | Ga0307517_10058531 | Ga0307517_100585312 | 363 |
| 505 | 3300028794 | Ga0307515_10038038 | Ga0307515_100380382 | 363 |
| 506 | 3300028794 | Ga0307515_10038364 | Ga0307515_100383644 | 363 |
| 507 | 3300030522 | Ga0307512_10011610 | Ga0307512_100116108 | 363 |
| 508 | 3300031251 | Ga0265327_10037005 | Ga0265327_100370052 | 363 |
| 509 | 3300031456 | Ga0307513_10090506 | Ga0307513_100905062 | 363 |
| 510 | 3300031507 | Ga0307509_10001216 | Ga0307509_100012166 | 363 |
| 511 | 3300031507 | Ga0307509_10011687 | Ga0307509_100116879 | 363 |
| 512 | 3300031507 | Ga0307509_10139579 | Ga0307509_101395792 | 363 |
| 513 | 3300031649 | Ga0307514_10164679 | Ga0307514_101646792 | 363 |
| 514 | 3300031730 | Ga0307516_10001684 | Ga0307516_1000168410 | 363 |
| 515 | 3300031911 | Ga0307412_10000137 | Ga0307412_1000013732 | 363 |
| 516 | 3300033179 | Ga0307507_10051280 | Ga0307507_100512803 | 363 |
| 517 | 3300033180 | Ga0307510_10159712 | Ga0307510_101597122 | 363 |
| 518 | 3300046454 | Ga0495592_0000563 | Ga0495592_0000563_7029_8207 | 363 |
| 519 | 3300046501 | Ga0495607_0000009 | Ga0495607_0000009_101461_102612 | 363 |
| 520 | 3300046512 | Ga0495610_0039051 | Ga0495610_0039051_244_1422 | 363 |
| 521 | 3300046524 | Ga0495648_0065979 | Ga0495648_0065979_825_2003 | 363 |
| 522 | 3300046526 | Ga0495666_0056612 | Ga0495666_0056612_636_1814 | 363 |
| 523 | 3300046683 | Ga0495658_0048392 | Ga0495658_0048392_633_1811 | 363 |
| 524 | 3300047472 | Ga0495686_0011776 | Ga0495686_0011776_1125_2303 | 363 |
| 525 | 3300048920 | Ga0496117_0062034 | Ga0496117_0062034_1391_2545 | 363 |
| 526 | 3300048924 | Ga0496121_0000411 | Ga0496121_0000411_49645_50799 | 363 |
| 527 | 3300048925 | Ga0496122_0001568 | Ga0496122_0001568_25886_27040 | 363 |
| 528 | 3300048928 | Ga0496125_0000096 | Ga0496125_0000096_63731_64885 | 363 |
| 529 | 3300048929 | Ga0496126_0037790 | Ga0496126_0037790_2373_3527 | 363 |
| 530 | 3300049579 | Ga0501043_0000010 | Ga0501043_0000010_156271_157431 | 363 |
| 531 | 3300049580 | Ga0501046_0000132 | Ga0501046_0000132_10414_11574 | 363 |
| 532 | 3300049581 | Ga0501047_0000026 | Ga0501047_0000026_67925_69085 | 363 |
| 533 | 3300050492 | nmdc:mga0yw44_131515_c1 | nmdc:mga0yw44_131515_c1_58_1221 | 363 |
| 534 | 3300050493 | nmdc:mga0k408_732_c1 | nmdc:mga0k408_732_c1_10766_11929 | 363 |
| 535 | 3300050494 | nmdc:mga06z11_6883_c1 | nmdc:mga06z11_6883_c1_2488_3651 | 363 |
| 536 | 3300050496 | nmdc:mga07m45_32159_c1 | nmdc:mga07m45_32159_c1_413_1576 | 363 |
| 537 | 3300050496 | nmdc:mga07m45_434_c1 | nmdc:mga07m45_434_c1_4423_5586 | 363 |
| 538 | 3300053088 | Ga0500644_0002663 | Ga0500644_0002663_2232_3410 | 363 |
| 539 | 3300053093 | Ga0500651_0015446 | Ga0500651_0015446_2901_4079 | 363 |
| 540 | 3300053118 | Ga0500594_0001534 | Ga0500594_0001534_2861_4039 | 363 |
| 541 | 3300053156 | Ga0500622_0000585 | Ga0500622_0000585_5437_6615 | 363 |
| 542 | 3300053161 | Ga0500634_0003843 | Ga0500634_0003843_4824_6050 | 363 |
| 543 | 3300059640 | Ga0587067_003515 | Ga0587067_003515_383_1543 | 363 |
| 544 | 3300059641 | Ga0587068_003846 | Ga0587068_003846_409_1569 | 363 |
| 545 | 3300059643 | Ga0587072_001638 | Ga0587072_001638_1281_2441 | 363 |
| 546 | 3300061719 | Ga0466962_0006170 | Ga0466962_0006170_133_1314 | 363 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jfn-assembly1.cif.gz_A | crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation | 0.8577 | 19 | 361 |
| 4obb-assembly2.cif.gz_B | the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. | 0.8452 | 21 | 363 |
| 4m88-assembly1.cif.gz_A | crystal structure of extracellular ligand-binding receptor from verminephrobacter eiseniae ef01-2 | 0.8403 | 21 | 360 |
| 4zpj-assembly1.cif.gz_A | abc transporter substrate-binding protein from sphaerobacter thermophilus | 0.8375 | 21 | 361 |
| 4oat-assembly1.cif.gz_A | the crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine. | 0.8318 | 21 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nqrA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9495 | 126 | 256 | 3.40.50.2300 |
| 3td9A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9149 | 126 | 251 | 3.40.50.2300 |
| 4gnrA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.911 | 126 | 253 | 3.40.50.2300 |
| 4n0qA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9061 | 126 | 251 | 3.40.50.2300 |
| 1usiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8992 | 126 | 251 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3AAT3-F1-model_v4 | deleted | 0.928 | 15 | 98 |
|
| AF-A0A2N0QHD5-F1-model_v4 | Periplasmic binding protein-like I | 0.9213 | 20 | 110 |
|
| AF-A0A1B8P3D6-F1-model_v4 | Aliphatic amidase expression-regulating protein | 0.9161 | 16 | 111 |
|
| AF-F1W248-F1-model_v4 | Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein | 0.9145 | 217 | 363 |
|
| AF-A0A2V6S585-F1-model_v4 | ABC transporter substrate-binding protein | 0.9131 | 12 | 111 |
GO:0006865
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar