F461986

General Info

Members Datasets Scaffolds Average Seq Length
546 348 512 377

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10004619|Ga0105240_1000461915
Length 428
Sequence LGWPGGNSVSAATAKAAGGFVRPREGRTSLPRDNRGFRPARPGRDPLQIIDPTGDIRMLLSRVPFAARSLVVAGAAEAISGPAGQYGQSIRNGFQLAVDEINAAGGVKGNKIALQVEDEQGKKEQAIDVFKKLIFQDKVLMLFGPTLSNSAQAADPIAQAAKVVVFGTSNTADGITSIGDYVFRNSVTEADVLPETLRVAAKHTGLKKVAVMYGNDDVFTKSGYDAFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKASGADAIVLSALIAEGAPIMVQARQLGIDLPVIGGNGMNSAKIFDLAKEKSDNLWVGSPWALGNQTKENEHFVVAYTQKYKAAPDQFSAQAYDAMNIAAQALGKIKLSGDLAADRKALRDALPSVTWTGATGAFKFRQAMDKSGKPAGHDAQQAAIVSVTKGGKYSIEK

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
14 2818991436 Collimonas arenae 515 Isolate Unclassified
15 2818991446 Variovorax sp. 1180 Isolate Unclassified
16 2855730933 Achromobacter sp. HZ28 Isolate Nodule
17 2855767633 Achromobacter sp. HZ34 Isolate Nodule
18 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
19 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
20 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
21 2858950400 Achromobacter sp. K91 Isolate Unclassified
22 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
23 2885266251 Ralstonia sp. SET104 Isolate Nodule
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
26 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2928037797 Variovorax sp. 1126 Isolate Unclassified
29 2928044640 Variovorax sp. 1128 Isolate Unclassified
30 2928051484 Variovorax sp. 1133 Isolate Unclassified
31 2928058823 Ralstonia sp. 1138 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
38 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
50 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
57 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
58 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
95 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
155 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
168 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
169 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
231 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
232 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
233 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
234 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
338 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.92
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.5
Nodule 0.55
Rhizoplane 2.38
Rhizosphere 64.1
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000196 3300001915 Bacteria 17817
2 JGI24740J21852_10002700 3300001979 Bacteria 7967
3 JGI24740J21852_10003016 3300001979 Bacteria 7454
4 JGI25156J39149_1000060 3300002705 Bacteria 84857
5 JGI25156J39149_1000175 3300002705 Bacteria 47051
6 JGI25156J39149_1001779 3300002705 Bacteria 8529
7 JGI25156J39149_1016653 3300002705 Bacteria 1422
8 JGI25162J39368_1000036 3300002737 Bacteria 180433
9 JGI25154J39366_1000129 3300002738 Bacteria 59399
10 JGI25154J39366_1002385 3300002738 Bacteria 4930
11 JGI25157J39369_1000029 3300002741 Bacteria 146928
12 JGI25164J39214_1003957 3300002772 Bacteria 1772
13 JGI25151J46595_10000137 3300003187 Bacteria 96370
14 JGI25151J46595_10030179 3300003187 Bacteria 2135
15 JGI25165J46597_1000022 3300003214 Bacteria 357959
16 rootH1_10009484 3300003316 Bacteria 3739
17 rootH1_10017612 3300003316 Bacteria 3441
18 rootH2_10006384 3300003320 Bacteria 8049
19 rootH2_10082770 3300003320 Bacteria 3290
20 rootH1_10024154 3300003323 Bacteria 5841
21 rootH1_10142259 3300003323 Bacteria 3751
22 Ga0055538_1000011 3300003751 Bacteria 357959
23 Ga0055539_1000016 3300003752 Bacteria 358248
24 Ga0055539_1000081 3300003752 Bacteria 122891
25 Ga0055539_1000118 3300003752 Bacteria 86566
26 Ga0055539_1000739 3300003752 Bacteria 8155
27 Ga0055533_1000010 3300003756 Bacteria 491196
28 Ga0055533_1000019 3300003756 Bacteria 357959
29 Ga0055533_1000421 3300003756 Bacteria 16356
30 Ga0055532_1000048 3300003758 Bacteria 175560
31 Ga0055525_1000042 3300003759 Bacteria 279804
32 Ga0055525_1000273 3300003759 Bacteria 48163
33 Ga0055525_1000415 3300003759 Bacteria 25986
34 Ga0055527_1003308 3300003760 Bacteria 2435
35 Ga0055535_1000035 3300003761 Bacteria 175560
36 Ga0055535_1000076 3300003761 Bacteria 111203
37 Ga0055535_1000282 3300003761 Bacteria 53559
38 Ga0055542_1000009 3300003762 Bacteria 416550
39 Ga0055542_1000724 3300003762 Bacteria 25809
40 Ga0055529_1000101 3300003763 Bacteria 130709
41 Ga0055529_1000491 3300003763 Bacteria 36152
42 Ga0055529_1000810 3300003763 Bacteria 18955
43 Ga0055530_10020060 3300003791 Bacteria 2008
44 Ga0055540_1008797 3300003792 Bacteria 3582
45 Ga0055541_1000017 3300003841 Bacteria 286811
46 Ga0055541_1001235 3300003841 Bacteria 5646
47 Ga0065712_10000421 3300005290 Bacteria 18901
48 Ga0065712_10002802 3300005290 Bacteria 10865
49 Ga0065715_10012795 3300005293 Bacteria 4959
50 Ga0065715_10089174 3300005293 Bacteria 13129
51 Ga0065707_10190054 3300005295 Bacteria 1350
52 Ga0070658_10016597 3300005327 Bacteria 5892
53 Ga0070658_10129050 3300005327 Bacteria 2106
54 Ga0070676_10024807 3300005328 Bacteria 3382
55 Ga0070676_10038698 3300005328 Unclassified 2755
56 Ga0070690_100041526 3300005330 Unclassified 2912
57 Ga0070690_100064191 3300005330 Bacteria 2371
58 Ga0070670_100000191 3300005331 Bacteria 56346
59 Ga0070670_100068546 3300005331 Bacteria 3045
60 Ga0070677_10018449 3300005333 Bacteria 2512
61 Ga0070666_10020261 3300005335 Bacteria 4299
62 Ga0070666_10200122 3300005335 Bacteria 1405
63 Ga0070680_100002615 3300005336 Bacteria 13332
64 Ga0070682_100011098 3300005337 Bacteria 5139
65 Ga0068868_100010559 3300005338 Bacteria 6692
66 Ga0070687_100051249 3300005343 Unclassified 2136
67 Ga0070661_100000370 3300005344 Bacteria 35389
68 Ga0070661_100003806 3300005344 Bacteria 10397
69 Ga0070669_100064626 3300005353 Unclassified 2695
70 Ga0070675_100054510 3300005354 Bacteria 3290
71 Ga0070675_100070187 3300005354 Unclassified 2903
72 Ga0070671_100005369 3300005355 Bacteria 10216
73 Ga0070671_100025924 3300005355 Bacteria 4814
74 Ga0070671_100034890 3300005355 Unclassified 4165
75 Ga0070671_100161985 3300005355 Bacteria 1891
76 Ga0070674_100007062 3300005356 Bacteria 6603
77 Ga0070673_100055185 3300005364 Bacteria 3130
78 Ga0070673_100071309 3300005364 Bacteria 2791
79 Ga0070659_100014344 3300005366 Bacteria 5921
80 Ga0070659_100037086 3300005366 Bacteria 3800
81 Ga0070667_100063802 3300005367 Bacteria 3123
82 Ga0070667_100081858 3300005367 Bacteria 2763
83 Ga0070705_100020941 3300005440 Unclassified 3471
84 Ga0070700_100006624 3300005441 Bacteria 6202
85 Ga0070694_100015923 3300005444 Bacteria 4730
86 Ga0070708_100000336 3300005445 Bacteria 35498
87 Ga0070663_100000024 3300005455 Bacteria 108544
88 Ga0070663_100043513 3300005455 Unclassified 3161
89 Ga0070678_100030127 3300005456 Bacteria 3725
90 Ga0070678_100030389 3300005456 Unclassified 3713
91 Ga0070662_100026282 3300005457 Unclassified 4030
92 Ga0070662_100059309 3300005457 Bacteria 2788
93 Ga0070681_10018223 3300005458 Bacteria 7018
94 Ga0070681_10079034 3300005458 Bacteria 3246
95 Ga0068867_100022324 3300005459 Unclassified 4524
96 Ga0070706_100002692 3300005467 Bacteria 17790
97 Ga0070698_100251532 3300005471 Bacteria 1700
98 Ga0070698_100291246 3300005471 Bacteria 1564
99 Ga0070699_100139989 3300005518 Bacteria 2136
100 Ga0070679_100024625 3300005530 Bacteria 5899
101 Ga0070679_100052774 3300005530 Bacteria 4047
102 Ga0070697_100022408 3300005536 Bacteria 5013
103 Ga0070672_100064127 3300005543 Bacteria 2902
104 Ga0070695_100005789 3300005545 Bacteria 7283
105 Ga0070696_100014843 3300005546 Bacteria 5228
106 Ga0070696_100018017 3300005546 Bacteria 4770
107 Ga0070693_100044899 3300005547 Unclassified 2502
108 Ga0070665_100008996 3300005548 Bacteria 10112
109 Ga0070665_100219927 3300005548 Bacteria 1900
110 Ga0070704_100034440 3300005549 Unclassified 3435
111 Ga0070664_100000022 3300005564 Bacteria 108544
112 Ga0070664_100016829 3300005564 Bacteria 6002
113 Ga0068857_100026215 3300005577 Bacteria 5136
114 Ga0068857_100111768 3300005577 Bacteria 2456
115 Ga0068857_100166686 3300005577 Bacteria 2001
116 Ga0068854_100000336 3300005578 Bacteria 30476
117 Ga0068854_100004203 3300005578 Bacteria 9067
118 Ga0068854_100016099 3300005578 Bacteria 4974
119 Ga0068854_100077689 3300005578 Bacteria 2443
120 Ga0068856_100000049 3300005614 Bacteria 108544
121 Ga0068856_100005146 3300005614 Bacteria 12913
122 Ga0068856_100097086 3300005614 Unclassified 2935
123 Ga0068859_100111632 3300005617 Bacteria 2797
124 Ga0068864_100009857 3300005618 Bacteria 7877
125 Ga0068870_10011924 3300005840 Bacteria 4045
126 Ga0068863_100308158 3300005841 Bacteria 1537
127 Ga0068858_100213312 3300005842 Bacteria 1827
128 Ga0068860_100123403 3300005843 Bacteria 2481
129 Ga0075365_10004760 3300006038 Bacteria 7235
130 Ga0075363_100016697 3300006048 Bacteria 3630
131 Ga0075364_10204542 3300006051 Bacteria 1339
132 Ga0070712_100044125 3300006175 Bacteria 3073
133 Ga0075362_10000766 3300006177 Bacteria 9569
134 Ga0075367_10019273 3300006178 Bacteria 3781
135 Ga0075367_10058564 3300006178 Bacteria 2292
136 Ga0075366_10024677 3300006195 Bacteria 3507
137 Ga0097621_100221734 3300006237 Bacteria 1648
138 Ga0075370_10002838 3300006353 Bacteria 8130
139 Ga0075370_10033148 3300006353 Bacteria 2891
140 Ga0068871_100333652 3300006358 Bacteria 1338
141 Ga0075430_100208405 3300006846 Bacteria 1622
142 Ga0075431_100003080 3300006847 Bacteria 16154
143 Ga0075433_10041459 3300006852 Bacteria 3989
144 Ga0075433_10082925 3300006852 Bacteria 2829
145 Ga0075434_100025998 3300006871 Bacteria 5731
146 Ga0075434_100063792 3300006871 Bacteria 3667
147 Ga0075429_100025185 3300006880 Bacteria 5165
148 Ga0068865_100042100 3300006881 Bacteria 3112
149 Ga0068865_100086607 3300006881 Bacteria 2262
150 Ga0097620_100111626 3300006931 Bacteria 2797
151 Ga0075435_100113729 3300007076 Bacteria 2253
152 Ga0099794_10003558 3300007265 Bacteria 5965
153 Ga0099794_10014932 3300007265 Bacteria 3415
154 Ga0105244_10025014 3300009036 Bacteria 3251
155 Ga0105240_10004619 3300009093 Bacteria 20879
156 Ga0105240_10078101 3300009093 Bacteria 4077
157 Ga0105240_10098010 3300009093 Bacteria 3571
158 Ga0111539_10102731 3300009094 Unclassified 3355
159 Ga0105245_10006581 3300009098 Bacteria 10200
160 Ga0105245_10022850 3300009098 Bacteria 5487
161 Ga0114129_10003918 3300009147 Bacteria 21004
162 Ga0114129_10057414 3300009147 Bacteria 5447
163 Ga0114129_10403563 3300009147 Bacteria 1801
164 Ga0105243_10354979 3300009148 Bacteria 1347
165 Ga0105241_10046984 3300009174 Unclassified 3280
166 Ga0105241_10315112 3300009174 Bacteria 1347
167 Ga0105242_10091188 3300009176 Bacteria 2565
168 Ga0105242_10134701 3300009176 Bacteria 2137
169 Ga0105237_10003650 3300009545 Bacteria 18149
170 Ga0105237_10178738 3300009545 Bacteria 2122
171 Ga0105237_10200135 3300009545 Bacteria 1997
172 Ga0105238_10038373 3300009551 Bacteria 4865
173 Ga0105238_10076445 3300009551 Bacteria 3339
174 Ga0105239_10009773 3300010375 Bacteria 10783
175 Ga0105239_10026856 3300010375 Bacteria 6336
176 Ga0105239_10122142 3300010375 Bacteria 2893
177 Ga0105239_10148129 3300010375 Bacteria 2619
178 Ga0105246_10051850 3300011119 Bacteria 2818
179 Ga0105246_10083087 3300011119 Bacteria 2287
180 Ga0157373_10003934 3300013100 Bacteria 11217
181 Ga0157373_10008463 3300013100 Bacteria 7639
182 Ga0157373_10014407 3300013100 Bacteria 5796
183 Ga0157371_10000089 3300013102 Bacteria 145483
184 Ga0157370_10000002 3300013104 Bacteria 431400
185 Ga0157369_10018918 3300013105 Bacteria 7718
186 Ga0157374_10016308 3300013296 Bacteria 6526
187 Ga0157378_10013757 3300013297 Bacteria 7077
188 Ga0157378_10021758 3300013297 Bacteria 5639
189 Ga0157378_10091596 3300013297 Bacteria 2765
190 Ga0157378_10106430 3300013297 Bacteria 2566
191 Ga0163162_10044858 3300013306 Bacteria 4429
192 Ga0163162_10059556 3300013306 Bacteria 3851
193 Ga0163162_10115914 3300013306 Bacteria 2780
194 Ga0163162_10159051 3300013306 Unclassified 2380
195 Ga0157372_10000149 3300013307 Bacteria 76796
196 Ga0157372_10145094 3300013307 Bacteria 2737
197 Ga0157380_10063112 3300014326 Unclassified 2970
198 Ga0182008_10003693 3300014497 Bacteria 9130
199 Ga0182008_10007653 3300014497 Bacteria 5953
200 Ga0157379_10048868 3300014968 Bacteria 3776
201 Ga0157376_10024430 3300014969 Bacteria 4744
202 Ga0182006_1027763 3300015261 Bacteria 2307
203 Ga0182007_10000908 3300015262 Bacteria 16394
204 Ga0182007_10036058 3300015262 Bacteria 1665
205 Ga0183362_10003 3300015683 Bacteria 977584
206 Ga0206351_10088450 3300020077 Bacteria 1682
207 Ga0213872_10000453 3300021361 Bacteria 33422
208 Ga0213872_10011834 3300021361 Bacteria 4122
209 Ga0224712_10054704 3300022467 Bacteria 1568
210 Ga0209784_100019 3300025224 Bacteria 453558
211 Ga0209784_100024 3300025224 Bacteria 394613
212 Ga0209784_100435 3300025224 Bacteria 18206
213 Ga0209784_100569 3300025224 Bacteria 12778
214 Ga0209566_100017 3300025225 Bacteria 453558
215 Ga0209566_100018 3300025225 Bacteria 448638
216 Ga0209566_100251 3300025225 Bacteria 51274
217 Ga0209674_100003 3300025226 Bacteria 2196646
218 Ga0209674_100031 3300025226 Bacteria 453558
219 Ga0209674_100046 3300025226 Bacteria 357920
220 Ga0209674_100135 3300025226 Bacteria 113826
221 Ga0209672_100240 3300025228 Bacteria 41226
222 Ga0209672_104301 3300025228 Bacteria 2674
223 Ga0209672_105991 3300025228 Bacteria 2025
224 Ga0209147_100008 3300025229 Bacteria 777096
225 Ga0209147_101067 3300025229 Bacteria 11568
226 Ga0209563_100035 3300025230 Bacteria 453558
227 Ga0209563_100039 3300025230 Bacteria 409717
228 Ga0209563_100049 3300025230 Bacteria 358472
229 Ga0207427_100158 3300025231 Bacteria 76687
230 Ga0207427_100679 3300025231 Bacteria 16155
231 Ga0209437_100038 3300025233 Bacteria 453558
232 Ga0209258_100009 3300025242 Bacteria 996276
233 Ga0209258_100013 3300025242 Bacteria 777096
234 Ga0209258_100258 3300025242 Bacteria 92469
235 Ga0209258_100977 3300025242 Bacteria 13291
236 Ga0209646_1000027 3300025246 Bacteria 395141
237 Ga0209646_1000111 3300025246 Bacteria 155786
238 Ga0209026_1000054 3300025250 Bacteria 242508
239 Ga0209026_1001871 3300025250 Bacteria 8583
240 Ga0209677_100020 3300025253 Bacteria 453558
241 Ga0209677_100024 3300025253 Bacteria 406035
242 Ga0209677_100050 3300025253 Bacteria 176828
243 Ga0209677_100105 3300025253 Bacteria 89277
244 Ga0209677_107594 3300025253 Bacteria 2267
245 Ga0209148_1000007 3300025254 Bacteria 1592273
246 Ga0209148_1000019 3300025254 Bacteria 748518
247 Ga0209148_1006163 3300025254 Bacteria 2632
248 Ga0209759_1000043 3300025256 Bacteria 242513
249 Ga0209759_1000332 3300025256 Bacteria 62148
250 Ga0209759_1001539 3300025256 Bacteria 12648
251 Ga0209759_1002064 3300025256 Bacteria 9414
252 Ga0209759_1008320 3300025256 Bacteria 3244
253 Ga0209129_1014394 3300025258 Bacteria 1686
254 Ga0209233_1000049 3300025261 Bacteria 453558
255 Ga0209455_1000042 3300025272 Bacteria 419638
256 Ga0209455_1000092 3300025272 Bacteria 220516
257 Ga0209455_1000633 3300025272 Bacteria 21704
258 Ga0209676_1003758 3300025292 Bacteria 8999
259 Ga0209025_1000071 3300025294 Bacteria 287297
260 Ga0209025_1000103 3300025294 Bacteria 228054
261 Ga0209050_1001375 3300025298 Bacteria 26556
262 Ga0209051_1003989 3300025303 Bacteria 9370
263 Ga0209051_1011937 3300025303 Bacteria 4243
264 Ga0209257_1024765 3300025304 Bacteria 2068
265 Ga0209257_1043462 3300025304 Bacteria 1318
266 Ga0207697_10009381 3300025315 Unclassified 4231
267 Ga0207656_10008342 3300025321 Bacteria 3809
268 Ga0207682_10014762 3300025893 Bacteria 3043
269 Ga0207645_10001291 3300025907 Bacteria 20581
270 Ga0207645_10002413 3300025907 Bacteria 14716
271 Ga0207705_10177364 3300025909 Bacteria 1607
272 Ga0207684_10005030 3300025910 Bacteria 12325
273 Ga0207654_10085115 3300025911 Bacteria 1913
274 Ga0207707_10007506 3300025912 Bacteria 9502
275 Ga0207707_10012673 3300025912 Bacteria 7327
276 Ga0207707_10114551 3300025912 Bacteria 2356
277 Ga0207707_10297557 3300025912 Bacteria 1396
278 Ga0207695_10004273 3300025913 Bacteria 19616
279 Ga0207695_10057661 3300025913 Bacteria 4034
280 Ga0207695_10094630 3300025913 Bacteria 2994
281 Ga0207660_10013064 3300025917 Bacteria 5437
282 Ga0207662_10056815 3300025918 Bacteria 2338
283 Ga0207657_10015456 3300025919 Bacteria 7394
284 Ga0207657_10027582 3300025919 Bacteria 5200
285 Ga0207649_10000075 3300025920 Bacteria 83915
286 Ga0207649_10012065 3300025920 Bacteria 4781
287 Ga0207652_10016085 3300025921 Bacteria 6101
288 Ga0207694_10034447 3300025924 Bacteria 3882
289 Ga0207694_10188288 3300025924 Bacteria 1676
290 Ga0207694_10195598 3300025924 Bacteria 1644
291 Ga0207694_10202774 3300025924 Bacteria 1614
292 Ga0207650_10000481 3300025925 Bacteria 33253
293 Ga0207650_10055843 3300025925 Bacteria 2933
294 Ga0207650_10090967 3300025925 Bacteria 2331
295 Ga0207659_10065912 3300025926 Bacteria 2626
296 Ga0207687_10005774 3300025927 Bacteria 8190
297 Ga0207644_10028163 3300025931 Unclassified 3886
298 Ga0207644_10039695 3300025931 Bacteria 3324
299 Ga0207690_10014714 3300025932 Bacteria 4731
300 Ga0207690_10024118 3300025932 Bacteria 3806
301 Ga0207706_10003089 3300025933 Bacteria 16000
302 Ga0207706_10238285 3300025933 Bacteria 1591
303 Ga0207704_10067847 3300025938 Bacteria 2246
304 Ga0207691_10002287 3300025940 Bacteria 18750
305 Ga0207691_10107041 3300025940 Bacteria 2490
306 Ga0207711_10265421 3300025941 Bacteria 1579
307 Ga0207689_10041479 3300025942 Bacteria 3808
308 Ga0207689_10062154 3300025942 Bacteria 3071
309 Ga0207661_10194671 3300025944 Bacteria 1779
310 Ga0207679_10000004 3300025945 Bacteria 589021
311 Ga0207679_10003108 3300025945 Bacteria 10278
312 Ga0207679_10130171 3300025945 Bacteria 2017
313 Ga0207667_10009547 3300025949 Bacteria 11417
314 Ga0207651_10042178 3300025960 Bacteria 3035
315 Ga0207651_10122395 3300025960 Bacteria 1975
316 Ga0207712_10048412 3300025961 Unclassified 2957
317 Ga0207640_10000084 3300025981 Bacteria 74504
318 Ga0207640_10000813 3300025981 Bacteria 17745
319 Ga0207640_10015942 3300025981 Bacteria 4361
320 Ga0207658_10285067 3300025986 Bacteria 1417
321 Ga0207703_10294716 3300026035 Bacteria 1477
322 Ga0207639_10050298 3300026041 Unclassified 3165
323 Ga0207678_10000012 3300026067 Bacteria 145324
324 Ga0207678_10048694 3300026067 Unclassified 3663
325 Ga0207708_10020329 3300026075 Bacteria 5008
326 Ga0207702_10000020 3300026078 Bacteria 203299
327 Ga0207702_10000376 3300026078 Bacteria 50989
328 Ga0207641_10083691 3300026088 Bacteria 2775
329 Ga0207648_10033728 3300026089 Bacteria 4515
330 Ga0207648_10052066 3300026089 Unclassified 3579
331 Ga0207676_10034239 3300026095 Bacteria 3845
332 Ga0207676_10188715 3300026095 Bacteria 1812
333 Ga0207674_10006196 3300026116 Bacteria 14099
334 Ga0207674_10139974 3300026116 Bacteria 2380
335 Ga0207675_100040471 3300026118 Bacteria 4352
336 Ga0207675_100288250 3300026118 Bacteria 1597
337 Ga0207683_10003551 3300026121 Bacteria 13603
338 Ga0207683_10206555 3300026121 Bacteria 1786
339 Ga0207698_10102209 3300026142 Bacteria 2379
340 Ga0209371_1020996 3300027312 Bacteria 1593
341 Ga0209588_1002366 3300027671 Bacteria 5111
342 Ga0209588_1010407 3300027671 Bacteria 2796
343 Ga0209588_1028256 3300027671 Bacteria 1785
344 Ga0209971_1005267 3300027682 Bacteria 3075
345 Ga0209974_10012579 3300027876 Bacteria 2828
346 Ga0268265_10400740 3300028380 Bacteria 1268
347 Ga0268264_10079495 3300028381 Bacteria 2798
348 Ga0265336_10000006 3300028666 Bacteria 348453
349 Ga0307517_10058531 3300028786 Bacteria 3710
350 Ga0307515_10002038 3300028794 Bacteria 44609
351 Ga0307515_10038038 3300028794 Bacteria 7713
352 Ga0307515_10038364 3300028794 Bacteria 7666
353 Ga0307515_10054315 3300028794 Bacteria 5884
354 Ga0265324_10000948 3300029957 Bacteria 18150
355 Ga0307512_10011610 3300030522 Bacteria 8338
356 Ga0307512_10070739 3300030522 Bacteria 2596
357 Ga0307512_10118226 3300030522 Bacteria 1715
358 Ga0265327_10037005 3300031251 Bacteria 2677
359 Ga0307513_10011503 3300031456 Bacteria 10994
360 Ga0307513_10090506 3300031456 Bacteria 3120
361 Ga0307509_10001216 3300031507 Bacteria 43713
362 Ga0307509_10011687 3300031507 Bacteria 10603
363 Ga0307509_10139579 3300031507 Bacteria 2362
364 Ga0307509_10179594 3300031507 Bacteria 1984
365 Ga0307408_100038541 3300031548 Unclassified 3373
366 Ga0307408_100059739 3300031548 Bacteria 2776
367 Ga0307514_10164679 3300031649 Bacteria 1461
368 Ga0265342_10000556 3300031712 Bacteria 39445
369 Ga0307516_10001684 3300031730 Bacteria 30439
370 Ga0307516_10015404 3300031730 Bacteria 8047
371 Ga0307405_10008752 3300031731 Bacteria 5149
372 Ga0307412_10000137 3300031911 Bacteria 53231
373 Ga0307412_10132441 3300031911 Bacteria 1813
374 Ga0307414_10012293 3300032004 Bacteria 5056
375 Ga0307411_10019342 3300032005 Bacteria 3932
376 Ga0307415_100110802 3300032126 Unclassified 2036
377 Ga0307507_10051280 3300033179 Bacteria 3973
378 Ga0307510_10159712 3300033180 Bacteria 1853
379 Ga0373928_0020336 3300035084 Bacteria 1391
380 Ga0373934_0066414 3300035086 Bacteria 1440
381 Ga0373956_0042395 3300035119 Bacteria 2023
382 Ga0373931_0004078 3300035691 Bacteria 6625
383 Ga0395899_0234069 3300037312 Bacteria 1267
384 Ga0395898_0108732 3300037466 Bacteria 2658
385 Ga0395905_0016422 3300037471 Bacteria 7035
386 Ga0395905_0052879 3300037471 Bacteria 3802
387 Ga0395901_0034836 3300038443 Bacteria 5200
388 Ga0436361_0837231 3300039447 Bacteria 44100
389 Ga0451795_1108175 3300041456 Bacteria 1852
390 Ga0451802_0838037 3300041460 Bacteria 2362
391 Ga0451841_0285088 3300041498 Bacteria 1828
392 Ga0451577_0413014 3300042876 Bacteria 1225
393 Ga0495592_0000563 3300046454 Bacteria 26400
394 Ga0495651_0001276 3300046462 Bacteria 19507
395 Ga0495580_0015568 3300046472 Bacteria 5732
396 Ga0495639_0004301 3300046475 Bacteria 6107
397 Ga0495607_0000009 3300046501 Bacteria 216674
398 Ga0495608_0018334 3300046511 Bacteria 4830
399 Ga0495610_0039051 3300046512 Bacteria 2404
400 Ga0495620_0017477 3300046515 Bacteria 3574
401 Ga0495628_0001650 3300046516 Bacteria 20411
402 Ga0495628_0026135 3300046516 Bacteria 4766
403 Ga0495632_0049653 3300046519 Bacteria 2073
404 Ga0495648_0065979 3300046524 Bacteria 2124
405 Ga0495666_0056612 3300046526 Bacteria 1878
406 Ga0495642_0015016 3300046528 Bacteria 3006
407 Ga0495642_0106169 3300046528 Bacteria 1198
408 Ga0495652_0003089 3300046529 Bacteria 16662
409 Ga0495625_0000602 3300046660 Bacteria 52321
410 Ga0495659_0038979 3300046664 Bacteria 1689
411 Ga0495661_0029227 3300046665 Bacteria 3521
412 Ga0495623_0001311 3300046679 Bacteria 16923
413 Ga0495623_0011379 3300046679 Bacteria 5757
414 Ga0495646_0001063 3300046680 Bacteria 15918
415 Ga0495658_0048392 3300046683 Bacteria 2397
416 Ga0495600_0020177 3300046809 Bacteria 4262
417 Ga0495687_013016 3300047443 Bacteria 4363
418 Ga0495686_0011776 3300047472 Bacteria 6154
419 Ga0495602_0017442 3300048088 Bacteria 7199
420 Ga0496100_0083360 3300048903 Bacteria 2164
421 Ga0496101_0056881 3300048904 Bacteria 2827
422 Ga0496102_0144584 3300048905 Unclassified 2231
423 Ga0496103_0112413 3300048906 Bacteria 1731
424 Ga0496108_0079585 3300048911 Bacteria 2775
425 Ga0496109_0242694 3300048912 Bacteria 1696
426 Ga0496111_0042150 3300048914 Bacteria 3277
427 Ga0496112_0019288 3300048915 Bacteria 6434
428 Ga0496112_0031926 3300048915 Bacteria 5111
429 Ga0496116_0039211 3300048919 Bacteria 3277
430 Ga0496117_0012798 3300048920 Bacteria 7359
431 Ga0496117_0062034 3300048920 Bacteria 2565
432 Ga0496121_0000411 3300048924 Bacteria 85089
433 Ga0496121_0130845 3300048924 Bacteria 1878
434 Ga0496122_0001568 3300048925 Bacteria 36083
435 Ga0496122_0111268 3300048925 Bacteria 1796
436 Ga0496123_0080219 3300048926 Bacteria 1990
437 Ga0496123_0082706 3300048926 Bacteria 1945
438 Ga0496124_0000103 3300048927 Bacteria 179162
439 Ga0496124_0067965 3300048927 Bacteria 2963
440 Ga0496125_0000096 3300048928 Bacteria 205618
441 Ga0496125_0007183 3300048928 Bacteria 11877
442 Ga0496126_0037790 3300048929 Bacteria 4499
443 Ga0501031_0014987 3300049568 Bacteria 5035
444 Ga0501032_0009263 3300049569 Bacteria 7138
445 Ga0501033_0004879 3300049570 Bacteria 10682
446 Ga0501033_0045764 3300049570 Bacteria 3255
447 Ga0501041_0023036 3300049577 Bacteria 3732
448 Ga0501043_0000010 3300049579 Bacteria 206374
449 Ga0501043_0018580 3300049579 Bacteria 5454
450 Ga0501043_0130414 3300049579 Bacteria 1970
451 Ga0501046_0000132 3300049580 Bacteria 79506
452 Ga0501046_0080947 3300049580 Bacteria 2508
453 Ga0501047_0000026 3300049581 Bacteria 225296
454 Ga0501047_0014502 3300049581 Bacteria 7495
455 Ga0501048_0002295 3300049582 Bacteria 14590
456 Ga0501068_0095979 3300049584 Bacteria 1833
457 Ga0501070_0014719 3300049586 Bacteria 6582
458 Ga0501070_0051865 3300049586 Bacteria 3404
459 Ga0501071_0192313 3300049587 Bacteria 1531
460 Ga0501072_0118147 3300049588 Bacteria 2112
461 Ga0501073_0024666 3300049589 Bacteria 4318
462 Ga0501074_0012356 3300049590 Bacteria 6206
463 Ga0501076_0166138 3300049592 Bacteria 1798
464 Ga0501077_0030023 3300049593 Bacteria 3457
465 Ga0501079_0074034 3300049741 Bacteria 2632
466 Ga0501079_0122229 3300049741 Bacteria 2025
467 Ga0501035_0005340 3300049822 Bacteria 12155
468 Ga0501035_0009597 3300049822 Bacteria 9000
469 Ga0501044_0000045 3300049823 Bacteria 148353
470 Ga0501044_0006513 3300049823 Bacteria 12897
471 Ga0501044_0047658 3300049823 Bacteria 4432
472 nmdc:mga0yw44_131515_c1 3300050492 Bacteria 1620
473 nmdc:mga0k408_118405_c1 3300050493 Bacteria 1568
474 nmdc:mga0k408_27666_c1 3300050493 Bacteria 3221
475 nmdc:mga0k408_732_c1 3300050493 Bacteria 18001
476 nmdc:mga06z11_6883_c1 3300050494 Bacteria 4651
477 nmdc:mga07m45_32159_c1 3300050496 Bacteria 2910
478 nmdc:mga07m45_434_c1 3300050496 Bacteria 17366
479 nmdc:mga07m45_50697_c1 3300050496 Bacteria 2340
480 nmdc:mga05p37_202878_c1 3300050507 Bacteria 2400
481 nmdc:mga09592_107867_c1 3300050508 Bacteria 2388
482 nmdc:mga0qj67_189184_c1 3300050509 Bacteria 1673
483 nmdc:mga06r32_100409_c1 3300050510 Bacteria 2839
484 nmdc:mga06r32_36209_c1 3300050510 Bacteria 4661
485 nmdc:mga08y16_86176_c1 3300050511 Bacteria 3273
486 nmdc:mga0n895_116726_c1 3300050512 Unclassified 2688
487 nmdc:mga0n895_15430_c1 3300050512 Bacteria 6966
488 nmdc:mga0n895_16785_c1 3300050512 Bacteria 6727
489 nmdc:mga0n895_686744_c1 3300050512 Unclassified 1020
490 nmdc:mga0n895_8459_c1 3300050512 Bacteria 8910
491 nmdc:mga0rr50_254317_c1 3300050513 Bacteria 1460
492 nmdc:mga0rr50_34582_c1 3300050513 Bacteria 3620
493 nmdc:mga0rr50_9819_c1 3300050513 Bacteria 6043
494 nmdc:mga08x19_71890_c1 3300050514 Bacteria 2256
495 nmdc:mga0a205_158611_c1 3300050515 Bacteria 2160
496 nmdc:mga0a205_169288_c1 3300050515 Bacteria 2080
497 nmdc:mga0a205_31569_c1 3300050515 Bacteria 5075
498 Ga0500635_0000007 3300053080 Bacteria 169379
499 Ga0500644_0002663 3300053088 Bacteria 4459
500 Ga0500651_0015446 3300053093 Bacteria 4685
501 Ga0500594_0001534 3300053118 Bacteria 5029
502 Ga0500574_001794 3300053141 Bacteria 3328
503 Ga0500622_0000585 3300053156 Bacteria 33068
504 Ga0500634_0003843 3300053161 Bacteria 6800
505 Ga0501084_0071460 3300054114 Bacteria 2906
506 Ga0590077_012424 3300059426 Bacteria 1765
507 Ga0587067_003515 3300059640 Bacteria 1966
508 Ga0587068_003846 3300059641 Bacteria 1950
509 Ga0587072_001638 3300059643 Bacteria 2833
510 Ga0501082_0012399 3300060353 Bacteria 7325
511 Ga0466962_0006170 3300061719 Bacteria 5758
512 Ga0530510_0122412 3300061734 Bacteria 1910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005343 Ga0070687_100051249 Ga0070687_1000512492 289
2 3300050512 nmdc:mga0n895_686744_c1 nmdc:mga0n895_686744_c1_16_948 293
3 3300005458 Ga0070681_10079034 Ga0070681_100790343 328
4 3300009147 Ga0114129_10003918 Ga0114129_1000391815 329
5 3300025912 Ga0207707_10114551 Ga0207707_101145512 330
6 3300027671 Ga0209588_1002366 Ga0209588_10023663 332
7 3300007265 Ga0099794_10003558 Ga0099794_100035582 336
8 3300026121 Ga0207683_10206555 Ga0207683_102065552 336
9 3300003320 rootH2_10006384 rootH2_100063846 337
10 3300037466 Ga0395898_0108732 Ga0395898_0108732_922_2085 337
11 3300038443 Ga0395901_0034836 Ga0395901_0034836_3489_4652 337
12 3300041498 Ga0451841_0285088 Ga0451841_0285088_209_1297 338
13 3300002772 JGI25164J39214_1003957 JGI25164J39214_10039571 340
14 3300009147 Ga0114129_10403563 Ga0114129_104035631 340
15 3300013297 Ga0157378_10091596 Ga0157378_100915963 340
16 3300025231 Ga0207427_100158 Ga0207427_10015829 340
17 3300026118 Ga0207675_100040471 Ga0207675_1000404713 340
18 3300028380 Ga0268265_10400740 Ga0268265_104007401 340
19 3300003752 Ga0055539_1000118 Ga0055539_10001188 341
20 3300003756 Ga0055533_1000010 Ga0055533_1000010368 341
21 3300003759 Ga0055525_1000415 Ga0055525_10004156 341
22 3300025226 Ga0209674_100003 Ga0209674_1000031702 341
23 3300025230 Ga0209563_100049 Ga0209563_100049164 341
24 3300025253 Ga0209677_100050 Ga0209677_100050121 341
25 3300025941 Ga0207711_10265421 Ga0207711_102654211 341
26 3300002705 JGI25156J39149_1000060 JGI25156J39149_100006068 342
27 3300002705 JGI25156J39149_1000175 JGI25156J39149_100017531 342
28 3300002738 JGI25154J39366_1002385 JGI25154J39366_10023855 342
29 3300002741 JGI25157J39369_1000029 JGI25157J39369_1000029100 342
30 3300003752 Ga0055539_1000739 Ga0055539_10007397 342
31 3300005578 Ga0068854_100004203 Ga0068854_1000042035 342
32 3300005614 Ga0068856_100005146 Ga0068856_1000051467 342
33 3300009551 Ga0105238_10038373 Ga0105238_100383733 342
34 3300010375 Ga0105239_10009773 Ga0105239_100097738 342
35 3300025246 Ga0209646_1000111 Ga0209646_1000111140 342
36 3300025250 Ga0209026_1000054 Ga0209026_100005487 342
37 3300025253 Ga0209677_100105 Ga0209677_1001059 342
38 3300025256 Ga0209759_1000043 Ga0209759_1000043140 342
39 3300025911 Ga0207654_10085115 Ga0207654_100851152 342
40 3300025924 Ga0207694_10034447 Ga0207694_100344473 342
41 3300025944 Ga0207661_10194671 Ga0207661_101946712 342
42 3300025981 Ga0207640_10000813 Ga0207640_1000081311 342
43 3300026078 Ga0207702_10000376 Ga0207702_100003765 342
44 3300037312 Ga0395899_0234069 Ga0395899_0234069_83_1246 342
45 3300007265 Ga0099794_10014932 Ga0099794_100149322 343
46 3300025949 Ga0207667_10009547 Ga0207667_100095472 343
47 3300027671 Ga0209588_1010407 Ga0209588_10104073 343
48 3300027671 Ga0209588_1028256 Ga0209588_10282562 343
49 3300035086 Ga0373934_0066414 Ga0373934_0066414_57_1220 343
50 3300003761 Ga0055535_1000282 Ga0055535_100028241 344
51 3300003763 Ga0055529_1000491 Ga0055529_100049127 344
52 3300025228 Ga0209672_105991 Ga0209672_1059911 344
53 3300025242 Ga0209258_100258 Ga0209258_10025810 344
54 3300025254 Ga0209148_1006163 Ga0209148_10061632 344
55 3300025256 Ga0209759_1001539 Ga0209759_100153910 344
56 3300025272 Ga0209455_1000092 Ga0209455_1000092194 344
57 3300025303 Ga0209051_1011937 Ga0209051_10119372 344
58 3300030522 Ga0307512_10118226 Ga0307512_101182261 344
59 3300005445 Ga0070708_100000336 Ga0070708_10000033616 345
60 3300005518 Ga0070699_100139989 Ga0070699_1001399892 345
61 3300005536 Ga0070697_100022408 Ga0070697_1000224083 345
62 3300028666 Ga0265336_10000006 Ga0265336_10000006162 345
63 3300029957 Ga0265324_10000948 Ga0265324_100009482 345
64 3300031507 Ga0307509_10179594 Ga0307509_101795941 345
65 3300049586 Ga0501070_0051865 Ga0501070_0051865_1475_2686 345
66 3300049582 Ga0501048_0002295 Ga0501048_0002295_20_1129 346
67 3300006852 Ga0075433_10082925 Ga0075433_100829251 347
68 3300046475 Ga0495639_0004301 Ga0495639_0004301_4100_5251 347
69 3300050512 nmdc:mga0n895_16785_c1 nmdc:mga0n895_16785_c1_1635_2786 347
70 3300050515 nmdc:mga0a205_31569_c1 nmdc:mga0a205_31569_c1_3682_4833 347
71 3300005335 Ga0070666_10020261 Ga0070666_100202613 348
72 3300005367 Ga0070667_100081858 Ga0070667_1000818581 348
73 3300005841 Ga0068863_100308158 Ga0068863_1003081581 348
74 3300009148 Ga0105243_10354979 Ga0105243_103549791 348
75 3300009176 Ga0105242_10091188 Ga0105242_100911882 348
76 3300013306 Ga0163162_10044858 Ga0163162_100448583 348
77 3300014497 Ga0182008_10003693 Ga0182008_100036937 348
78 3300015262 Ga0182007_10000908 Ga0182007_1000090815 348
79 3300025942 Ga0207689_10041479 Ga0207689_100414792 348
80 3300025960 Ga0207651_10042178 Ga0207651_100421782 348
81 3300025986 Ga0207658_10285067 Ga0207658_102850671 348
82 3300046528 Ga0495642_0106169 Ga0495642_0106169_14_1165 348
83 3300025924 Ga0207694_10195598 Ga0207694_101955982 349
84 3300046462 Ga0495651_0001276 Ga0495651_0001276_11207_12364 349
85 3300046516 Ga0495628_0001650 Ga0495628_0001650_17466_18623 349
86 3300046529 Ga0495652_0003089 Ga0495652_0003089_14927_16084 349
87 3300046679 Ga0495623_0001311 Ga0495623_0001311_15091_16248 349
88 3300048088 Ga0495602_0017442 Ga0495602_0017442_1321_2478 349
89 3300048912 Ga0496109_0242694 Ga0496109_0242694_206_1375 349
90 3300015683 Ga0183362_10003 Ga0183362_10003371 350
91 3300025924 Ga0207694_10188288 Ga0207694_101882882 350
92 iso_pu_bacteria 2857576091 2857578059 350
93 3300006847 Ga0075431_100003080 Ga0075431_1000030802 351
94 3300050510 nmdc:mga06r32_100409_c1 nmdc:mga06r32_100409_c1_1664_2782 351
95 3300009545 Ga0105237_10200135 Ga0105237_102001352 352
96 3300005327 Ga0070658_10016597 Ga0070658_100165973 353
97 3300048903 Ga0496100_0083360 Ga0496100_0083360_872_2023 353
98 3300048911 Ga0496108_0079585 Ga0496108_0079585_1160_2311 353
99 3300048928 Ga0496125_0007183 Ga0496125_0007183_1209_2360 353
100 3300005327 Ga0070658_10129050 Ga0070658_101290502 354
101 3300013306 Ga0163162_10115914 Ga0163162_101159142 354
102 3300003187 JGI25151J46595_10030179 JGI25151J46595_100301792 355
103 3300003316 rootH1_10009484 rootH1_100094844 355
104 3300003320 rootH2_10082770 rootH2_100827702 355
105 3300003323 rootH1_10024154 rootH1_100241544 355
106 3300003761 Ga0055535_1000076 Ga0055535_10000768 355
107 3300003762 Ga0055542_1000009 Ga0055542_1000009204 355
108 3300005578 Ga0068854_100077689 Ga0068854_1000776893 355
109 3300006195 Ga0075366_10024677 Ga0075366_100246772 355
110 3300009093 Ga0105240_10004619 Ga0105240_1000461915 355
111 3300009093 Ga0105240_10098010 Ga0105240_100980102 355
112 3300009545 Ga0105237_10003650 Ga0105237_1000365016 355
113 3300009551 Ga0105238_10076445 Ga0105238_100764452 355
114 3300010375 Ga0105239_10026856 Ga0105239_100268562 355
115 3300010375 Ga0105239_10122142 Ga0105239_101221423 355
116 3300010375 Ga0105239_10148129 Ga0105239_101481293 355
117 3300013100 Ga0157373_10008463 Ga0157373_100084635 355
118 3300013307 Ga0157372_10145094 Ga0157372_101450942 355
119 3300025229 Ga0209147_101067 Ga0209147_1010672 355
120 3300025242 Ga0209258_100009 Ga0209258_100009448 355
121 3300025254 Ga0209148_1000007 Ga0209148_1000007448 355
122 3300025256 Ga0209759_1000332 Ga0209759_10003326 355
123 3300025258 Ga0209129_1014394 Ga0209129_10143942 355
124 3300025294 Ga0209025_1000103 Ga0209025_100010361 355
125 3300025304 Ga0209257_1024765 Ga0209257_10247653 355
126 3300025321 Ga0207656_10008342 Ga0207656_100083424 355
127 3300025913 Ga0207695_10094630 Ga0207695_100946303 355
128 3300025924 Ga0207694_10202774 Ga0207694_102027742 355
129 3300031456 Ga0307513_10011503 Ga0307513_100115033 355
130 3300048906 Ga0496103_0112413 Ga0496103_0112413_14_1141 355
131 3300048926 Ga0496123_0082706 Ga0496123_0082706_51_1205 355
132 3300048927 Ga0496124_0067965 Ga0496124_0067965_448_1602 355
133 3300050493 nmdc:mga0k408_27666_c1 nmdc:mga0k408_27666_c1_1759_2922 355
134 3300050512 nmdc:mga0n895_8459_c1 nmdc:mga0n895_8459_c1_2769_3899 355
135 3300050513 nmdc:mga0rr50_9819_c1 nmdc:mga0rr50_9819_c1_2592_3722 355
136 3300050515 nmdc:mga0a205_158611_c1 nmdc:mga0a205_158611_c1_391_1521 355
137 3300001979 JGI24740J21852_10002700 JGI24740J21852_100027004 356
138 3300002705 JGI25156J39149_1001779 JGI25156J39149_10017796 356
139 3300002738 JGI25154J39366_1000129 JGI25154J39366_100012929 356
140 3300003323 rootH1_10142259 rootH1_101422592 356
141 3300003756 Ga0055533_1000421 Ga0055533_10004218 356
142 3300003762 Ga0055542_1000724 Ga0055542_100072420 356
143 3300005338 Ga0068868_100010559 Ga0068868_1000105594 356
144 3300005355 Ga0070671_100005369 Ga0070671_1000053694 356
145 3300005456 Ga0070678_100030127 Ga0070678_1000301273 356
146 3300005618 Ga0068864_100009857 Ga0068864_1000098577 356
147 3300005842 Ga0068858_100213312 Ga0068858_1002133121 356
148 3300005843 Ga0068860_100123403 Ga0068860_1001234032 356
149 3300006237 Ga0097621_100221734 Ga0097621_1002217342 356
150 3300009098 Ga0105245_10006581 Ga0105245_100065814 356
151 3300013306 Ga0163162_10059556 Ga0163162_100595562 356
152 3300014968 Ga0157379_10048868 Ga0157379_100488682 356
153 3300025224 Ga0209784_100569 Ga0209784_1005695 356
154 3300025225 Ga0209566_100251 Ga0209566_10025145 356
155 3300025226 Ga0209674_100135 Ga0209674_10013559 356
156 3300025246 Ga0209646_1000027 Ga0209646_1000027273 356
157 3300025250 Ga0209026_1001871 Ga0209026_10018712 356
158 3300025253 Ga0209677_107594 Ga0209677_1075942 356
159 3300025254 Ga0209148_1000019 Ga0209148_1000019367 356
160 3300025256 Ga0209759_1002064 Ga0209759_10020644 356
161 3300025909 Ga0207705_10177364 Ga0207705_101773641 356
162 3300025927 Ga0207687_10005774 Ga0207687_100057742 356
163 3300026035 Ga0207703_10294716 Ga0207703_102947162 356
164 3300026088 Ga0207641_10083691 Ga0207641_100836913 356
165 3300026095 Ga0207676_10034239 Ga0207676_100342393 356
166 3300028381 Ga0268264_10079495 Ga0268264_100794952 356
167 iso_pu_bacteria 2904479285 2904481508 356
168 3300005290 Ga0065712_10000421 Ga0065712_100004216 357
169 3300005293 Ga0065715_10089174 Ga0065715_100891746 357
170 3300005295 Ga0065707_10190054 Ga0065707_101900541 357
171 3300005328 Ga0070676_10038698 Ga0070676_100386983 357
172 3300005355 Ga0070671_100161985 Ga0070671_1001619852 357
173 3300005366 Ga0070659_100014344 Ga0070659_1000143444 357
174 3300005457 Ga0070662_100059309 Ga0070662_1000593095 357
175 3300005577 Ga0068857_100166686 Ga0068857_1001666862 357
176 3300006852 Ga0075433_10041459 Ga0075433_100414596 357
177 3300006871 Ga0075434_100025998 Ga0075434_1000259982 357
178 3300006871 Ga0075434_100063792 Ga0075434_1000637923 357
179 3300007076 Ga0075435_100113729 Ga0075435_1001137292 357
180 3300009147 Ga0114129_10057414 Ga0114129_100574141 357
181 3300014497 Ga0182008_10007653 Ga0182008_100076534 357
182 3300025919 Ga0207657_10027582 Ga0207657_100275822 357
183 3300025925 Ga0207650_10090967 Ga0207650_100909673 357
184 3300025933 Ga0207706_10238285 Ga0207706_102382852 357
185 3300025945 Ga0207679_10130171 Ga0207679_101301712 357
186 3300035691 Ga0373931_0004078 Ga0373931_0004078_3260_4402 357
187 3300042876 Ga0451577_0413014 Ga0451577_0413014_47_1189 357
188 3300048914 Ga0496111_0042150 Ga0496111_0042150_1575_2717 357
189 3300048915 Ga0496112_0031926 Ga0496112_0031926_466_1608 357
190 3300050507 nmdc:mga05p37_202878_c1 nmdc:mga05p37_202878_c1_1083_2228 357
191 3300050511 nmdc:mga08y16_86176_c1 nmdc:mga08y16_86176_c1_2109_3251 357
192 3300050512 nmdc:mga0n895_15430_c1 nmdc:mga0n895_15430_c1_850_1992 357
193 3300050513 nmdc:mga0rr50_34582_c1 nmdc:mga0rr50_34582_c1_2078_3220 357
194 3300050514 nmdc:mga08x19_71890_c1 nmdc:mga08x19_71890_c1_902_2044 357
195 3300050515 nmdc:mga0a205_169288_c1 nmdc:mga0a205_169288_c1_319_1461 357
196 3300003763 Ga0055529_1000810 Ga0055529_100081016 358
197 3300005335 Ga0070666_10200122 Ga0070666_102001221 358
198 3300006178 Ga0075367_10019273 Ga0075367_100192733 358
199 3300013297 Ga0157378_10013757 Ga0157378_100137577 358
200 3300025228 Ga0209672_104301 Ga0209672_1043011 358
201 3300025272 Ga0209455_1000633 Ga0209455_100063315 358
202 3300028794 Ga0307515_10002038 Ga0307515_1000203825 358
203 3300028794 Ga0307515_10054315 Ga0307515_100543154 358
204 3300030522 Ga0307512_10070739 Ga0307512_100707392 358
205 3300031730 Ga0307516_10015404 Ga0307516_100154045 358
206 3300031911 Ga0307412_10132441 Ga0307412_101324413 358
207 3300032004 Ga0307414_10012293 Ga0307414_100122937 358
208 3300032005 Ga0307411_10019342 Ga0307411_100193422 358
209 3300032126 Ga0307415_100110802 Ga0307415_1001108022 358
210 3300041456 Ga0451795_1108175 Ga0451795_1108175_604_1764 358
211 3300041460 Ga0451802_0838037 Ga0451802_0838037_919_2079 358
212 3300046515 Ga0495620_0017477 Ga0495620_0017477_562_1722 358
213 3300046519 Ga0495632_0049653 Ga0495632_0049653_855_2015 358
214 3300046660 Ga0495625_0000602 Ga0495625_0000602_49351_50511 358
215 3300049822 Ga0501035_0009597 Ga0501035_0009597_7722_8873 358
216 3300049823 Ga0501044_0000045 Ga0501044_0000045_101665_102816 358
217 3300050493 nmdc:mga0k408_118405_c1 nmdc:mga0k408_118405_c1_69_1229 358
218 3300053080 Ga0500635_0000007 Ga0500635_0000007_73319_74497 358
219 iso_pu_bacteria 2585428062 2587755844 358
220 iso_pu_bacteria 2818991436 2819542599 358
221 3300003791 Ga0055530_10020060 Ga0055530_100200602 359
222 3300005471 Ga0070698_100291246 Ga0070698_1002912462 359
223 3300006846 Ga0075430_100208405 Ga0075430_1002084052 359
224 3300006880 Ga0075429_100025185 Ga0075429_1000251852 359
225 3300025304 Ga0209257_1043462 Ga0209257_10434622 359
226 3300027682 Ga0209971_1005267 Ga0209971_10052673 359
227 3300027876 Ga0209974_10012579 Ga0209974_100125792 359
228 3300031548 Ga0307408_100038541 Ga0307408_1000385413 359
229 3300031548 Ga0307408_100059739 Ga0307408_1000597391 359
230 3300031712 Ga0265342_10000556 Ga0265342_1000055613 359
231 3300031731 Ga0307405_10008752 Ga0307405_100087522 359
232 3300035119 Ga0373956_0042395 Ga0373956_0042395_171_1325 359
233 3300037471 Ga0395905_0016422 Ga0395905_0016422_3650_4789 359
234 3300037471 Ga0395905_0052879 Ga0395905_0052879_2165_3304 359
235 3300046528 Ga0495642_0015016 Ga0495642_0015016_802_1956 359
236 3300046665 Ga0495661_0029227 Ga0495661_0029227_1246_2400 359
237 3300047443 Ga0495687_013016 Ga0495687_013016_3117_4271 359
238 3300048904 Ga0496101_0056881 Ga0496101_0056881_917_2071 359
239 3300048919 Ga0496116_0039211 Ga0496116_0039211_1347_2501 359
240 3300048920 Ga0496117_0012798 Ga0496117_0012798_1468_2622 359
241 3300048924 Ga0496121_0130845 Ga0496121_0130845_479_1633 359
242 3300048925 Ga0496122_0111268 Ga0496122_0111268_488_1642 359
243 3300048926 Ga0496123_0080219 Ga0496123_0080219_689_1843 359
244 3300049741 Ga0501079_0122229 Ga0501079_0122229_257_1405 359
245 3300050508 nmdc:mga09592_107867_c1 nmdc:mga09592_107867_c1_550_1698 359
246 3300050509 nmdc:mga0qj67_189184_c1 nmdc:mga0qj67_189184_c1_87_1238 359
247 3300050510 nmdc:mga06r32_36209_c1 nmdc:mga06r32_36209_c1_546_1694 359
248 3300054114 Ga0501084_0071460 Ga0501084_0071460_1515_2663 359
249 iso_pu_bacteria 2596583598 2597027979 359
250 iso_pu_bacteria 2599185178 2599444652 359
251 iso_pu_bacteria 2599185292 2599904618 359
252 iso_pu_bacteria 2643221569 2643861165 359
253 iso_pu_bacteria 2643221594 2643983373 359
254 iso_pu_bacteria 2643221621 2644124513 359
255 iso_pu_bacteria 2643221654 2644301855 359
256 iso_pu_bacteria 2808606395 2809032709 359
257 iso_pu_bacteria 2855730933 2855735070 359
258 iso_pu_bacteria 2855767633 2855770854 359
259 iso_pu_bacteria 2857537821 2857540529 359
260 iso_pu_bacteria 2857542790 2857543447 359
261 iso_pu_bacteria 2858950400 2858951315 359
262 iso_pu_bacteria 2881412998 2881418244 359
263 iso_pu_bacteria 2885266251 2885266425 359
264 iso_pu_bacteria 2900577576 2900580034 359
265 iso_pu_bacteria 2928058823 2928059790 359
266 iso_pu_bacteria 2941479691 2941485355 359
267 3300002737 JGI25162J39368_1000036 JGI25162J39368_100003643 360
268 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022315 360
269 3300003751 Ga0055538_1000011 Ga0055538_100001142 360
270 3300003752 Ga0055539_1000016 Ga0055539_1000016315 360
271 3300003756 Ga0055533_1000019 Ga0055533_1000019315 360
272 3300003759 Ga0055525_1000042 Ga0055525_100004243 360
273 3300003841 Ga0055541_1000017 Ga0055541_1000017250 360
274 3300005328 Ga0070676_10024807 Ga0070676_100248073 360
275 3300005331 Ga0070670_100068546 Ga0070670_1000685462 360
276 3300005333 Ga0070677_10018449 Ga0070677_100184492 360
277 3300005354 Ga0070675_100054510 Ga0070675_1000545103 360
278 3300005355 Ga0070671_100025924 Ga0070671_1000259249 360
279 3300005364 Ga0070673_100071309 Ga0070673_1000713093 360
280 3300005530 Ga0070679_100052774 Ga0070679_1000527743 360
281 3300005543 Ga0070672_100064127 Ga0070672_1000641273 360
282 3300005546 Ga0070696_100014843 Ga0070696_1000148435 360
283 3300005617 Ga0068859_100111632 Ga0068859_1001116322 360
284 3300005840 Ga0068870_10011924 Ga0068870_100119242 360
285 3300006353 Ga0075370_10033148 Ga0075370_100331482 360
286 3300006358 Ga0068871_100333652 Ga0068871_1003336521 360
287 3300006881 Ga0068865_100086607 Ga0068865_1000866071 360
288 3300006931 Ga0097620_100111626 Ga0097620_1001116264 360
289 3300009176 Ga0105242_10134701 Ga0105242_101347012 360
290 3300011119 Ga0105246_10051850 Ga0105246_100518504 360
291 3300013297 Ga0157378_10106430 Ga0157378_101064303 360
292 3300015262 Ga0182007_10036058 Ga0182007_100360581 360
293 3300025224 Ga0209784_100019 Ga0209784_100019392 360
294 3300025225 Ga0209566_100017 Ga0209566_100017392 360
295 3300025226 Ga0209674_100031 Ga0209674_100031392 360
296 3300025230 Ga0209563_100035 Ga0209563_100035392 360
297 3300025231 Ga0207427_100679 Ga0207427_1006796 360
298 3300025233 Ga0209437_100038 Ga0209437_100038392 360
299 3300025253 Ga0209677_100020 Ga0209677_100020392 360
300 3300025261 Ga0209233_1000049 Ga0209233_1000049392 360
301 3300025893 Ga0207682_10014762 Ga0207682_100147623 360
302 3300025907 Ga0207645_10002413 Ga0207645_1000241314 360
303 3300025912 Ga0207707_10012673 Ga0207707_100126737 360
304 3300025912 Ga0207707_10297557 Ga0207707_102975572 360
305 3300025925 Ga0207650_10055843 Ga0207650_100558431 360
306 3300025926 Ga0207659_10065912 Ga0207659_100659122 360
307 3300025931 Ga0207644_10039695 Ga0207644_100396952 360
308 3300025938 Ga0207704_10067847 Ga0207704_100678472 360
309 3300025940 Ga0207691_10107041 Ga0207691_101070412 360
310 3300025942 Ga0207689_10062154 Ga0207689_100621543 360
311 3300025960 Ga0207651_10122395 Ga0207651_101223952 360
312 3300026089 Ga0207648_10033728 Ga0207648_100337282 360
313 3300026095 Ga0207676_10188715 Ga0207676_101887152 360
314 3300026116 Ga0207674_10139974 Ga0207674_101399743 360
315 3300035084 Ga0373928_0020336 Ga0373928_0020336_123_1298 360
316 3300046472 Ga0495580_0015568 Ga0495580_0015568_3278_4429 360
317 3300046511 Ga0495608_0018334 Ga0495608_0018334_1068_2240 360
318 3300046516 Ga0495628_0026135 Ga0495628_0026135_1370_2542 360
319 3300046664 Ga0495659_0038979 Ga0495659_0038979_108_1259 360
320 3300046679 Ga0495623_0011379 Ga0495623_0011379_763_1935 360
321 3300046680 Ga0495646_0001063 Ga0495646_0001063_13888_15060 360
322 3300046809 Ga0495600_0020177 Ga0495600_0020177_948_2120 360
323 3300049568 Ga0501031_0014987 Ga0501031_0014987_3207_4358 360
324 3300049569 Ga0501032_0009263 Ga0501032_0009263_4502_5653 360
325 3300049570 Ga0501033_0045764 Ga0501033_0045764_739_1890 360
326 3300049577 Ga0501041_0023036 Ga0501041_0023036_2231_3382 360
327 3300049579 Ga0501043_0018580 Ga0501043_0018580_864_2015 360
328 3300049580 Ga0501046_0080947 Ga0501046_0080947_1316_2467 360
329 3300049584 Ga0501068_0095979 Ga0501068_0095979_20_1171 360
330 3300049586 Ga0501070_0014719 Ga0501070_0014719_1138_2289 360
331 3300049587 Ga0501071_0192313 Ga0501071_0192313_154_1308 360
332 3300049588 Ga0501072_0118147 Ga0501072_0118147_611_1762 360
333 3300049589 Ga0501073_0024666 Ga0501073_0024666_3089_4240 360
334 3300049590 Ga0501074_0012356 Ga0501074_0012356_663_1814 360
335 3300049592 Ga0501076_0166138 Ga0501076_0166138_297_1448 360
336 3300049593 Ga0501077_0030023 Ga0501077_0030023_1230_2381 360
337 3300049741 Ga0501079_0074034 Ga0501079_0074034_135_1286 360
338 3300049823 Ga0501044_0047658 Ga0501044_0047658_1031_2182 360
339 3300050496 nmdc:mga07m45_50697_c1 nmdc:mga07m45_50697_c1_60_1223 360
340 3300053141 Ga0500574_001794 Ga0500574_001794_647_1819 360
341 3300059426 Ga0590077_012424 Ga0590077_012424_238_1392 360
342 3300060353 Ga0501082_0012399 Ga0501082_0012399_4393_5544 360
343 3300061734 Ga0530510_0122412 Ga0530510_0122412_209_1360 360
344 iso_pu_bacteria 2721755763 2723876959 360
345 3300003841 Ga0055541_1001235 Ga0055541_10012353 361
346 3300006051 Ga0075364_10204542 Ga0075364_102045421 361
347 3300025292 Ga0209676_1003758 Ga0209676_10037588 361
348 3300025298 Ga0209050_1001375 Ga0209050_10013758 361
349 3300048927 Ga0496124_0000103 Ga0496124_0000103_47381_48535 361
350 iso_pu_bacteria 2738541277 2738719628 361
351 iso_pu_bacteria 2738541307 2738879937 361
352 iso_pu_bacteria 2738543019 2739278827 361
353 iso_pu_bacteria 2818991446 2819599377 361
354 iso_pu_bacteria 2899924645 2899925883 361
355 iso_pu_bacteria 2904541872 2904544298 361
356 iso_pu_bacteria 2928037797 2928041729 361
357 iso_pu_bacteria 2928044640 2928049293 361
358 iso_pu_bacteria 2928051484 2928052099 361
359 iso_pu_bacteria 2928064002 2928065221 361
360 iso_pu_bacteria 2929160207 2929162130 361
361 3300005290 Ga0065712_10002802 Ga0065712_1000280210 362
362 3300005293 Ga0065715_10012795 Ga0065715_100127955 362
363 3300005330 Ga0070690_100041526 Ga0070690_1000415263 362
364 3300005330 Ga0070690_100064191 Ga0070690_1000641913 362
365 3300005331 Ga0070670_100000191 Ga0070670_10000019141 362
366 3300005336 Ga0070680_100002615 Ga0070680_10000261513 362
367 3300005337 Ga0070682_100011098 Ga0070682_1000110985 362
368 3300005344 Ga0070661_100003806 Ga0070661_1000038064 362
369 3300005353 Ga0070669_100064626 Ga0070669_1000646264 362
370 3300005354 Ga0070675_100070187 Ga0070675_1000701872 362
371 3300005355 Ga0070671_100034890 Ga0070671_1000348903 362
372 3300005356 Ga0070674_100007062 Ga0070674_1000070627 362
373 3300005364 Ga0070673_100055185 Ga0070673_1000551853 362
374 3300005440 Ga0070705_100020941 Ga0070705_1000209412 362
375 3300005441 Ga0070700_100006624 Ga0070700_1000066244 362
376 3300005444 Ga0070694_100015923 Ga0070694_1000159235 362
377 3300005455 Ga0070663_100043513 Ga0070663_1000435132 362
378 3300005456 Ga0070678_100030389 Ga0070678_1000303893 362
379 3300005457 Ga0070662_100026282 Ga0070662_1000262823 362
380 3300005458 Ga0070681_10018223 Ga0070681_100182236 362
381 3300005459 Ga0068867_100022324 Ga0068867_1000223243 362
382 3300005530 Ga0070679_100024625 Ga0070679_1000246256 362
383 3300005545 Ga0070695_100005789 Ga0070695_1000057893 362
384 3300005546 Ga0070696_100018017 Ga0070696_1000180174 362
385 3300005547 Ga0070693_100044899 Ga0070693_1000448992 362
386 3300005548 Ga0070665_100219927 Ga0070665_1002199272 362
387 3300005549 Ga0070704_100034440 Ga0070704_1000344403 362
388 3300005564 Ga0070664_100016829 Ga0070664_1000168293 362
389 3300005578 Ga0068854_100016099 Ga0068854_1000160995 362
390 3300005614 Ga0068856_100097086 Ga0068856_1000970862 362
391 3300006175 Ga0070712_100044125 Ga0070712_1000441252 362
392 3300006881 Ga0068865_100042100 Ga0068865_1000421002 362
393 3300009094 Ga0111539_10102731 Ga0111539_101027312 362
394 3300009098 Ga0105245_10022850 Ga0105245_100228504 362
395 3300009174 Ga0105241_10046984 Ga0105241_100469843 362
396 3300009174 Ga0105241_10315112 Ga0105241_103151122 362
397 3300009545 Ga0105237_10178738 Ga0105237_101787382 362
398 3300013100 Ga0157373_10014407 Ga0157373_100144074 362
399 3300013296 Ga0157374_10016308 Ga0157374_100163087 362
400 3300013297 Ga0157378_10021758 Ga0157378_100217586 362
401 3300013306 Ga0163162_10159051 Ga0163162_101590512 362
402 3300014326 Ga0157380_10063112 Ga0157380_100631122 362
403 3300014969 Ga0157376_10024430 Ga0157376_100244302 362
404 3300021361 Ga0213872_10000453 Ga0213872_100004535 362
405 3300025315 Ga0207697_10009381 Ga0207697_100093814 362
406 3300025907 Ga0207645_10001291 Ga0207645_1000129124 362
407 3300025912 Ga0207707_10007506 Ga0207707_100075065 362
408 3300025917 Ga0207660_10013064 Ga0207660_100130642 362
409 3300025918 Ga0207662_10056815 Ga0207662_100568152 362
410 3300025919 Ga0207657_10015456 Ga0207657_100154565 362
411 3300025920 Ga0207649_10012065 Ga0207649_100120653 362
412 3300025921 Ga0207652_10016085 Ga0207652_100160855 362
413 3300025925 Ga0207650_10000481 Ga0207650_1000048138 362
414 3300025931 Ga0207644_10028163 Ga0207644_100281634 362
415 3300025932 Ga0207690_10014714 Ga0207690_100147142 362
416 3300025933 Ga0207706_10003089 Ga0207706_100030896 362
417 3300025940 Ga0207691_10002287 Ga0207691_100022878 362
418 3300025945 Ga0207679_10003108 Ga0207679_100031086 362
419 3300025961 Ga0207712_10048412 Ga0207712_100484123 362
420 3300025981 Ga0207640_10015942 Ga0207640_100159422 362
421 3300026041 Ga0207639_10050298 Ga0207639_100502982 362
422 3300026067 Ga0207678_10048694 Ga0207678_100486943 362
423 3300026075 Ga0207708_10020329 Ga0207708_100203293 362
424 3300026089 Ga0207648_10052066 Ga0207648_100520663 362
425 3300026121 Ga0207683_10003551 Ga0207683_1000355118 362
426 3300039447 Ga0436361_0837231 Ga0436361_0837231_14935_16086 362
427 3300048905 Ga0496102_0144584 Ga0496102_0144584_340_1503 362
428 3300048915 Ga0496112_0019288 Ga0496112_0019288_1753_2916 362
429 3300049570 Ga0501033_0004879 Ga0501033_0004879_4879_6036 362
430 3300049579 Ga0501043_0130414 Ga0501043_0130414_243_1400 362
431 3300049581 Ga0501047_0014502 Ga0501047_0014502_4625_5782 362
432 3300049822 Ga0501035_0005340 Ga0501035_0005340_7836_8993 362
433 3300049823 Ga0501044_0006513 Ga0501044_0006513_7132_8289 362
434 3300050512 nmdc:mga0n895_116726_c1 nmdc:mga0n895_116726_c1_1319_2482 362
435 3300050513 nmdc:mga0rr50_254317_c1 nmdc:mga0rr50_254317_c1_270_1433 362
436 3300001915 JGI24741J21665_1000196 JGI24741J21665_10001964 363
437 3300001979 JGI24740J21852_10003016 JGI24740J21852_100030166 363
438 3300002705 JGI25156J39149_1016653 JGI25156J39149_10166531 363
439 3300003187 JGI25151J46595_10000137 JGI25151J46595_1000013788 363
440 3300003316 rootH1_10017612 rootH1_100176122 363
441 3300003752 Ga0055539_1000081 Ga0055539_100008176 363
442 3300003758 Ga0055532_1000048 Ga0055532_100004861 363
443 3300003759 Ga0055525_1000273 Ga0055525_100027349 363
444 3300003760 Ga0055527_1003308 Ga0055527_10033083 363
445 3300003761 Ga0055535_1000035 Ga0055535_100003561 363
446 3300003763 Ga0055529_1000101 Ga0055529_1000101110 363
447 3300003792 Ga0055540_1008797 Ga0055540_10087972 363
448 3300005344 Ga0070661_100000370 Ga0070661_1000003707 363
449 3300005366 Ga0070659_100037086 Ga0070659_1000370861 363
450 3300005367 Ga0070667_100063802 Ga0070667_1000638023 363
451 3300005455 Ga0070663_100000024 Ga0070663_10000002481 363
452 3300005467 Ga0070706_100002692 Ga0070706_1000026924 363
453 3300005471 Ga0070698_100251532 Ga0070698_1002515321 363
454 3300005548 Ga0070665_100008996 Ga0070665_1000089967 363
455 3300005564 Ga0070664_100000022 Ga0070664_10000002281 363
456 3300005577 Ga0068857_100026215 Ga0068857_1000262154 363
457 3300005577 Ga0068857_100111768 Ga0068857_1001117683 363
458 3300005578 Ga0068854_100000336 Ga0068854_10000033619 363
459 3300005614 Ga0068856_100000049 Ga0068856_10000004981 363
460 3300006038 Ga0075365_10004760 Ga0075365_100047604 363
461 3300006048 Ga0075363_100016697 Ga0075363_1000166974 363
462 3300006177 Ga0075362_10000766 Ga0075362_100007664 363
463 3300006178 Ga0075367_10058564 Ga0075367_100585642 363
464 3300006353 Ga0075370_10002838 Ga0075370_100028388 363
465 3300009036 Ga0105244_10025014 Ga0105244_100250141 363
466 3300009093 Ga0105240_10078101 Ga0105240_100781011 363
467 3300011119 Ga0105246_10083087 Ga0105246_100830872 363
468 3300013100 Ga0157373_10003934 Ga0157373_1000393410 363
469 3300013102 Ga0157371_10000089 Ga0157371_1000008979 363
470 3300013104 Ga0157370_10000002 Ga0157370_10000002322 363
471 3300013105 Ga0157369_10018918 Ga0157369_100189183 363
472 3300013307 Ga0157372_10000149 Ga0157372_1000014950 363
473 3300015261 Ga0182006_1027763 Ga0182006_10277632 363
474 3300020077 Ga0206351_10088450 Ga0206351_100884501 363
475 3300021361 Ga0213872_10011834 Ga0213872_100118342 363
476 3300022467 Ga0224712_10054704 Ga0224712_100547041 363
477 3300025224 Ga0209784_100024 Ga0209784_100024297 363
478 3300025224 Ga0209784_100435 Ga0209784_10043513 363
479 3300025225 Ga0209566_100018 Ga0209566_100018297 363
480 3300025226 Ga0209674_100046 Ga0209674_10004666 363
481 3300025228 Ga0209672_100240 Ga0209672_10024029 363
482 3300025229 Ga0209147_100008 Ga0209147_10000880 363
483 3300025230 Ga0209563_100039 Ga0209563_10003966 363
484 3300025242 Ga0209258_100013 Ga0209258_10001380 363
485 3300025242 Ga0209258_100977 Ga0209258_1009777 363
486 3300025253 Ga0209677_100024 Ga0209677_10002464 363
487 3300025256 Ga0209759_1008320 Ga0209759_10083202 363
488 3300025272 Ga0209455_1000042 Ga0209455_100004280 363
489 3300025294 Ga0209025_1000071 Ga0209025_1000071172 363
490 3300025303 Ga0209051_1003989 Ga0209051_10039893 363
491 3300025910 Ga0207684_10005030 Ga0207684_1000503012 363
492 3300025913 Ga0207695_10004273 Ga0207695_100042732 363
493 3300025913 Ga0207695_10057661 Ga0207695_100576612 363
494 3300025920 Ga0207649_10000075 Ga0207649_100000757 363
495 3300025932 Ga0207690_10024118 Ga0207690_100241184 363
496 3300025945 Ga0207679_10000004 Ga0207679_10000004489 363
497 3300025981 Ga0207640_10000084 Ga0207640_1000008459 363
498 3300026067 Ga0207678_10000012 Ga0207678_1000001279 363
499 3300026078 Ga0207702_10000020 Ga0207702_10000020132 363
500 3300026116 Ga0207674_10006196 Ga0207674_100061963 363
501 3300026118 Ga0207675_100288250 Ga0207675_1002882501 363
502 3300026142 Ga0207698_10102209 Ga0207698_101022092 363
503 3300027312 Ga0209371_1020996 Ga0209371_10209962 363
504 3300028786 Ga0307517_10058531 Ga0307517_100585312 363
505 3300028794 Ga0307515_10038038 Ga0307515_100380382 363
506 3300028794 Ga0307515_10038364 Ga0307515_100383644 363
507 3300030522 Ga0307512_10011610 Ga0307512_100116108 363
508 3300031251 Ga0265327_10037005 Ga0265327_100370052 363
509 3300031456 Ga0307513_10090506 Ga0307513_100905062 363
510 3300031507 Ga0307509_10001216 Ga0307509_100012166 363
511 3300031507 Ga0307509_10011687 Ga0307509_100116879 363
512 3300031507 Ga0307509_10139579 Ga0307509_101395792 363
513 3300031649 Ga0307514_10164679 Ga0307514_101646792 363
514 3300031730 Ga0307516_10001684 Ga0307516_1000168410 363
515 3300031911 Ga0307412_10000137 Ga0307412_1000013732 363
516 3300033179 Ga0307507_10051280 Ga0307507_100512803 363
517 3300033180 Ga0307510_10159712 Ga0307510_101597122 363
518 3300046454 Ga0495592_0000563 Ga0495592_0000563_7029_8207 363
519 3300046501 Ga0495607_0000009 Ga0495607_0000009_101461_102612 363
520 3300046512 Ga0495610_0039051 Ga0495610_0039051_244_1422 363
521 3300046524 Ga0495648_0065979 Ga0495648_0065979_825_2003 363
522 3300046526 Ga0495666_0056612 Ga0495666_0056612_636_1814 363
523 3300046683 Ga0495658_0048392 Ga0495658_0048392_633_1811 363
524 3300047472 Ga0495686_0011776 Ga0495686_0011776_1125_2303 363
525 3300048920 Ga0496117_0062034 Ga0496117_0062034_1391_2545 363
526 3300048924 Ga0496121_0000411 Ga0496121_0000411_49645_50799 363
527 3300048925 Ga0496122_0001568 Ga0496122_0001568_25886_27040 363
528 3300048928 Ga0496125_0000096 Ga0496125_0000096_63731_64885 363
529 3300048929 Ga0496126_0037790 Ga0496126_0037790_2373_3527 363
530 3300049579 Ga0501043_0000010 Ga0501043_0000010_156271_157431 363
531 3300049580 Ga0501046_0000132 Ga0501046_0000132_10414_11574 363
532 3300049581 Ga0501047_0000026 Ga0501047_0000026_67925_69085 363
533 3300050492 nmdc:mga0yw44_131515_c1 nmdc:mga0yw44_131515_c1_58_1221 363
534 3300050493 nmdc:mga0k408_732_c1 nmdc:mga0k408_732_c1_10766_11929 363
535 3300050494 nmdc:mga06z11_6883_c1 nmdc:mga06z11_6883_c1_2488_3651 363
536 3300050496 nmdc:mga07m45_32159_c1 nmdc:mga07m45_32159_c1_413_1576 363
537 3300050496 nmdc:mga07m45_434_c1 nmdc:mga07m45_434_c1_4423_5586 363
538 3300053088 Ga0500644_0002663 Ga0500644_0002663_2232_3410 363
539 3300053093 Ga0500651_0015446 Ga0500651_0015446_2901_4079 363
540 3300053118 Ga0500594_0001534 Ga0500594_0001534_2861_4039 363
541 3300053156 Ga0500622_0000585 Ga0500622_0000585_5437_6615 363
542 3300053161 Ga0500634_0003843 Ga0500634_0003843_4824_6050 363
543 3300059640 Ga0587067_003515 Ga0587067_003515_383_1543 363
544 3300059641 Ga0587068_003846 Ga0587068_003846_409_1569 363
545 3300059643 Ga0587072_001638 Ga0587072_001638_1281_2441 363
546 3300061719 Ga0466962_0006170 Ga0466962_0006170_133_1314 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

71

423

0.92

PF01094

ANF_receptor

Receptor family ligand binding region

90

404

0.85

PF13433

Peripla_BP_5

Periplasmic binding protein domain

74

426

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.8577 19 361
4obb-assembly2.cif.gz_B the crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid. 0.8452 21 363
4m88-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from verminephrobacter eiseniae ef01-2 0.8403 21 360
4zpj-assembly1.cif.gz_A abc transporter substrate-binding protein from sphaerobacter thermophilus 0.8375 21 361
4oat-assembly1.cif.gz_A the crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine. 0.8318 21 363
ID Description Score Start End Superfamily
4nqrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9495 126 256 3.40.50.2300
3td9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9149 126 251 3.40.50.2300
4gnrA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.911 126 253 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9061 126 251 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8992 126 251 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3AAT3-F1-model_v4 deleted 0.928 15 98
AF-A0A2N0QHD5-F1-model_v4 Periplasmic binding protein-like I 0.9213 20 110
AF-A0A1B8P3D6-F1-model_v4 Aliphatic amidase expression-regulating protein 0.9161 16 111
AF-F1W248-F1-model_v4 Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein 0.9145 217 363
AF-A0A2V6S585-F1-model_v4 ABC transporter substrate-binding protein 0.9131 12 111 GO:0006865

Feature Viewer

pLDDT pTM Quality
87.95 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map