F461878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 545 | 340 | 510 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10001334|Ga0265327_1000133417 |
| Length | 282 |
| Sequence | VGTSPHGGTWLVRRPVAYCAHVPIETVRDREGVAEVVIDHPPVNALDVAGWFALADALVAAGQSPETTVVVLRAEGRGFCAGVDIKEIQAEGDRALVGVNRGCAAAFAAVYDCEVPVIAAVGGFCLGGGIGLVGNADIVIAADDATFGLPEVDRGALGAATHLARLVPQHKMREMVYTAKSVTADELAGYGSVSRVVPRAALRDAALDLADEIATKHPSIIRRAKESLNGIDPVDVKRSYRFEQGFTYELHVRGVADEQRAAFVEKRAPVVGHRGEGGGGSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 4 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 5 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 6 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 7 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 8 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 9 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 10 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 11 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 12 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 13 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 14 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 15 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 16 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 17 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 18 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 19 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 20 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 21 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 22 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 23 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 24 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 25 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 26 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 27 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 28 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 29 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 218 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 223 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 224 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 225 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 226 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 327 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 331 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 333 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 336 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 337 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 338 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 339 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 340 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.21 |
| Metatranscriptomes | 0.37 |
| Isolates | 6.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.59 |
| Nodule | 1.47 |
| Rhizoplane | 5.5 |
| Rhizosphere | 81.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10164656 | 3300003322 | Bacteria | 1283 |
| 2 | Ga0055532_1001927 | 3300003758 | Bacteria | 4930 |
| 3 | Ga0055532_1001930 | 3300003758 | Bacteria | 4918 |
| 4 | Ga0055527_1000103 | 3300003760 | Bacteria | 62002 |
| 5 | Ga0055535_1000209 | 3300003761 | Bacteria | 62002 |
| 6 | Ga0055542_1001293 | 3300003762 | Bacteria | 13359 |
| 7 | Ga0070658_10007745 | 3300005327 | Bacteria | 8655 |
| 8 | Ga0070676_10006570 | 3300005328 | Bacteria | 6217 |
| 9 | Ga0070670_100218700 | 3300005331 | Bacteria | 1657 |
| 10 | Ga0070666_10064701 | 3300005335 | Bacteria | 2480 |
| 11 | Ga0068868_100122815 | 3300005338 | Bacteria | 2119 |
| 12 | Ga0068868_100704217 | 3300005338 | Bacteria | 904 |
| 13 | Ga0070660_100118361 | 3300005339 | Bacteria | 2113 |
| 14 | Ga0070691_10054011 | 3300005341 | Bacteria | 1923 |
| 15 | Ga0070668_100002771 | 3300005347 | Bacteria | 12883 |
| 16 | Ga0070668_100036337 | 3300005347 | Bacteria | 3759 |
| 17 | Ga0070668_100250604 | 3300005347 | Bacteria | 1470 |
| 18 | Ga0070671_100024285 | 3300005355 | Bacteria | 4962 |
| 19 | Ga0070674_100012675 | 3300005356 | Bacteria | 5183 |
| 20 | Ga0070673_100026276 | 3300005364 | Bacteria | 4299 |
| 21 | Ga0070659_100413529 | 3300005366 | Bacteria | 1140 |
| 22 | Ga0070667_100545757 | 3300005367 | Bacteria | 1065 |
| 23 | Ga0070667_100616896 | 3300005367 | Bacteria | 1000 |
| 24 | Ga0070709_10032498 | 3300005434 | Bacteria | 3147 |
| 25 | Ga0070709_10104308 | 3300005434 | Bacteria | 1894 |
| 26 | Ga0070714_100043027 | 3300005435 | Bacteria | 3818 |
| 27 | Ga0070714_100073810 | 3300005435 | Bacteria | 2956 |
| 28 | Ga0070714_100232846 | 3300005435 | Bacteria | 1698 |
| 29 | Ga0070714_100611116 | 3300005435 | Bacteria | 1047 |
| 30 | Ga0070714_100625640 | 3300005435 | Bacteria | 1035 |
| 31 | Ga0070713_100010434 | 3300005436 | Bacteria | 6709 |
| 32 | Ga0070713_100028818 | 3300005436 | Bacteria | 4388 |
| 33 | Ga0070713_100161365 | 3300005436 | Bacteria | 2001 |
| 34 | Ga0070713_100461444 | 3300005436 | Bacteria | 1194 |
| 35 | Ga0070710_10002583 | 3300005437 | Bacteria | 8605 |
| 36 | Ga0070710_10011934 | 3300005437 | Bacteria | 4305 |
| 37 | Ga0070710_10025429 | 3300005437 | Bacteria | 3135 |
| 38 | Ga0070694_100298496 | 3300005444 | Bacteria | 1234 |
| 39 | Ga0070708_100035685 | 3300005445 | Bacteria | 4333 |
| 40 | Ga0070678_100001371 | 3300005456 | Bacteria | 12958 |
| 41 | Ga0070662_100067085 | 3300005457 | Bacteria | 2634 |
| 42 | Ga0068867_100449265 | 3300005459 | Bacteria | 1098 |
| 43 | Ga0070707_100049989 | 3300005468 | Bacteria | 4008 |
| 44 | Ga0070707_100101437 | 3300005468 | Bacteria | 2789 |
| 45 | Ga0070699_100154238 | 3300005518 | Bacteria | 2032 |
| 46 | Ga0070697_100021918 | 3300005536 | Bacteria | 5067 |
| 47 | Ga0068853_100421945 | 3300005539 | Bacteria | 1251 |
| 48 | Ga0070672_100383445 | 3300005543 | Bacteria | 1202 |
| 49 | Ga0070693_100079426 | 3300005547 | Bacteria | 1952 |
| 50 | Ga0070693_100379360 | 3300005547 | Bacteria | 975 |
| 51 | Ga0070665_100001428 | 3300005548 | Bacteria | 28009 |
| 52 | Ga0070704_100219440 | 3300005549 | Bacteria | 1545 |
| 53 | Ga0068855_100002217 | 3300005563 | Bacteria | 24047 |
| 54 | Ga0068855_100146500 | 3300005563 | Bacteria | 2687 |
| 55 | Ga0068855_100197368 | 3300005563 | Bacteria | 2267 |
| 56 | Ga0068855_100214837 | 3300005563 | Bacteria | 2159 |
| 57 | Ga0068855_100424118 | 3300005563 | Bacteria | 1455 |
| 58 | Ga0068857_100476935 | 3300005577 | Bacteria | 1169 |
| 59 | Ga0068864_100598144 | 3300005618 | Bacteria | 1070 |
| 60 | Ga0068866_10027292 | 3300005718 | Bacteria | 2706 |
| 61 | Ga0068870_10009358 | 3300005840 | Bacteria | 4453 |
| 62 | Ga0068863_100553946 | 3300005841 | Bacteria | 1135 |
| 63 | Ga0068858_100023429 | 3300005842 | Bacteria | 5751 |
| 64 | Ga0068858_100031738 | 3300005842 | Bacteria | 4909 |
| 65 | Ga0068858_100033104 | 3300005842 | Bacteria | 4800 |
| 66 | Ga0068860_100006204 | 3300005843 | Bacteria | 12016 |
| 67 | Ga0068860_100028090 | 3300005843 | Bacteria | 5416 |
| 68 | Ga0068862_100011608 | 3300005844 | Bacteria | 7268 |
| 69 | Ga0081455_10054664 | 3300005937 | Bacteria | 3401 |
| 70 | Ga0081540_1055828 | 3300005983 | Bacteria | 1921 |
| 71 | Ga0070717_10081359 | 3300006028 | Bacteria | 2719 |
| 72 | Ga0070717_10092180 | 3300006028 | Bacteria | 2559 |
| 73 | Ga0070717_10263813 | 3300006028 | Bacteria | 1524 |
| 74 | Ga0070715_10000618 | 3300006163 | Bacteria | 9385 |
| 75 | Ga0070716_100249191 | 3300006173 | Bacteria | 1209 |
| 76 | Ga0070712_100051032 | 3300006175 | Bacteria | 2880 |
| 77 | Ga0070712_100073392 | 3300006175 | Bacteria | 2454 |
| 78 | Ga0070712_100106467 | 3300006175 | Bacteria | 2085 |
| 79 | Ga0070712_100130813 | 3300006175 | Bacteria | 1902 |
| 80 | Ga0070712_100148673 | 3300006175 | Bacteria | 1796 |
| 81 | Ga0070712_100169996 | 3300006175 | Bacteria | 1690 |
| 82 | Ga0070712_100355791 | 3300006175 | Bacteria | 1199 |
| 83 | Ga0097621_100043869 | 3300006237 | Bacteria | 3606 |
| 84 | Ga0075428_100003036 | 3300006844 | Bacteria | 18329 |
| 85 | Ga0075428_100224042 | 3300006844 | Bacteria | 2030 |
| 86 | Ga0075430_100253487 | 3300006846 | Bacteria | 1458 |
| 87 | Ga0075430_100353476 | 3300006846 | Bacteria | 1213 |
| 88 | Ga0075431_100027540 | 3300006847 | Bacteria | 5833 |
| 89 | Ga0075431_100285608 | 3300006847 | Bacteria | 1670 |
| 90 | Ga0075431_100366999 | 3300006847 | Bacteria | 1445 |
| 91 | Ga0075429_100063985 | 3300006880 | Bacteria | 3204 |
| 92 | Ga0068865_100464061 | 3300006881 | Bacteria | 1049 |
| 93 | Ga0075435_100367433 | 3300007076 | Bacteria | 1235 |
| 94 | Ga0105245_10030968 | 3300009098 | Bacteria | 4732 |
| 95 | Ga0105245_10829488 | 3300009098 | Bacteria | 964 |
| 96 | Ga0105247_10023102 | 3300009101 | Bacteria | 3745 |
| 97 | Ga0114129_10307472 | 3300009147 | Bacteria | 2111 |
| 98 | Ga0114129_10858044 | 3300009147 | Bacteria | 1154 |
| 99 | Ga0105241_10011887 | 3300009174 | Bacteria | 6397 |
| 100 | Ga0105242_10007934 | 3300009176 | Bacteria | 8175 |
| 101 | Ga0105237_10247412 | 3300009545 | Bacteria | 1785 |
| 102 | Ga0105237_10305317 | 3300009545 | Bacteria | 1594 |
| 103 | Ga0105238_10002317 | 3300009551 | Bacteria | 19137 |
| 104 | Ga0105238_10319956 | 3300009551 | Bacteria | 1537 |
| 105 | Ga0105239_10009458 | 3300010375 | Bacteria | 10983 |
| 106 | Ga0157369_10047435 | 3300013105 | Bacteria | 4664 |
| 107 | Ga0157369_10262634 | 3300013105 | Bacteria | 1800 |
| 108 | Ga0157369_10388678 | 3300013105 | Bacteria | 1448 |
| 109 | Ga0157374_10057897 | 3300013296 | Bacteria | 3620 |
| 110 | Ga0157378_10222067 | 3300013297 | Bacteria | 1797 |
| 111 | Ga0157372_10880232 | 3300013307 | Bacteria | 1039 |
| 112 | Ga0163163_10104254 | 3300014325 | Bacteria | 2861 |
| 113 | Ga0163163_10330570 | 3300014325 | Bacteria | 1578 |
| 114 | Ga0157379_10119526 | 3300014968 | Bacteria | 2370 |
| 115 | Ga0157376_10040783 | 3300014969 | Bacteria | 3796 |
| 116 | Ga0157376_10185312 | 3300014969 | Bacteria | 1905 |
| 117 | Ga0182007_10014081 | 3300015262 | Bacteria | 3028 |
| 118 | Ga0206354_11368094 | 3300020081 | Bacteria | 1991 |
| 119 | Ga0206353_10656357 | 3300020082 | Bacteria | 1443 |
| 120 | Ga0213872_10000311 | 3300021361 | Bacteria | 41468 |
| 121 | Ga0209566_100365 | 3300025225 | Bacteria | 37887 |
| 122 | Ga0209674_104697 | 3300025226 | Bacteria | 2168 |
| 123 | Ga0209672_100062 | 3300025228 | Bacteria | 204912 |
| 124 | Ga0209147_100061 | 3300025229 | Bacteria | 248809 |
| 125 | Ga0209147_100078 | 3300025229 | Bacteria | 204912 |
| 126 | Ga0209258_100108 | 3300025242 | Bacteria | 204912 |
| 127 | Ga0209233_1006721 | 3300025261 | Bacteria | 3687 |
| 128 | Ga0209455_1000251 | 3300025272 | Bacteria | 63875 |
| 129 | Ga0209025_1000034 | 3300025294 | Bacteria | 413205 |
| 130 | Ga0209051_1029255 | 3300025303 | Bacteria | 2159 |
| 131 | Ga0207692_10062971 | 3300025898 | Bacteria | 1926 |
| 132 | Ga0207692_10094059 | 3300025898 | Bacteria | 1631 |
| 133 | Ga0207642_10084595 | 3300025899 | Bacteria | 1550 |
| 134 | Ga0207710_10049501 | 3300025900 | Bacteria | 1883 |
| 135 | Ga0207647_10080857 | 3300025904 | Bacteria | 1948 |
| 136 | Ga0207685_10005718 | 3300025905 | Bacteria | 3315 |
| 137 | Ga0207699_10011325 | 3300025906 | Bacteria | 4500 |
| 138 | Ga0207645_10001237 | 3300025907 | Bacteria | 21011 |
| 139 | Ga0207643_10012781 | 3300025908 | Bacteria | 4540 |
| 140 | Ga0207705_10018322 | 3300025909 | Bacteria | 5007 |
| 141 | Ga0207693_10000161 | 3300025915 | Bacteria | 61727 |
| 142 | Ga0207693_10086339 | 3300025915 | Bacteria | 2458 |
| 143 | Ga0207693_10164120 | 3300025915 | Bacteria | 1748 |
| 144 | Ga0207693_10203018 | 3300025915 | Bacteria | 1559 |
| 145 | Ga0207693_10216382 | 3300025915 | Bacteria | 1505 |
| 146 | Ga0207663_10098440 | 3300025916 | Bacteria | 1958 |
| 147 | Ga0207646_10099584 | 3300025922 | Bacteria | 2605 |
| 148 | Ga0207694_10001252 | 3300025924 | Bacteria | 21941 |
| 149 | Ga0207700_10006538 | 3300025928 | Bacteria | 7049 |
| 150 | Ga0207664_10043733 | 3300025929 | Bacteria | 3505 |
| 151 | Ga0207664_10447951 | 3300025929 | Bacteria | 1152 |
| 152 | Ga0207664_10674177 | 3300025929 | Bacteria | 930 |
| 153 | Ga0207706_10031269 | 3300025933 | Bacteria | 4743 |
| 154 | Ga0207704_10655149 | 3300025938 | Bacteria | 865 |
| 155 | Ga0207665_10010659 | 3300025939 | Bacteria | 6035 |
| 156 | Ga0207665_10259126 | 3300025939 | Bacteria | 1288 |
| 157 | Ga0207691_10001275 | 3300025940 | Bacteria | 25192 |
| 158 | Ga0207689_10401220 | 3300025942 | Bacteria | 1143 |
| 159 | Ga0207661_10262523 | 3300025944 | Bacteria | 1539 |
| 160 | Ga0207667_10007751 | 3300025949 | Bacteria | 12832 |
| 161 | Ga0207667_10215950 | 3300025949 | Bacteria | 1965 |
| 162 | Ga0207667_10263707 | 3300025949 | Bacteria | 1762 |
| 163 | Ga0207667_10372274 | 3300025949 | Bacteria | 1456 |
| 164 | Ga0207668_10010415 | 3300025972 | Bacteria | 5615 |
| 165 | Ga0207668_10179523 | 3300025972 | Bacteria | 1668 |
| 166 | Ga0207658_10052002 | 3300025986 | Bacteria | 3021 |
| 167 | Ga0207658_10127346 | 3300025986 | Bacteria | 2040 |
| 168 | Ga0207703_10157464 | 3300026035 | Bacteria | 1986 |
| 169 | Ga0207678_10076889 | 3300026067 | Bacteria | 2859 |
| 170 | Ga0207708_10017628 | 3300026075 | Bacteria | 5376 |
| 171 | Ga0207702_10047109 | 3300026078 | Bacteria | 3631 |
| 172 | Ga0207702_10076903 | 3300026078 | Bacteria | 2885 |
| 173 | Ga0207702_10237003 | 3300026078 | Bacteria | 1708 |
| 174 | Ga0207702_10304279 | 3300026078 | Bacteria | 1514 |
| 175 | Ga0207648_10006902 | 3300026089 | Bacteria | 11248 |
| 176 | Ga0207676_10217654 | 3300026095 | Bacteria | 1699 |
| 177 | Ga0207676_10251514 | 3300026095 | Bacteria | 1591 |
| 178 | Ga0207674_10166233 | 3300026116 | Bacteria | 2160 |
| 179 | Ga0207675_100007183 | 3300026118 | Bacteria | 10523 |
| 180 | Ga0207683_10014642 | 3300026121 | Bacteria | 6680 |
| 181 | Ga0209981_1024901 | 3300027378 | Bacteria | 865 |
| 182 | Ga0209984_1018162 | 3300027424 | Bacteria | 948 |
| 183 | Ga0209982_1021923 | 3300027552 | Bacteria | 985 |
| 184 | Ga0210002_1025289 | 3300027617 | Bacteria | 971 |
| 185 | Ga0209983_1000778 | 3300027665 | Bacteria | 6936 |
| 186 | Ga0209971_1000645 | 3300027682 | Bacteria | 9092 |
| 187 | Ga0209998_10000369 | 3300027717 | Bacteria | 13058 |
| 188 | Ga0209974_10000695 | 3300027876 | Bacteria | 11471 |
| 189 | Ga0207428_10129090 | 3300027907 | Bacteria | 1935 |
| 190 | Ga0268266_10000945 | 3300028379 | Bacteria | 36992 |
| 191 | Ga0268265_10139025 | 3300028380 | Bacteria | 2030 |
| 192 | Ga0268265_10143935 | 3300028380 | Bacteria | 2000 |
| 193 | Ga0265337_1000136 | 3300028556 | Bacteria | 37039 |
| 194 | Ga0265326_10000701 | 3300028558 | Bacteria | 12388 |
| 195 | Ga0265326_10041604 | 3300028558 | Bacteria | 1305 |
| 196 | Ga0265319_1001835 | 3300028563 | Bacteria | 12110 |
| 197 | Ga0265334_10000468 | 3300028573 | Bacteria | 20832 |
| 198 | Ga0265323_10001755 | 3300028653 | Bacteria | 10292 |
| 199 | Ga0265322_10001776 | 3300028654 | Bacteria | 6843 |
| 200 | Ga0265336_10001798 | 3300028666 | Bacteria | 9374 |
| 201 | Ga0307517_10083105 | 3300028786 | Bacteria | 2711 |
| 202 | Ga0307517_10204258 | 3300028786 | Bacteria | 1229 |
| 203 | Ga0307515_10008714 | 3300028794 | Bacteria | 19719 |
| 204 | Ga0307515_10043536 | 3300028794 | Bacteria | 6974 |
| 205 | Ga0265338_10009448 | 3300028800 | Bacteria | 11622 |
| 206 | Ga0265338_10159528 | 3300028800 | Bacteria | 1743 |
| 207 | Ga0265324_10001624 | 3300029957 | Bacteria | 12483 |
| 208 | Ga0307512_10026940 | 3300030522 | Bacteria | 5067 |
| 209 | Ga0265332_10001612 | 3300031238 | Bacteria | 12359 |
| 210 | Ga0265320_10002827 | 3300031240 | Bacteria | 11938 |
| 211 | Ga0265325_10006977 | 3300031241 | Bacteria | 6809 |
| 212 | Ga0265340_10023192 | 3300031247 | Bacteria | 3166 |
| 213 | Ga0265327_10000104 | 3300031251 | Bacteria | 185298 |
| 214 | Ga0265327_10000229 | 3300031251 | Bacteria | 113907 |
| 215 | Ga0265327_10000774 | 3300031251 | Bacteria | 49307 |
| 216 | Ga0265327_10001334 | 3300031251 | Bacteria | 31995 |
| 217 | Ga0265316_10002565 | 3300031344 | Bacteria | 18770 |
| 218 | Ga0307513_10010075 | 3300031456 | Bacteria | 11904 |
| 219 | Ga0307513_10195259 | 3300031456 | Bacteria | 1871 |
| 220 | Ga0307513_10211154 | 3300031456 | Bacteria | 1772 |
| 221 | Ga0307513_10258916 | 3300031456 | Bacteria | 1531 |
| 222 | Ga0307509_10007990 | 3300031507 | Bacteria | 13634 |
| 223 | Ga0307509_10109155 | 3300031507 | Bacteria | 2778 |
| 224 | Ga0307509_10138524 | 3300031507 | Bacteria | 2374 |
| 225 | Ga0265313_10010060 | 3300031595 | Bacteria | 6050 |
| 226 | Ga0307508_10002491 | 3300031616 | Bacteria | 19419 |
| 227 | Ga0307508_10044916 | 3300031616 | Bacteria | 3949 |
| 228 | Ga0265314_10004380 | 3300031711 | Bacteria | 13132 |
| 229 | Ga0265342_10002497 | 3300031712 | Bacteria | 15841 |
| 230 | Ga0307516_10001391 | 3300031730 | Bacteria | 33410 |
| 231 | Ga0307516_10145394 | 3300031730 | Bacteria | 2137 |
| 232 | Ga0307405_10122414 | 3300031731 | Bacteria | 1782 |
| 233 | Ga0316577_10158188 | 3300031733 | Bacteria | 1278 |
| 234 | Ga0307406_10071387 | 3300031901 | Bacteria | 2276 |
| 235 | Ga0307412_10156585 | 3300031911 | Bacteria | 1687 |
| 236 | Ga0307409_100245995 | 3300031995 | Bacteria | 1632 |
| 237 | Ga0307416_100262272 | 3300032002 | Bacteria | 1690 |
| 238 | Ga0307411_10292491 | 3300032005 | Bacteria | 1302 |
| 239 | Ga0307507_10108957 | 3300033179 | Bacteria | 2274 |
| 240 | Ga0307507_10146674 | 3300033179 | Bacteria | 1790 |
| 241 | Ga0373938_0013800 | 3300034957 | Bacteria | 1540 |
| 242 | Ga0373938_0033606 | 3300034957 | Bacteria | 1110 |
| 243 | Ga0373926_0011101 | 3300035083 | Bacteria | 3027 |
| 244 | Ga0373926_0012938 | 3300035083 | Bacteria | 2826 |
| 245 | Ga0373923_0000147 | 3300035111 | Bacteria | 13643 |
| 246 | Ga0373923_0023496 | 3300035111 | Bacteria | 2426 |
| 247 | Ga0373936_0005085 | 3300035113 | Bacteria | 4951 |
| 248 | Ga0373936_0090465 | 3300035113 | Bacteria | 1283 |
| 249 | Ga0373941_0000662 | 3300035115 | Bacteria | 6973 |
| 250 | Ga0373945_0028187 | 3300035116 | Bacteria | 1966 |
| 251 | Ga0373953_0035103 | 3300035117 | Bacteria | 1969 |
| 252 | Ga0373953_0059453 | 3300035117 | Bacteria | 1560 |
| 253 | Ga0373956_0004840 | 3300035119 | Bacteria | 5390 |
| 254 | Ga0373956_0112148 | 3300035119 | Bacteria | 1270 |
| 255 | Ga0373956_0116781 | 3300035119 | Bacteria | 1245 |
| 256 | Ga0373957_0060838 | 3300035120 | Bacteria | 1463 |
| 257 | Ga0373943_0128234 | 3300035170 | Bacteria | 1355 |
| 258 | Ga0373955_0019966 | 3300035172 | Bacteria | 3360 |
| 259 | Ga0373955_0084490 | 3300035172 | Bacteria | 1800 |
| 260 | Ga0373955_0129442 | 3300035172 | Bacteria | 1472 |
| 261 | Ga0373942_0000794 | 3300035207 | Bacteria | 8718 |
| 262 | Ga0373962_0004406 | 3300035242 | Bacteria | 3402 |
| 263 | Ga0316574_0047710 | 3300035398 | Bacteria | 2659 |
| 264 | Ga0316574_0397832 | 3300035398 | Bacteria | 868 |
| 265 | Ga0373924_0003695 | 3300035410 | Bacteria | 5280 |
| 266 | Ga0373924_0036914 | 3300035410 | Bacteria | 1987 |
| 267 | Ga0373924_0054206 | 3300035410 | Bacteria | 1667 |
| 268 | Ga0373935_0010906 | 3300035692 | Bacteria | 5457 |
| 269 | Ga0373935_0064729 | 3300035692 | Bacteria | 2345 |
| 270 | Ga0373935_0091565 | 3300035692 | Bacteria | 1991 |
| 271 | Ga0373935_0127961 | 3300035692 | Bacteria | 1704 |
| 272 | Ga0373935_0399079 | 3300035692 | Bacteria | 987 |
| 273 | Ga0373935_0882161 | 3300035692 | Bacteria | 662 |
| 274 | Ga0373927_0174237 | 3300035695 | Bacteria | 1411 |
| 275 | Ga0373933_0024047 | 3300035724 | Bacteria | 3487 |
| 276 | Ga0373933_0068363 | 3300035724 | Bacteria | 2157 |
| 277 | Ga0373933_0114417 | 3300035724 | Bacteria | 1685 |
| 278 | Ga0373933_0352000 | 3300035724 | Bacteria | 957 |
| 279 | Ga0373947_0037442 | 3300035725 | Bacteria | 2879 |
| 280 | Ga0373947_0089663 | 3300035725 | Bacteria | 1916 |
| 281 | Ga0373947_0221047 | 3300035725 | Bacteria | 1245 |
| 282 | Ga0373937_0051584 | 3300036401 | Bacteria | 3770 |
| 283 | Ga0373937_0122683 | 3300036401 | Bacteria | 2422 |
| 284 | Ga0373937_0245717 | 3300036401 | Bacteria | 1686 |
| 285 | Ga0373925_0004361 | 3300037068 | Bacteria | 10703 |
| 286 | Ga0373925_0041216 | 3300037068 | Bacteria | 3422 |
| 287 | Ga0373925_0047295 | 3300037068 | Bacteria | 3202 |
| 288 | Ga0373925_0057575 | 3300037068 | Bacteria | 2912 |
| 289 | Ga0373925_0116500 | 3300037068 | Bacteria | 2069 |
| 290 | Ga0373925_0141929 | 3300037068 | Bacteria | 1880 |
| 291 | Ga0395899_0128285 | 3300037312 | Bacteria | 1813 |
| 292 | Ga0395905_0095170 | 3300037471 | Bacteria | 2795 |
| 293 | Ga0436364_1136910 | 3300037853 | Bacteria | 7245 |
| 294 | Ga0395901_0259271 | 3300038443 | Bacteria | 1810 |
| 295 | Ga0237819_00736 | 3300038705 | Bacteria | 10536 |
| 296 | Ga0237816_01631 | 3300039145 | Bacteria | 1808 |
| 297 | Ga0436365_1911032 | 3300039437 | Bacteria | 3679 |
| 298 | Ga0436360_0378152 | 3300039438 | Bacteria | 1636 |
| 299 | Ga0436360_0759458 | 3300039438 | Bacteria | 896 |
| 300 | Ga0436361_0396482 | 3300039447 | Bacteria | 62548 |
| 301 | Ga0436361_0462475 | 3300039447 | Bacteria | 943 |
| 302 | Ga0436361_1053652 | 3300039447 | Bacteria | 1274 |
| 303 | Ga0436362_0406386 | 3300039453 | Bacteria | 1158 |
| 304 | Ga0450921_001570 | 3300042123 | Bacteria | 1403 |
| 305 | Ga0450888_026002 | 3300042126 | Bacteria | 767 |
| 306 | Ga0450896_004073 | 3300042133 | Bacteria | 1970 |
| 307 | Ga0439460_0076759 | 3300042461 | Bacteria | 1043 |
| 308 | Ga0466966_0052352 | 3300044684 | Bacteria | 2593 |
| 309 | Ga0466964_0002956 | 3300044706 | Bacteria | 6142 |
| 310 | Ga0466964_0129010 | 3300044706 | Bacteria | 1149 |
| 311 | Ga0466971_0043071 | 3300044719 | Bacteria | 2028 |
| 312 | Ga0466970_0004895 | 3300044765 | Bacteria | 6613 |
| 313 | Ga0466959_0007742 | 3300045049 | Bacteria | 7551 |
| 314 | Ga0466959_0199975 | 3300045049 | Bacteria | 1392 |
| 315 | Ga0466958_0128924 | 3300045836 | Bacteria | 1587 |
| 316 | Ga0495592_0019238 | 3300046454 | Bacteria | 5195 |
| 317 | Ga0495592_0105615 | 3300046454 | Bacteria | 2000 |
| 318 | Ga0495592_0180422 | 3300046454 | Bacteria | 1438 |
| 319 | Ga0495592_0303547 | 3300046454 | Bacteria | 1037 |
| 320 | Ga0495603_0010275 | 3300046455 | Bacteria | 5667 |
| 321 | Ga0495629_0014073 | 3300046459 | Bacteria | 5762 |
| 322 | Ga0495629_0024737 | 3300046459 | Bacteria | 4274 |
| 323 | Ga0495641_0005925 | 3300046461 | Bacteria | 8060 |
| 324 | Ga0495641_0012642 | 3300046461 | Bacteria | 4704 |
| 325 | Ga0495651_0002432 | 3300046462 | Bacteria | 14373 |
| 326 | Ga0495651_0006489 | 3300046462 | Bacteria | 8941 |
| 327 | Ga0495651_0094101 | 3300046462 | Bacteria | 2243 |
| 328 | Ga0495651_0203799 | 3300046462 | Bacteria | 1382 |
| 329 | Ga0495653_0011935 | 3300046463 | Bacteria | 7096 |
| 330 | Ga0495653_0037247 | 3300046463 | Bacteria | 3823 |
| 331 | Ga0495653_0054218 | 3300046463 | Bacteria | 3064 |
| 332 | Ga0495580_0000466 | 3300046472 | Bacteria | 33634 |
| 333 | Ga0495580_0010620 | 3300046472 | Bacteria | 7162 |
| 334 | Ga0495580_0013630 | 3300046472 | Bacteria | 6199 |
| 335 | Ga0495580_0088500 | 3300046472 | Bacteria | 2156 |
| 336 | Ga0495582_0031327 | 3300046473 | Bacteria | 2922 |
| 337 | Ga0495582_0032510 | 3300046473 | Bacteria | 2868 |
| 338 | Ga0495639_0024997 | 3300046475 | Bacteria | 2632 |
| 339 | Ga0495639_0112616 | 3300046475 | Bacteria | 1293 |
| 340 | Ga0495662_0004466 | 3300046476 | Bacteria | 7027 |
| 341 | Ga0495662_0096909 | 3300046476 | Bacteria | 1442 |
| 342 | Ga0495664_0037164 | 3300046477 | Bacteria | 2873 |
| 343 | Ga0495664_0091788 | 3300046477 | Bacteria | 1826 |
| 344 | Ga0495584_0000123 | 3300046491 | Bacteria | 53094 |
| 345 | Ga0495594_0070653 | 3300046499 | Bacteria | 1941 |
| 346 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 347 | Ga0495583_0010261 | 3300046506 | Bacteria | 5489 |
| 348 | Ga0495608_0021643 | 3300046511 | Bacteria | 4413 |
| 349 | Ga0495608_0366539 | 3300046511 | Bacteria | 885 |
| 350 | Ga0495618_0009994 | 3300046514 | Bacteria | 5742 |
| 351 | Ga0495618_0036147 | 3300046514 | Bacteria | 3099 |
| 352 | Ga0495618_0080052 | 3300046514 | Bacteria | 2084 |
| 353 | Ga0495618_0157720 | 3300046514 | Bacteria | 1448 |
| 354 | Ga0495628_0021991 | 3300046516 | Bacteria | 5241 |
| 355 | Ga0495628_0091744 | 3300046516 | Bacteria | 2350 |
| 356 | Ga0495628_0167940 | 3300046516 | Bacteria | 1664 |
| 357 | Ga0495632_0041897 | 3300046519 | Bacteria | 2298 |
| 358 | Ga0495632_0127306 | 3300046519 | Bacteria | 1187 |
| 359 | Ga0495666_0023474 | 3300046526 | Bacteria | 3050 |
| 360 | Ga0495652_0020718 | 3300046529 | Bacteria | 5844 |
| 361 | Ga0495652_0024394 | 3300046529 | Bacteria | 5354 |
| 362 | Ga0495652_0074090 | 3300046529 | Bacteria | 2832 |
| 363 | Ga0495652_0089967 | 3300046529 | Bacteria | 2512 |
| 364 | Ga0495652_0111707 | 3300046529 | Bacteria | 2197 |
| 365 | Ga0495654_0054862 | 3300046530 | Bacteria | 1931 |
| 366 | Ga0495665_0030582 | 3300046531 | Bacteria | 2882 |
| 367 | Ga0495665_0035048 | 3300046531 | Bacteria | 2682 |
| 368 | Ga0495640_0007859 | 3300046533 | Bacteria | 8385 |
| 369 | Ga0495640_0019425 | 3300046533 | Bacteria | 5015 |
| 370 | Ga0495586_0005623 | 3300046535 | Bacteria | 6705 |
| 371 | Ga0495587_0019019 | 3300046536 | Bacteria | 4256 |
| 372 | Ga0495587_0028904 | 3300046536 | Bacteria | 3368 |
| 373 | Ga0495587_0082196 | 3300046536 | Bacteria | 1866 |
| 374 | Ga0495645_0040635 | 3300046543 | Bacteria | 3392 |
| 375 | Ga0495645_0057719 | 3300046543 | Bacteria | 2816 |
| 376 | Ga0495645_0094115 | 3300046543 | Bacteria | 2138 |
| 377 | Ga0495645_0168058 | 3300046543 | Bacteria | 1511 |
| 378 | Ga0495667_0004159 | 3300046559 | Bacteria | 9737 |
| 379 | Ga0495667_0033874 | 3300046559 | Bacteria | 3416 |
| 380 | Ga0495667_0069433 | 3300046559 | Bacteria | 2299 |
| 381 | Ga0495634_0035105 | 3300046642 | Bacteria | 3436 |
| 382 | Ga0495634_0041028 | 3300046642 | Bacteria | 3144 |
| 383 | Ga0495634_0242617 | 3300046642 | Bacteria | 1105 |
| 384 | Ga0495625_0014779 | 3300046660 | Bacteria | 6214 |
| 385 | Ga0495625_0389097 | 3300046660 | Bacteria | 873 |
| 386 | Ga0495635_0033862 | 3300046663 | Bacteria | 3543 |
| 387 | Ga0495635_0075050 | 3300046663 | Bacteria | 2316 |
| 388 | Ga0495635_0311593 | 3300046663 | Bacteria | 1054 |
| 389 | Ga0495659_0000018 | 3300046664 | Bacteria | 75257 |
| 390 | Ga0495657_0002561 | 3300046675 | Bacteria | 15252 |
| 391 | Ga0495657_0019678 | 3300046675 | Bacteria | 4866 |
| 392 | Ga0495599_0000339 | 3300046678 | Bacteria | 27900 |
| 393 | Ga0495599_0023458 | 3300046678 | Bacteria | 3858 |
| 394 | Ga0495599_0033301 | 3300046678 | Bacteria | 3237 |
| 395 | Ga0495599_0037988 | 3300046678 | Bacteria | 3025 |
| 396 | Ga0495623_0006086 | 3300046679 | Bacteria | 7849 |
| 397 | Ga0495646_0009125 | 3300046680 | Bacteria | 6290 |
| 398 | Ga0495646_0032449 | 3300046680 | Bacteria | 3249 |
| 399 | Ga0495647_0063609 | 3300046681 | Bacteria | 1461 |
| 400 | Ga0495658_0096247 | 3300046683 | Bacteria | 1760 |
| 401 | Ga0495613_0150327 | 3300046689 | Bacteria | 1661 |
| 402 | Ga0495613_0259071 | 3300046689 | Bacteria | 1212 |
| 403 | Ga0495624_0365702 | 3300046690 | Bacteria | 867 |
| 404 | Ga0495600_0012485 | 3300046809 | Bacteria | 5314 |
| 405 | Ga0495600_0047031 | 3300046809 | Bacteria | 2814 |
| 406 | Ga0495600_0053582 | 3300046809 | Bacteria | 2634 |
| 407 | Ga0495581_0010613 | 3300047315 | Bacteria | 5324 |
| 408 | Ga0495581_0040771 | 3300047315 | Bacteria | 2686 |
| 409 | Ga0495604_0011445 | 3300047317 | Bacteria | 7044 |
| 410 | Ga0495604_0212948 | 3300047317 | Bacteria | 1334 |
| 411 | Ga0495636_0023832 | 3300047318 | Bacteria | 2480 |
| 412 | Ga0495674_0003706 | 3300047319 | Bacteria | 14855 |
| 413 | Ga0495674_0027907 | 3300047319 | Bacteria | 5154 |
| 414 | Ga0495674_0028392 | 3300047319 | Bacteria | 5101 |
| 415 | Ga0495674_0072393 | 3300047319 | Bacteria | 2973 |
| 416 | Ga0495674_0124956 | 3300047319 | Bacteria | 2171 |
| 417 | Ga0495674_0125656 | 3300047319 | Bacteria | 2164 |
| 418 | Ga0495674_0225654 | 3300047319 | Bacteria | 1547 |
| 419 | Ga0495674_0254599 | 3300047319 | Bacteria | 1444 |
| 420 | Ga0495672_0001818 | 3300047320 | Bacteria | 20410 |
| 421 | Ga0495676_0279025 | 3300047321 | Bacteria | 1132 |
| 422 | Ga0495680_0024972 | 3300047322 | Bacteria | 4948 |
| 423 | Ga0495680_0062940 | 3300047322 | Bacteria | 2850 |
| 424 | Ga0495680_0084987 | 3300047322 | Bacteria | 2383 |
| 425 | Ga0495675_0004535 | 3300047444 | Bacteria | 8421 |
| 426 | Ga0495675_0072155 | 3300047444 | Bacteria | 2178 |
| 427 | Ga0495677_0001834 | 3300047445 | Bacteria | 8490 |
| 428 | Ga0495685_090606 | 3300047447 | Bacteria | 1014 |
| 429 | Ga0495684_0018892 | 3300047471 | Bacteria | 5307 |
| 430 | Ga0495684_0129385 | 3300047471 | Bacteria | 1897 |
| 431 | Ga0495593_0014131 | 3300047673 | Bacteria | 4542 |
| 432 | Ga0495593_0154353 | 3300047673 | Bacteria | 1160 |
| 433 | Ga0495602_0045686 | 3300048088 | Bacteria | 3961 |
| 434 | Ga0495602_0095644 | 3300048088 | Bacteria | 2451 |
| 435 | Ga0495602_0114727 | 3300048088 | Bacteria | 2180 |
| 436 | Ga0495602_0139325 | 3300048088 | Bacteria | 1922 |
| 437 | Ga0495602_0204393 | 3300048088 | Bacteria | 1504 |
| 438 | Ga0495614_0019312 | 3300048089 | Bacteria | 2949 |
| 439 | Ga0496102_0001045 | 3300048905 | Bacteria | 25687 |
| 440 | Ga0496102_0232959 | 3300048905 | Bacteria | 1736 |
| 441 | Ga0496103_0031374 | 3300048906 | Bacteria | 3237 |
| 442 | Ga0496103_0106743 | 3300048906 | Bacteria | 1776 |
| 443 | Ga0496104_0124650 | 3300048907 | Bacteria | 2473 |
| 444 | Ga0496104_0134162 | 3300048907 | Bacteria | 2378 |
| 445 | Ga0496105_0063025 | 3300048908 | Bacteria | 3059 |
| 446 | Ga0496105_0195308 | 3300048908 | Bacteria | 1653 |
| 447 | Ga0496106_0010983 | 3300048909 | Bacteria | 6696 |
| 448 | Ga0496107_0354570 | 3300048910 | Bacteria | 1092 |
| 449 | Ga0496108_0000041 | 3300048911 | Bacteria | 147365 |
| 450 | Ga0496108_0011457 | 3300048911 | Bacteria | 7206 |
| 451 | Ga0496108_0039840 | 3300048911 | Bacteria | 3916 |
| 452 | Ga0496109_0110971 | 3300048912 | Bacteria | 2550 |
| 453 | Ga0496110_0005954 | 3300048913 | Bacteria | 9598 |
| 454 | Ga0496110_0149363 | 3300048913 | Bacteria | 2115 |
| 455 | Ga0496111_0001142 | 3300048914 | Bacteria | 14731 |
| 456 | Ga0496111_0304933 | 3300048914 | Bacteria | 1180 |
| 457 | Ga0496112_0076949 | 3300048915 | Bacteria | 3299 |
| 458 | Ga0496112_0102515 | 3300048915 | Bacteria | 2832 |
| 459 | Ga0496113_0215194 | 3300048916 | Bacteria | 1530 |
| 460 | Ga0496114_0013956 | 3300048917 | Bacteria | 6440 |
| 461 | Ga0496115_0017554 | 3300048918 | Bacteria | 5474 |
| 462 | Ga0496115_0102903 | 3300048918 | Bacteria | 2342 |
| 463 | Ga0496116_0018495 | 3300048919 | Bacteria | 5370 |
| 464 | Ga0496118_0172876 | 3300048921 | Bacteria | 1317 |
| 465 | Ga0501032_0407499 | 3300049569 | Bacteria | 873 |
| 466 | Ga0501034_0000384 | 3300049571 | Bacteria | 75553 |
| 467 | Ga0501034_0002846 | 3300049571 | Bacteria | 20161 |
| 468 | Ga0501034_0031029 | 3300049571 | Bacteria | 5431 |
| 469 | Ga0501034_0338009 | 3300049571 | Bacteria | 1436 |
| 470 | Ga0501037_0074843 | 3300049573 | Bacteria | 2460 |
| 471 | Ga0501041_0059241 | 3300049577 | Bacteria | 2344 |
| 472 | Ga0501042_0038790 | 3300049578 | Bacteria | 3383 |
| 473 | Ga0501046_0477807 | 3300049580 | Bacteria | 894 |
| 474 | Ga0501070_0388550 | 3300049586 | Bacteria | 1130 |
| 475 | Ga0501077_0137132 | 3300049593 | Bacteria | 1552 |
| 476 | Ga0501079_0256361 | 3300049741 | Bacteria | 1367 |
| 477 | Ga0501080_0067236 | 3300049742 | Bacteria | 3333 |
| 478 | Ga0501080_0210325 | 3300049742 | Bacteria | 1782 |
| 479 | Ga0501044_0738867 | 3300049823 | Bacteria | 867 |
| 480 | nmdc:mga05p37_206467_c1 | 3300050507 | Bacteria | 2376 |
| 481 | nmdc:mga09592_368950_c1 | 3300050508 | Bacteria | 1242 |
| 482 | nmdc:mga0qj67_115310_c1 | 3300050509 | Bacteria | 2171 |
| 483 | nmdc:mga0qj67_163198_c1 | 3300050509 | Bacteria | 1809 |
| 484 | nmdc:mga06r32_213884_c1 | 3300050510 | Bacteria | 1916 |
| 485 | nmdc:mga06r32_24666_c1 | 3300050510 | Bacteria | 5585 |
| 486 | nmdc:mga06r32_300369_c1 | 3300050510 | Bacteria | 1592 |
| 487 | nmdc:mga0rr50_250959_c1 | 3300050513 | Bacteria | 1469 |
| 488 | nmdc:mga0rr50_643011_c1 | 3300050513 | Bacteria | 905 |
| 489 | nmdc:mga08x19_420230_c1 | 3300050514 | Bacteria | 939 |
| 490 | Ga0495601_0129418 | 3300053077 | Bacteria | 1643 |
| 491 | Ga0495601_0415158 | 3300053077 | Bacteria | 872 |
| 492 | Ga0495612_0048938 | 3300053078 | Bacteria | 1733 |
| 493 | Ga0495612_0204404 | 3300053078 | Bacteria | 872 |
| 494 | Ga0495595_0004380 | 3300053084 | Bacteria | 5684 |
| 495 | Ga0495595_0015816 | 3300053084 | Bacteria | 3221 |
| 496 | Ga0495595_0028251 | 3300053084 | Bacteria | 2505 |
| 497 | Ga0495619_0007613 | 3300053085 | Bacteria | 6855 |
| 498 | Ga0495619_0019574 | 3300053085 | Bacteria | 4304 |
| 499 | Ga0495619_0213226 | 3300053085 | Bacteria | 1337 |
| 500 | Ga0500643_061832 | 3300053087 | Bacteria | 1050 |
| 501 | Ga0500644_0111311 | 3300053088 | Bacteria | 1055 |
| 502 | Ga0500647_0068181 | 3300053091 | Bacteria | 1711 |
| 503 | Ga0500592_009215 | 3300053116 | Bacteria | 1568 |
| 504 | Ga0500594_0029574 | 3300053118 | Bacteria | 1433 |
| 505 | Ga0500595_003020 | 3300053119 | Bacteria | 8009 |
| 506 | Ga0500588_0033469 | 3300053146 | Bacteria | 1499 |
| 507 | Ga0500627_0000002 | 3300053158 | Bacteria | 235747 |
| 508 | Ga0500630_135409 | 3300053159 | Bacteria | 1069 |
| 509 | Ga0500596_000031 | 3300053735 | Bacteria | 19217 |
| 510 | Ga0466962_0012086 | 3300061719 | Bacteria | 4151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0882161 | Ga0373935_0882161_41_649 | 202 |
| 2 | 3300042126 | Ga0450888_026002 | Ga0450888_026002_11_646 | 211 |
| 3 | 3300049742 | Ga0501080_0210325 | Ga0501080_0210325_101_736 | 211 |
| 4 | 3300005347 | Ga0070668_100002771 | Ga0070668_10000277112 | 216 |
| 5 | 3300025972 | Ga0207668_10010415 | Ga0207668_100104153 | 216 |
| 6 | 3300050514 | nmdc:mga08x19_420230_c1 | nmdc:mga08x19_420230_c1_27_713 | 226 |
| 7 | 3300044684 | Ga0466966_0052352 | Ga0466966_0052352_1124_1876 | 229 |
| 8 | 3300044706 | Ga0466964_0002956 | Ga0466964_0002956_3559_4311 | 229 |
| 9 | 3300044719 | Ga0466971_0043071 | Ga0466971_0043071_856_1608 | 229 |
| 10 | 3300044765 | Ga0466970_0004895 | Ga0466970_0004895_585_1337 | 229 |
| 11 | 3300045049 | Ga0466959_0007742 | Ga0466959_0007742_5085_5837 | 229 |
| 12 | 3300061719 | Ga0466962_0012086 | Ga0466962_0012086_1500_2252 | 229 |
| 13 | 3300003758 | Ga0055532_1001930 | Ga0055532_10019302 | 232 |
| 14 | 3300003760 | Ga0055527_1000103 | Ga0055527_100010314 | 232 |
| 15 | 3300003761 | Ga0055535_1000209 | Ga0055535_100020914 | 232 |
| 16 | 3300003762 | Ga0055542_1001293 | Ga0055542_10012938 | 232 |
| 17 | 3300025228 | Ga0209672_100062 | Ga0209672_10006292 | 232 |
| 18 | 3300025229 | Ga0209147_100078 | Ga0209147_10007892 | 232 |
| 19 | 3300025242 | Ga0209258_100108 | Ga0209258_10010892 | 232 |
| 20 | 3300025272 | Ga0209455_1000251 | Ga0209455_100025149 | 232 |
| 21 | 3300028558 | Ga0265326_10041604 | Ga0265326_100416042 | 233 |
| 22 | 3300031251 | Ga0265327_10000104 | Ga0265327_10000104145 | 233 |
| 23 | 3300039447 | Ga0436361_1053652 | Ga0436361_1053652_465_1244 | 235 |
| 24 | 3300033179 | Ga0307507_10108957 | Ga0307507_101089573 | 236 |
| 25 | 3300049569 | Ga0501032_0407499 | Ga0501032_0407499_68_823 | 236 |
| 26 | 3300005435 | Ga0070714_100625640 | Ga0070714_1006256401 | 237 |
| 27 | 3300047319 | Ga0495674_0072393 | Ga0495674_0072393_1975_2790 | 237 |
| 28 | 3300045049 | Ga0466959_0199975 | Ga0466959_0199975_290_1039 | 239 |
| 29 | iso_pu_bacteria | 2751185782 | 2753265819 | 239 |
| 30 | iso_pu_bacteria | 2870782633 | 2870787860 | 239 |
| 31 | 3300005468 | Ga0070707_100049989 | Ga0070707_1000499892 | 241 |
| 32 | 3300028786 | Ga0307517_10204258 | Ga0307517_102042582 | 241 |
| 33 | iso_pu_bacteria | 8047710418 | 8047715962 | 241 |
| 34 | 3300006175 | Ga0070712_100355791 | Ga0070712_1003557912 | 242 |
| 35 | 3300035117 | Ga0373953_0035103 | Ga0373953_0035103_56_796 | 242 |
| 36 | 3300035724 | Ga0373933_0024047 | Ga0373933_0024047_58_798 | 242 |
| 37 | 3300036401 | Ga0373937_0122683 | Ga0373937_0122683_899_1639 | 242 |
| 38 | 3300037068 | Ga0373925_0004361 | Ga0373925_0004361_2628_3368 | 242 |
| 39 | 3300037068 | Ga0373925_0116500 | Ga0373925_0116500_1162_1902 | 242 |
| 40 | 3300037853 | Ga0436364_1136910 | Ga0436364_1136910_5862_6602 | 242 |
| 41 | 3300046454 | Ga0495592_0105615 | Ga0495592_0105615_116_856 | 242 |
| 42 | 3300046462 | Ga0495651_0002432 | Ga0495651_0002432_8017_8757 | 242 |
| 43 | 3300046463 | Ga0495653_0011935 | Ga0495653_0011935_4078_4818 | 242 |
| 44 | 3300046477 | Ga0495664_0091788 | Ga0495664_0091788_273_1013 | 242 |
| 45 | 3300046514 | Ga0495618_0009994 | Ga0495618_0009994_1191_1931 | 242 |
| 46 | 3300046516 | Ga0495628_0167940 | Ga0495628_0167940_177_917 | 242 |
| 47 | 3300046529 | Ga0495652_0020718 | Ga0495652_0020718_3961_4701 | 242 |
| 48 | 3300046533 | Ga0495640_0019425 | Ga0495640_0019425_3983_4723 | 242 |
| 49 | 3300046536 | Ga0495587_0019019 | Ga0495587_0019019_3139_3879 | 242 |
| 50 | 3300046559 | Ga0495667_0004159 | Ga0495667_0004159_7732_8472 | 242 |
| 51 | 3300046663 | Ga0495635_0075050 | Ga0495635_0075050_510_1250 | 242 |
| 52 | 3300046675 | Ga0495657_0002561 | Ga0495657_0002561_4602_5342 | 242 |
| 53 | 3300046678 | Ga0495599_0037988 | Ga0495599_0037988_11_751 | 242 |
| 54 | 3300046680 | Ga0495646_0032449 | Ga0495646_0032449_201_941 | 242 |
| 55 | 3300046809 | Ga0495600_0047031 | Ga0495600_0047031_1612_2352 | 242 |
| 56 | 3300047319 | Ga0495674_0003706 | Ga0495674_0003706_5453_6193 | 242 |
| 57 | 3300047322 | Ga0495680_0084987 | Ga0495680_0084987_748_1488 | 242 |
| 58 | 3300047471 | Ga0495684_0129385 | Ga0495684_0129385_236_976 | 242 |
| 59 | 3300048088 | Ga0495602_0045686 | Ga0495602_0045686_1483_2223 | 242 |
| 60 | 3300053084 | Ga0495595_0028251 | Ga0495595_0028251_973_1713 | 242 |
| 61 | iso_pu_bacteria | 2744054611 | 2744953630 | 242 |
| 62 | 3300005331 | Ga0070670_100218700 | Ga0070670_1002187002 | 243 |
| 63 | 3300005338 | Ga0068868_100704217 | Ga0068868_1007042171 | 243 |
| 64 | 3300005347 | Ga0070668_100250604 | Ga0070668_1002506042 | 243 |
| 65 | 3300005367 | Ga0070667_100616896 | Ga0070667_1006168961 | 243 |
| 66 | 3300005434 | Ga0070709_10104308 | Ga0070709_101043081 | 243 |
| 67 | 3300005539 | Ga0068853_100421945 | Ga0068853_1004219452 | 243 |
| 68 | 3300005841 | Ga0068863_100553946 | Ga0068863_1005539462 | 243 |
| 69 | 3300005842 | Ga0068858_100023429 | Ga0068858_1000234298 | 243 |
| 70 | 3300005843 | Ga0068860_100028090 | Ga0068860_1000280903 | 243 |
| 71 | 3300005983 | Ga0081540_1055828 | Ga0081540_10558282 | 243 |
| 72 | 3300006028 | Ga0070717_10092180 | Ga0070717_100921802 | 243 |
| 73 | 3300009098 | Ga0105245_10829488 | Ga0105245_108294882 | 243 |
| 74 | 3300009147 | Ga0114129_10307472 | Ga0114129_103074722 | 243 |
| 75 | 3300013297 | Ga0157378_10222067 | Ga0157378_102220672 | 243 |
| 76 | 3300025942 | Ga0207689_10401220 | Ga0207689_104012202 | 243 |
| 77 | 3300025944 | Ga0207661_10262523 | Ga0207661_102625232 | 243 |
| 78 | 3300025972 | Ga0207668_10179523 | Ga0207668_101795232 | 243 |
| 79 | 3300025986 | Ga0207658_10127346 | Ga0207658_101273463 | 243 |
| 80 | 3300026095 | Ga0207676_10217654 | Ga0207676_102176542 | 243 |
| 81 | 3300028786 | Ga0307517_10083105 | Ga0307517_100831053 | 243 |
| 82 | 3300028794 | Ga0307515_10008714 | Ga0307515_1000871415 | 243 |
| 83 | 3300028794 | Ga0307515_10043536 | Ga0307515_100435364 | 243 |
| 84 | 3300030522 | Ga0307512_10026940 | Ga0307512_100269402 | 243 |
| 85 | 3300031456 | Ga0307513_10010075 | Ga0307513_100100754 | 243 |
| 86 | 3300031456 | Ga0307513_10211154 | Ga0307513_102111542 | 243 |
| 87 | 3300031456 | Ga0307513_10258916 | Ga0307513_102589162 | 243 |
| 88 | 3300031507 | Ga0307509_10007990 | Ga0307509_100079904 | 243 |
| 89 | 3300031616 | Ga0307508_10002491 | Ga0307508_1000249116 | 243 |
| 90 | 3300031616 | Ga0307508_10044916 | Ga0307508_100449162 | 243 |
| 91 | 3300031730 | Ga0307516_10001391 | Ga0307516_1000139124 | 243 |
| 92 | 3300031730 | Ga0307516_10145394 | Ga0307516_101453942 | 243 |
| 93 | 3300031733 | Ga0316577_10158188 | Ga0316577_101581882 | 243 |
| 94 | 3300031901 | Ga0307406_10071387 | Ga0307406_100713872 | 243 |
| 95 | 3300031995 | Ga0307409_100245995 | Ga0307409_1002459951 | 243 |
| 96 | 3300032002 | Ga0307416_100262272 | Ga0307416_1002622722 | 243 |
| 97 | 3300035398 | Ga0316574_0047710 | Ga0316574_0047710_465_1220 | 243 |
| 98 | 3300035692 | Ga0373935_0010906 | Ga0373935_0010906_3267_4004 | 243 |
| 99 | 3300045836 | Ga0466958_0128924 | Ga0466958_0128924_432_1259 | 243 |
| 100 | 3300046519 | Ga0495632_0041897 | Ga0495632_0041897_1395_2135 | 243 |
| 101 | 3300046519 | Ga0495632_0127306 | Ga0495632_0127306_202_939 | 243 |
| 102 | 3300048911 | Ga0496108_0000041 | Ga0496108_0000041_85631_86368 | 243 |
| 103 | 3300050513 | nmdc:mga0rr50_250959_c1 | nmdc:mga0rr50_250959_c1_685_1425 | 243 |
| 104 | 3300053118 | Ga0500594_0029574 | Ga0500594_0029574_278_1018 | 243 |
| 105 | 3300053159 | Ga0500630_135409 | Ga0500630_135409_99_839 | 243 |
| 106 | 3300005338 | Ga0068868_100122815 | Ga0068868_1001228152 | 244 |
| 107 | 3300005434 | Ga0070709_10032498 | Ga0070709_100324983 | 244 |
| 108 | 3300005435 | Ga0070714_100043027 | Ga0070714_1000430272 | 244 |
| 109 | 3300005435 | Ga0070714_100073810 | Ga0070714_1000738102 | 244 |
| 110 | 3300005435 | Ga0070714_100611116 | Ga0070714_1006111161 | 244 |
| 111 | 3300005436 | Ga0070713_100028818 | Ga0070713_1000288183 | 244 |
| 112 | 3300005436 | Ga0070713_100161365 | Ga0070713_1001613652 | 244 |
| 113 | 3300005436 | Ga0070713_100461444 | Ga0070713_1004614442 | 244 |
| 114 | 3300005437 | Ga0070710_10011934 | Ga0070710_100119343 | 244 |
| 115 | 3300005437 | Ga0070710_10025429 | Ga0070710_100254292 | 244 |
| 116 | 3300005547 | Ga0070693_100379360 | Ga0070693_1003793601 | 244 |
| 117 | 3300005618 | Ga0068864_100598144 | Ga0068864_1005981441 | 244 |
| 118 | 3300005842 | Ga0068858_100031738 | Ga0068858_1000317385 | 244 |
| 119 | 3300006028 | Ga0070717_10263813 | Ga0070717_102638132 | 244 |
| 120 | 3300006173 | Ga0070716_100249191 | Ga0070716_1002491912 | 244 |
| 121 | 3300006175 | Ga0070712_100106467 | Ga0070712_1001064672 | 244 |
| 122 | 3300006175 | Ga0070712_100130813 | Ga0070712_1001308132 | 244 |
| 123 | 3300006175 | Ga0070712_100169996 | Ga0070712_1001699962 | 244 |
| 124 | 3300007076 | Ga0075435_100367433 | Ga0075435_1003674332 | 244 |
| 125 | 3300009545 | Ga0105237_10305317 | Ga0105237_103053172 | 244 |
| 126 | 3300009551 | Ga0105238_10319956 | Ga0105238_103199562 | 244 |
| 127 | 3300013105 | Ga0157369_10262634 | Ga0157369_102626342 | 244 |
| 128 | 3300013307 | Ga0157372_10880232 | Ga0157372_108802322 | 244 |
| 129 | 3300014325 | Ga0163163_10330570 | Ga0163163_103305703 | 244 |
| 130 | 3300014969 | Ga0157376_10040783 | Ga0157376_100407833 | 244 |
| 131 | 3300025898 | Ga0207692_10062971 | Ga0207692_100629712 | 244 |
| 132 | 3300025898 | Ga0207692_10094059 | Ga0207692_100940592 | 244 |
| 133 | 3300025915 | Ga0207693_10216382 | Ga0207693_102163821 | 244 |
| 134 | 3300025929 | Ga0207664_10043733 | Ga0207664_100437332 | 244 |
| 135 | 3300025929 | Ga0207664_10674177 | Ga0207664_106741771 | 244 |
| 136 | 3300025939 | Ga0207665_10259126 | Ga0207665_102591262 | 244 |
| 137 | 3300026035 | Ga0207703_10157464 | Ga0207703_101574641 | 244 |
| 138 | 3300026078 | Ga0207702_10047109 | Ga0207702_100471093 | 244 |
| 139 | 3300026078 | Ga0207702_10076903 | Ga0207702_100769034 | 244 |
| 140 | 3300026078 | Ga0207702_10304279 | Ga0207702_103042792 | 244 |
| 141 | 3300026095 | Ga0207676_10251514 | Ga0207676_102515142 | 244 |
| 142 | 3300026116 | Ga0207674_10166233 | Ga0207674_101662333 | 244 |
| 143 | 3300034957 | Ga0373938_0033606 | Ga0373938_0033606_312_1052 | 244 |
| 144 | 3300035083 | Ga0373926_0012938 | Ga0373926_0012938_691_1434 | 244 |
| 145 | 3300035111 | Ga0373923_0000147 | Ga0373923_0000147_6363_7106 | 244 |
| 146 | 3300035113 | Ga0373936_0005085 | Ga0373936_0005085_313_1056 | 244 |
| 147 | 3300035113 | Ga0373936_0090465 | Ga0373936_0090465_356_1120 | 244 |
| 148 | 3300035115 | Ga0373941_0000662 | Ga0373941_0000662_1285_2025 | 244 |
| 149 | 3300035116 | Ga0373945_0028187 | Ga0373945_0028187_131_874 | 244 |
| 150 | 3300035117 | Ga0373953_0059453 | Ga0373953_0059453_180_923 | 244 |
| 151 | 3300035119 | Ga0373956_0004840 | Ga0373956_0004840_4245_4988 | 244 |
| 152 | 3300035119 | Ga0373956_0112148 | Ga0373956_0112148_441_1184 | 244 |
| 153 | 3300035120 | Ga0373957_0060838 | Ga0373957_0060838_127_891 | 244 |
| 154 | 3300035170 | Ga0373943_0128234 | Ga0373943_0128234_135_878 | 244 |
| 155 | 3300035172 | Ga0373955_0019966 | Ga0373955_0019966_1851_2594 | 244 |
| 156 | 3300035172 | Ga0373955_0129442 | Ga0373955_0129442_36_779 | 244 |
| 157 | 3300035207 | Ga0373942_0000794 | Ga0373942_0000794_4146_4886 | 244 |
| 158 | 3300035242 | Ga0373962_0004406 | Ga0373962_0004406_465_1205 | 244 |
| 159 | 3300035410 | Ga0373924_0003695 | Ga0373924_0003695_2723_3466 | 244 |
| 160 | 3300035410 | Ga0373924_0036914 | Ga0373924_0036914_48_791 | 244 |
| 161 | 3300035692 | Ga0373935_0091565 | Ga0373935_0091565_180_923 | 244 |
| 162 | 3300035692 | Ga0373935_0399079 | Ga0373935_0399079_220_963 | 244 |
| 163 | 3300035695 | Ga0373927_0174237 | Ga0373927_0174237_290_1036 | 244 |
| 164 | 3300035724 | Ga0373933_0068363 | Ga0373933_0068363_1389_2132 | 244 |
| 165 | 3300035724 | Ga0373933_0114417 | Ga0373933_0114417_120_863 | 244 |
| 166 | 3300035725 | Ga0373947_0037442 | Ga0373947_0037442_1985_2728 | 244 |
| 167 | 3300035725 | Ga0373947_0089663 | Ga0373947_0089663_179_922 | 244 |
| 168 | 3300035725 | Ga0373947_0221047 | Ga0373947_0221047_217_960 | 244 |
| 169 | 3300036401 | Ga0373937_0245717 | Ga0373937_0245717_36_779 | 244 |
| 170 | 3300037068 | Ga0373925_0047295 | Ga0373925_0047295_2074_2817 | 244 |
| 171 | 3300037068 | Ga0373925_0057575 | Ga0373925_0057575_1001_1744 | 244 |
| 172 | 3300037068 | Ga0373925_0141929 | Ga0373925_0141929_1005_1748 | 244 |
| 173 | 3300039453 | Ga0436362_0406386 | Ga0436362_0406386_157_903 | 244 |
| 174 | 3300042123 | Ga0450921_001570 | Ga0450921_001570_371_1105 | 244 |
| 175 | 3300046454 | Ga0495592_0019238 | Ga0495592_0019238_4195_4938 | 244 |
| 176 | 3300046454 | Ga0495592_0180422 | Ga0495592_0180422_558_1301 | 244 |
| 177 | 3300046455 | Ga0495603_0010275 | Ga0495603_0010275_2925_3668 | 244 |
| 178 | 3300046459 | Ga0495629_0014073 | Ga0495629_0014073_4407_5150 | 244 |
| 179 | 3300046461 | Ga0495641_0005925 | Ga0495641_0005925_6804_7547 | 244 |
| 180 | 3300046461 | Ga0495641_0012642 | Ga0495641_0012642_999_1742 | 244 |
| 181 | 3300046462 | Ga0495651_0006489 | Ga0495651_0006489_6798_7541 | 244 |
| 182 | 3300046462 | Ga0495651_0203799 | Ga0495651_0203799_179_922 | 244 |
| 183 | 3300046463 | Ga0495653_0037247 | Ga0495653_0037247_2844_3587 | 244 |
| 184 | 3300046463 | Ga0495653_0054218 | Ga0495653_0054218_216_959 | 244 |
| 185 | 3300046472 | Ga0495580_0088500 | Ga0495580_0088500_505_1248 | 244 |
| 186 | 3300046473 | Ga0495582_0031327 | Ga0495582_0031327_1228_1971 | 244 |
| 187 | 3300046473 | Ga0495582_0032510 | Ga0495582_0032510_706_1449 | 244 |
| 188 | 3300046475 | Ga0495639_0024997 | Ga0495639_0024997_1355_2098 | 244 |
| 189 | 3300046475 | Ga0495639_0112616 | Ga0495639_0112616_14_760 | 244 |
| 190 | 3300046476 | Ga0495662_0004466 | Ga0495662_0004466_1354_2097 | 244 |
| 191 | 3300046477 | Ga0495664_0037164 | Ga0495664_0037164_79_822 | 244 |
| 192 | 3300046499 | Ga0495594_0070653 | Ga0495594_0070653_1059_1802 | 244 |
| 193 | 3300046511 | Ga0495608_0021643 | Ga0495608_0021643_2254_2997 | 244 |
| 194 | 3300046511 | Ga0495608_0366539 | Ga0495608_0366539_23_766 | 244 |
| 195 | 3300046514 | Ga0495618_0036147 | Ga0495618_0036147_242_985 | 244 |
| 196 | 3300046514 | Ga0495618_0080052 | Ga0495618_0080052_1052_1795 | 244 |
| 197 | 3300046516 | Ga0495628_0021991 | Ga0495628_0021991_258_1001 | 244 |
| 198 | 3300046516 | Ga0495628_0091744 | Ga0495628_0091744_1042_1785 | 244 |
| 199 | 3300046526 | Ga0495666_0023474 | Ga0495666_0023474_957_1700 | 244 |
| 200 | 3300046529 | Ga0495652_0024394 | Ga0495652_0024394_3352_4095 | 244 |
| 201 | 3300046529 | Ga0495652_0074090 | Ga0495652_0074090_34_777 | 244 |
| 202 | 3300046529 | Ga0495652_0089967 | Ga0495652_0089967_150_893 | 244 |
| 203 | 3300046529 | Ga0495652_0111707 | Ga0495652_0111707_628_1374 | 244 |
| 204 | 3300046531 | Ga0495665_0030582 | Ga0495665_0030582_1255_1998 | 244 |
| 205 | 3300046531 | Ga0495665_0035048 | Ga0495665_0035048_901_1644 | 244 |
| 206 | 3300046533 | Ga0495640_0007859 | Ga0495640_0007859_5407_6150 | 244 |
| 207 | 3300046535 | Ga0495586_0005623 | Ga0495586_0005623_4921_5664 | 244 |
| 208 | 3300046536 | Ga0495587_0028904 | Ga0495587_0028904_1105_1848 | 244 |
| 209 | 3300046536 | Ga0495587_0082196 | Ga0495587_0082196_1088_1831 | 244 |
| 210 | 3300046543 | Ga0495645_0040635 | Ga0495645_0040635_2052_2795 | 244 |
| 211 | 3300046543 | Ga0495645_0057719 | Ga0495645_0057719_1042_1785 | 244 |
| 212 | 3300046543 | Ga0495645_0168058 | Ga0495645_0168058_526_1272 | 244 |
| 213 | 3300046559 | Ga0495667_0033874 | Ga0495667_0033874_236_979 | 244 |
| 214 | 3300046559 | Ga0495667_0069433 | Ga0495667_0069433_33_776 | 244 |
| 215 | 3300046642 | Ga0495634_0041028 | Ga0495634_0041028_1356_2099 | 244 |
| 216 | 3300046642 | Ga0495634_0242617 | Ga0495634_0242617_280_1023 | 244 |
| 217 | 3300046663 | Ga0495635_0033862 | Ga0495635_0033862_1999_2742 | 244 |
| 218 | 3300046663 | Ga0495635_0311593 | Ga0495635_0311593_131_874 | 244 |
| 219 | 3300046675 | Ga0495657_0019678 | Ga0495657_0019678_2116_2859 | 244 |
| 220 | 3300046678 | Ga0495599_0023458 | Ga0495599_0023458_2558_3301 | 244 |
| 221 | 3300046678 | Ga0495599_0033301 | Ga0495599_0033301_2265_3008 | 244 |
| 222 | 3300046680 | Ga0495646_0009125 | Ga0495646_0009125_1340_2083 | 244 |
| 223 | 3300046681 | Ga0495647_0063609 | Ga0495647_0063609_91_834 | 244 |
| 224 | 3300046683 | Ga0495658_0096247 | Ga0495658_0096247_312_1055 | 244 |
| 225 | 3300046689 | Ga0495613_0150327 | Ga0495613_0150327_517_1260 | 244 |
| 226 | 3300046689 | Ga0495613_0259071 | Ga0495613_0259071_209_952 | 244 |
| 227 | 3300046690 | Ga0495624_0365702 | Ga0495624_0365702_13_756 | 244 |
| 228 | 3300046809 | Ga0495600_0012485 | Ga0495600_0012485_1253_1996 | 244 |
| 229 | 3300046809 | Ga0495600_0053582 | Ga0495600_0053582_536_1279 | 244 |
| 230 | 3300047315 | Ga0495581_0010613 | Ga0495581_0010613_3375_4118 | 244 |
| 231 | 3300047315 | Ga0495581_0040771 | Ga0495581_0040771_756_1499 | 244 |
| 232 | 3300047317 | Ga0495604_0011445 | Ga0495604_0011445_3322_4065 | 244 |
| 233 | 3300047317 | Ga0495604_0212948 | Ga0495604_0212948_325_1068 | 244 |
| 234 | 3300047319 | Ga0495674_0027907 | Ga0495674_0027907_2208_2951 | 244 |
| 235 | 3300047319 | Ga0495674_0124956 | Ga0495674_0124956_1026_1769 | 244 |
| 236 | 3300047319 | Ga0495674_0125656 | Ga0495674_0125656_206_949 | 244 |
| 237 | 3300047319 | Ga0495674_0225654 | Ga0495674_0225654_289_1035 | 244 |
| 238 | 3300047321 | Ga0495676_0279025 | Ga0495676_0279025_376_1119 | 244 |
| 239 | 3300047322 | Ga0495680_0024972 | Ga0495680_0024972_1188_1931 | 244 |
| 240 | 3300047322 | Ga0495680_0062940 | Ga0495680_0062940_258_1001 | 244 |
| 241 | 3300047444 | Ga0495675_0004535 | Ga0495675_0004535_1009_1752 | 244 |
| 242 | 3300047444 | Ga0495675_0072155 | Ga0495675_0072155_1241_1984 | 244 |
| 243 | 3300047471 | Ga0495684_0018892 | Ga0495684_0018892_257_1000 | 244 |
| 244 | 3300047673 | Ga0495593_0014131 | Ga0495593_0014131_2778_3521 | 244 |
| 245 | 3300047673 | Ga0495593_0154353 | Ga0495593_0154353_181_924 | 244 |
| 246 | 3300048088 | Ga0495602_0095644 | Ga0495602_0095644_381_1124 | 244 |
| 247 | 3300048088 | Ga0495602_0114727 | Ga0495602_0114727_902_1645 | 244 |
| 248 | 3300048088 | Ga0495602_0139325 | Ga0495602_0139325_38_781 | 244 |
| 249 | 3300048089 | Ga0495614_0019312 | Ga0495614_0019312_1858_2601 | 244 |
| 250 | 3300048905 | Ga0496102_0001045 | Ga0496102_0001045_18472_19218 | 244 |
| 251 | 3300048906 | Ga0496103_0031374 | Ga0496103_0031374_194_940 | 244 |
| 252 | 3300048907 | Ga0496104_0124650 | Ga0496104_0124650_1272_2015 | 244 |
| 253 | 3300048908 | Ga0496105_0063025 | Ga0496105_0063025_1359_2102 | 244 |
| 254 | 3300048911 | Ga0496108_0011457 | Ga0496108_0011457_3793_4536 | 244 |
| 255 | 3300048913 | Ga0496110_0149363 | Ga0496110_0149363_215_958 | 244 |
| 256 | 3300048914 | Ga0496111_0304933 | Ga0496111_0304933_370_1113 | 244 |
| 257 | 3300048915 | Ga0496112_0102515 | Ga0496112_0102515_1065_1808 | 244 |
| 258 | 3300048916 | Ga0496113_0215194 | Ga0496113_0215194_684_1427 | 244 |
| 259 | 3300049578 | Ga0501042_0038790 | Ga0501042_0038790_768_1514 | 244 |
| 260 | 3300050513 | nmdc:mga0rr50_643011_c1 | nmdc:mga0rr50_643011_c1_29_772 | 244 |
| 261 | 3300053077 | Ga0495601_0129418 | Ga0495601_0129418_230_973 | 244 |
| 262 | 3300053078 | Ga0495612_0048938 | Ga0495612_0048938_421_1164 | 244 |
| 263 | 3300053084 | Ga0495595_0004380 | Ga0495595_0004380_3917_4660 | 244 |
| 264 | 3300053084 | Ga0495595_0015816 | Ga0495595_0015816_2275_3018 | 244 |
| 265 | 3300053085 | Ga0495619_0007613 | Ga0495619_0007613_5147_5890 | 244 |
| 266 | 3300053085 | Ga0495619_0019574 | Ga0495619_0019574_1245_1988 | 244 |
| 267 | 3300053085 | Ga0495619_0213226 | Ga0495619_0213226_334_1077 | 244 |
| 268 | 3300053088 | Ga0500644_0111311 | Ga0500644_0111311_232_978 | 244 |
| 269 | 3300005435 | Ga0070714_100232846 | Ga0070714_1002328462 | 245 |
| 270 | 3300005436 | Ga0070713_100010434 | Ga0070713_1000104346 | 245 |
| 271 | 3300005445 | Ga0070708_100035685 | Ga0070708_1000356853 | 245 |
| 272 | 3300005468 | Ga0070707_100101437 | Ga0070707_1001014372 | 245 |
| 273 | 3300006028 | Ga0070717_10081359 | Ga0070717_100813592 | 245 |
| 274 | 3300006175 | Ga0070712_100051032 | Ga0070712_1000510323 | 245 |
| 275 | 3300013105 | Ga0157369_10047435 | Ga0157369_100474354 | 245 |
| 276 | 3300025915 | Ga0207693_10203018 | Ga0207693_102030182 | 245 |
| 277 | 3300025922 | Ga0207646_10099584 | Ga0207646_100995843 | 245 |
| 278 | 3300025929 | Ga0207664_10447951 | Ga0207664_104479512 | 245 |
| 279 | 3300028556 | Ga0265337_1000136 | Ga0265337_10001366 | 245 |
| 280 | 3300028558 | Ga0265326_10000701 | Ga0265326_100007016 | 245 |
| 281 | 3300028563 | Ga0265319_1001835 | Ga0265319_10018356 | 245 |
| 282 | 3300028573 | Ga0265334_10000468 | Ga0265334_1000046811 | 245 |
| 283 | 3300028653 | Ga0265323_10001755 | Ga0265323_100017555 | 245 |
| 284 | 3300028654 | Ga0265322_10001776 | Ga0265322_100017763 | 245 |
| 285 | 3300028666 | Ga0265336_10001798 | Ga0265336_100017986 | 245 |
| 286 | 3300028800 | Ga0265338_10009448 | Ga0265338_100094486 | 245 |
| 287 | 3300029957 | Ga0265324_10001624 | Ga0265324_100016246 | 245 |
| 288 | 3300031238 | Ga0265332_10001612 | Ga0265332_100016128 | 245 |
| 289 | 3300031240 | Ga0265320_10002827 | Ga0265320_100028276 | 245 |
| 290 | 3300031241 | Ga0265325_10006977 | Ga0265325_100069774 | 245 |
| 291 | 3300031247 | Ga0265340_10023192 | Ga0265340_100231923 | 245 |
| 292 | 3300031344 | Ga0265316_10002565 | Ga0265316_1000256519 | 245 |
| 293 | 3300031456 | Ga0307513_10195259 | Ga0307513_101952592 | 245 |
| 294 | 3300031507 | Ga0307509_10138524 | Ga0307509_101385242 | 245 |
| 295 | 3300031595 | Ga0265313_10010060 | Ga0265313_100100602 | 245 |
| 296 | 3300031711 | Ga0265314_10004380 | Ga0265314_100043806 | 245 |
| 297 | 3300031712 | Ga0265342_10002497 | Ga0265342_1000249712 | 245 |
| 298 | 3300033179 | Ga0307507_10146674 | Ga0307507_101466742 | 245 |
| 299 | 3300035083 | Ga0373926_0011101 | Ga0373926_0011101_63_809 | 245 |
| 300 | 3300046459 | Ga0495629_0024737 | Ga0495629_0024737_1219_1968 | 245 |
| 301 | 3300046642 | Ga0495634_0035105 | Ga0495634_0035105_1942_2688 | 245 |
| 302 | 3300048918 | Ga0496115_0102903 | Ga0496115_0102903_1035_1781 | 245 |
| 303 | iso_pu_bacteria | 2554235231 | 2555248798 | 245 |
| 304 | iso_pu_bacteria | 2599185161 | 2599364148 | 245 |
| 305 | iso_pu_bacteria | 2599185162 | 2599370468 | 245 |
| 306 | iso_pu_bacteria | 2599185163 | 2599377387 | 245 |
| 307 | iso_pu_bacteria | 2599185166 | 2599395693 | 245 |
| 308 | iso_pu_bacteria | 2599185168 | 2599408430 | 245 |
| 309 | iso_pu_bacteria | 2939651529 | 2939653770 | 245 |
| 310 | 3300005327 | Ga0070658_10007745 | Ga0070658_100077455 | 246 |
| 311 | 3300005459 | Ga0068867_100449265 | Ga0068867_1004492651 | 246 |
| 312 | 3300005518 | Ga0070699_100154238 | Ga0070699_1001542382 | 246 |
| 313 | 3300005536 | Ga0070697_100021918 | Ga0070697_1000219185 | 246 |
| 314 | 3300005563 | Ga0068855_100146500 | Ga0068855_1001465004 | 246 |
| 315 | 3300005577 | Ga0068857_100476935 | Ga0068857_1004769352 | 246 |
| 316 | 3300013105 | Ga0157369_10388678 | Ga0157369_103886782 | 246 |
| 317 | 3300020081 | Ga0206354_11368094 | Ga0206354_113680944 | 246 |
| 318 | 3300020082 | Ga0206353_10656357 | Ga0206353_106563572 | 246 |
| 319 | 3300025904 | Ga0207647_10080857 | Ga0207647_100808572 | 246 |
| 320 | 3300025909 | Ga0207705_10018322 | Ga0207705_100183225 | 246 |
| 321 | 3300025915 | Ga0207693_10086339 | Ga0207693_100863392 | 246 |
| 322 | 3300025949 | Ga0207667_10215950 | Ga0207667_102159502 | 246 |
| 323 | 3300026067 | Ga0207678_10076889 | Ga0207678_100768893 | 246 |
| 324 | 3300028800 | Ga0265338_10159528 | Ga0265338_101595282 | 246 |
| 325 | 3300031251 | Ga0265327_10000774 | Ga0265327_1000077439 | 246 |
| 326 | 3300031251 | Ga0265327_10001334 | Ga0265327_1000133417 | 246 |
| 327 | 3300034957 | Ga0373938_0013800 | Ga0373938_0013800_535_1311 | 246 |
| 328 | 3300035692 | Ga0373935_0064729 | Ga0373935_0064729_550_1323 | 246 |
| 329 | 3300039438 | Ga0436360_0378152 | Ga0436360_0378152_739_1497 | 246 |
| 330 | 3300039438 | Ga0436360_0759458 | Ga0436360_0759458_116_874 | 246 |
| 331 | 3300047319 | Ga0495674_0254599 | Ga0495674_0254599_328_1086 | 246 |
| 332 | 3300049573 | Ga0501037_0074843 | Ga0501037_0074843_1605_2399 | 246 |
| 333 | 3300053077 | Ga0495601_0415158 | Ga0495601_0415158_91_849 | 246 |
| 334 | 3300053078 | Ga0495612_0204404 | Ga0495612_0204404_62_835 | 246 |
| 335 | iso_pu_bacteria | 2510917013 | 2511094126 | 246 |
| 336 | iso_pu_bacteria | 2511231024 | 2511375391 | 246 |
| 337 | iso_pu_bacteria | 2738543024 | 2739306784 | 246 |
| 338 | iso_pu_bacteria | 3007803356 | 3007805450 | 246 |
| 339 | iso_pu_bacteria | 8002285264 | 8002286007 | 246 |
| 340 | 3300005937 | Ga0081455_10054664 | Ga0081455_100546643 | 247 |
| 341 | 3300044706 | Ga0466964_0129010 | Ga0466964_0129010_190_1023 | 247 |
| 342 | 3300049586 | Ga0501070_0388550 | Ga0501070_0388550_20_799 | 247 |
| 343 | 3300003758 | Ga0055532_1001927 | Ga0055532_10019272 | 248 |
| 344 | 3300005339 | Ga0070660_100118361 | Ga0070660_1001183612 | 248 |
| 345 | 3300005367 | Ga0070667_100545757 | Ga0070667_1005457572 | 248 |
| 346 | 3300005548 | Ga0070665_100001428 | Ga0070665_10000142822 | 248 |
| 347 | 3300005563 | Ga0068855_100002217 | Ga0068855_10000221711 | 248 |
| 348 | 3300005563 | Ga0068855_100214837 | Ga0068855_1002148372 | 248 |
| 349 | 3300005563 | Ga0068855_100424118 | Ga0068855_1004241181 | 248 |
| 350 | 3300009545 | Ga0105237_10247412 | Ga0105237_102474122 | 248 |
| 351 | 3300009551 | Ga0105238_10002317 | Ga0105238_100023172 | 248 |
| 352 | 3300015262 | Ga0182007_10014081 | Ga0182007_100140814 | 248 |
| 353 | 3300021361 | Ga0213872_10000311 | Ga0213872_1000031126 | 248 |
| 354 | 3300025225 | Ga0209566_100365 | Ga0209566_10036528 | 248 |
| 355 | 3300025226 | Ga0209674_104697 | Ga0209674_1046972 | 248 |
| 356 | 3300025229 | Ga0209147_100061 | Ga0209147_100061211 | 248 |
| 357 | 3300025294 | Ga0209025_1000034 | Ga0209025_1000034303 | 248 |
| 358 | 3300025303 | Ga0209051_1029255 | Ga0209051_10292552 | 248 |
| 359 | 3300025924 | Ga0207694_10001252 | Ga0207694_100012527 | 248 |
| 360 | 3300025949 | Ga0207667_10007751 | Ga0207667_100077518 | 248 |
| 361 | 3300025949 | Ga0207667_10263707 | Ga0207667_102637072 | 248 |
| 362 | 3300025949 | Ga0207667_10372274 | Ga0207667_103722742 | 248 |
| 363 | 3300026078 | Ga0207702_10237003 | Ga0207702_102370032 | 248 |
| 364 | 3300028379 | Ga0268266_10000945 | Ga0268266_100009458 | 248 |
| 365 | 3300031251 | Ga0265327_10000229 | Ga0265327_10000229111 | 248 |
| 366 | 3300031731 | Ga0307405_10122414 | Ga0307405_101224142 | 248 |
| 367 | 3300032005 | Ga0307411_10292491 | Ga0307411_102924912 | 248 |
| 368 | 3300035398 | Ga0316574_0397832 | Ga0316574_0397832_46_798 | 248 |
| 369 | 3300037312 | Ga0395899_0128285 | Ga0395899_0128285_954_1709 | 248 |
| 370 | 3300037471 | Ga0395905_0095170 | Ga0395905_0095170_357_1112 | 248 |
| 371 | 3300038443 | Ga0395901_0259271 | Ga0395901_0259271_239_994 | 248 |
| 372 | 3300039437 | Ga0436365_1911032 | Ga0436365_1911032_599_1408 | 248 |
| 373 | 3300039447 | Ga0436361_0396482 | Ga0436361_0396482_22606_23367 | 248 |
| 374 | 3300039447 | Ga0436361_0462475 | Ga0436361_0462475_129_881 | 248 |
| 375 | 3300046491 | Ga0495584_0000123 | Ga0495584_0000123_29762_30520 | 248 |
| 376 | 3300046506 | Ga0495583_0000026 | Ga0495583_0000026_54258_55013 | 248 |
| 377 | 3300046664 | Ga0495659_0000018 | Ga0495659_0000018_20442_21224 | 248 |
| 378 | 3300046678 | Ga0495599_0000339 | Ga0495599_0000339_6188_6961 | 248 |
| 379 | 3300046679 | Ga0495623_0006086 | Ga0495623_0006086_6029_6802 | 248 |
| 380 | 3300047318 | Ga0495636_0023832 | Ga0495636_0023832_197_982 | 248 |
| 381 | 3300047320 | Ga0495672_0001818 | Ga0495672_0001818_969_1751 | 248 |
| 382 | 3300047447 | Ga0495685_090606 | Ga0495685_090606_79_855 | 248 |
| 383 | 3300048088 | Ga0495602_0204393 | Ga0495602_0204393_738_1493 | 248 |
| 384 | 3300048905 | Ga0496102_0232959 | Ga0496102_0232959_477_1271 | 248 |
| 385 | 3300048919 | Ga0496116_0018495 | Ga0496116_0018495_1550_2344 | 248 |
| 386 | 3300048921 | Ga0496118_0172876 | Ga0496118_0172876_285_1043 | 248 |
| 387 | 3300049571 | Ga0501034_0000384 | Ga0501034_0000384_58483_59286 | 248 |
| 388 | 3300049571 | Ga0501034_0002846 | Ga0501034_0002846_4100_4864 | 248 |
| 389 | 3300049571 | Ga0501034_0031029 | Ga0501034_0031029_3029_3793 | 248 |
| 390 | 3300049571 | Ga0501034_0338009 | Ga0501034_0338009_130_909 | 248 |
| 391 | 3300049742 | Ga0501080_0067236 | Ga0501080_0067236_2485_3255 | 248 |
| 392 | 3300049823 | Ga0501044_0738867 | Ga0501044_0738867_55_810 | 248 |
| 393 | 3300053087 | Ga0500643_061832 | Ga0500643_061832_159_905 | 248 |
| 394 | 3300053091 | Ga0500647_0068181 | Ga0500647_0068181_502_1257 | 248 |
| 395 | 3300053119 | Ga0500595_003020 | Ga0500595_003020_1650_2405 | 248 |
| 396 | 3300053146 | Ga0500588_0033469 | Ga0500588_0033469_53_808 | 248 |
| 397 | iso_pu_bacteria | 2501025502 | 2501079788 | 248 |
| 398 | iso_pu_bacteria | 2513237150 | 2513953720 | 248 |
| 399 | iso_pu_bacteria | 2513237165 | 2514040376 | 248 |
| 400 | iso_pu_bacteria | 2599185239 | 2599734803 | 248 |
| 401 | iso_pu_bacteria | 2744054900 | 2746091356 | 248 |
| 402 | iso_pu_bacteria | 2744054901 | 2746097789 | 248 |
| 403 | iso_pu_bacteria | 2818991452 | 2819635751 | 248 |
| 404 | iso_pu_bacteria | 2842324504 | 2842325294 | 248 |
| 405 | iso_pu_bacteria | 2842348783 | 2842349573 | 248 |
| 406 | iso_pu_bacteria | 2842454564 | 2842455189 | 248 |
| 407 | iso_pu_bacteria | 2858688981 | 2858690130 | 248 |
| 408 | iso_pu_bacteria | 2870068957 | 2870075397 | 248 |
| 409 | iso_pu_bacteria | 2900634093 | 2900640226 | 248 |
| 410 | iso_pu_bacteria | 2928170801 | 2928175257 | 248 |
| 411 | iso_pu_bacteria | 2981990288 | 2981992540 | 248 |
| 412 | iso_pu_bacteria | 641736154 | 642418583 | 248 |
| 413 | iso_pu_bacteria | 644736347 | 644750555 | 248 |
| 414 | iso_pu_bacteria | 8018845410 | 8018847869 | 248 |
| 415 | iso_pu_bacteria | 8021120328 | 8021121832 | 248 |
| 416 | 3300003322 | rootL2_10164656 | rootL2_101646562 | 249 |
| 417 | 3300005328 | Ga0070676_10006570 | Ga0070676_100065705 | 249 |
| 418 | 3300005335 | Ga0070666_10064701 | Ga0070666_100647013 | 249 |
| 419 | 3300005341 | Ga0070691_10054011 | Ga0070691_100540112 | 249 |
| 420 | 3300005347 | Ga0070668_100036337 | Ga0070668_1000363374 | 249 |
| 421 | 3300005355 | Ga0070671_100024285 | Ga0070671_1000242851 | 249 |
| 422 | 3300005356 | Ga0070674_100012675 | Ga0070674_1000126751 | 249 |
| 423 | 3300005364 | Ga0070673_100026276 | Ga0070673_1000262764 | 249 |
| 424 | 3300005366 | Ga0070659_100413529 | Ga0070659_1004135291 | 249 |
| 425 | 3300005437 | Ga0070710_10002583 | Ga0070710_100025838 | 249 |
| 426 | 3300005444 | Ga0070694_100298496 | Ga0070694_1002984962 | 249 |
| 427 | 3300005456 | Ga0070678_100001371 | Ga0070678_10000137111 | 249 |
| 428 | 3300005457 | Ga0070662_100067085 | Ga0070662_1000670852 | 249 |
| 429 | 3300005543 | Ga0070672_100383445 | Ga0070672_1003834451 | 249 |
| 430 | 3300005547 | Ga0070693_100079426 | Ga0070693_1000794262 | 249 |
| 431 | 3300005549 | Ga0070704_100219440 | Ga0070704_1002194402 | 249 |
| 432 | 3300005563 | Ga0068855_100197368 | Ga0068855_1001973683 | 249 |
| 433 | 3300005718 | Ga0068866_10027292 | Ga0068866_100272923 | 249 |
| 434 | 3300005840 | Ga0068870_10009358 | Ga0068870_100093582 | 249 |
| 435 | 3300005842 | Ga0068858_100033104 | Ga0068858_1000331045 | 249 |
| 436 | 3300005843 | Ga0068860_100006204 | Ga0068860_1000062044 | 249 |
| 437 | 3300005844 | Ga0068862_100011608 | Ga0068862_1000116083 | 249 |
| 438 | 3300006163 | Ga0070715_10000618 | Ga0070715_100006188 | 249 |
| 439 | 3300006175 | Ga0070712_100073392 | Ga0070712_1000733921 | 249 |
| 440 | 3300006175 | Ga0070712_100148673 | Ga0070712_1001486732 | 249 |
| 441 | 3300006237 | Ga0097621_100043869 | Ga0097621_1000438693 | 249 |
| 442 | 3300006844 | Ga0075428_100003036 | Ga0075428_10000303620 | 249 |
| 443 | 3300006844 | Ga0075428_100224042 | Ga0075428_1002240422 | 249 |
| 444 | 3300006846 | Ga0075430_100253487 | Ga0075430_1002534872 | 249 |
| 445 | 3300006846 | Ga0075430_100353476 | Ga0075430_1003534761 | 249 |
| 446 | 3300006847 | Ga0075431_100027540 | Ga0075431_1000275405 | 249 |
| 447 | 3300006847 | Ga0075431_100285608 | Ga0075431_1002856082 | 249 |
| 448 | 3300006847 | Ga0075431_100366999 | Ga0075431_1003669992 | 249 |
| 449 | 3300006880 | Ga0075429_100063985 | Ga0075429_1000639852 | 249 |
| 450 | 3300006881 | Ga0068865_100464061 | Ga0068865_1004640611 | 249 |
| 451 | 3300009098 | Ga0105245_10030968 | Ga0105245_100309681 | 249 |
| 452 | 3300009101 | Ga0105247_10023102 | Ga0105247_100231023 | 249 |
| 453 | 3300009147 | Ga0114129_10858044 | Ga0114129_108580441 | 249 |
| 454 | 3300009174 | Ga0105241_10011887 | Ga0105241_100118873 | 249 |
| 455 | 3300009176 | Ga0105242_10007934 | Ga0105242_100079342 | 249 |
| 456 | 3300010375 | Ga0105239_10009458 | Ga0105239_100094586 | 249 |
| 457 | 3300013296 | Ga0157374_10057897 | Ga0157374_100578973 | 249 |
| 458 | 3300014325 | Ga0163163_10104254 | Ga0163163_101042543 | 249 |
| 459 | 3300014968 | Ga0157379_10119526 | Ga0157379_101195263 | 249 |
| 460 | 3300014969 | Ga0157376_10185312 | Ga0157376_101853121 | 249 |
| 461 | 3300025261 | Ga0209233_1006721 | Ga0209233_10067212 | 249 |
| 462 | 3300025899 | Ga0207642_10084595 | Ga0207642_100845952 | 249 |
| 463 | 3300025900 | Ga0207710_10049501 | Ga0207710_100495012 | 249 |
| 464 | 3300025905 | Ga0207685_10005718 | Ga0207685_100057182 | 249 |
| 465 | 3300025906 | Ga0207699_10011325 | Ga0207699_100113252 | 249 |
| 466 | 3300025907 | Ga0207645_10001237 | Ga0207645_1000123712 | 249 |
| 467 | 3300025908 | Ga0207643_10012781 | Ga0207643_100127814 | 249 |
| 468 | 3300025915 | Ga0207693_10000161 | Ga0207693_1000016157 | 249 |
| 469 | 3300025915 | Ga0207693_10164120 | Ga0207693_101641202 | 249 |
| 470 | 3300025916 | Ga0207663_10098440 | Ga0207663_100984402 | 249 |
| 471 | 3300025928 | Ga0207700_10006538 | Ga0207700_100065386 | 249 |
| 472 | 3300025933 | Ga0207706_10031269 | Ga0207706_100312692 | 249 |
| 473 | 3300025938 | Ga0207704_10655149 | Ga0207704_106551491 | 249 |
| 474 | 3300025939 | Ga0207665_10010659 | Ga0207665_100106592 | 249 |
| 475 | 3300025940 | Ga0207691_10001275 | Ga0207691_1000127514 | 249 |
| 476 | 3300025986 | Ga0207658_10052002 | Ga0207658_100520024 | 249 |
| 477 | 3300026075 | Ga0207708_10017628 | Ga0207708_100176286 | 249 |
| 478 | 3300026089 | Ga0207648_10006902 | Ga0207648_100069023 | 249 |
| 479 | 3300026118 | Ga0207675_100007183 | Ga0207675_10000718311 | 249 |
| 480 | 3300026121 | Ga0207683_10014642 | Ga0207683_100146425 | 249 |
| 481 | 3300027378 | Ga0209981_1024901 | Ga0209981_10249011 | 249 |
| 482 | 3300027424 | Ga0209984_1018162 | Ga0209984_10181622 | 249 |
| 483 | 3300027552 | Ga0209982_1021923 | Ga0209982_10219232 | 249 |
| 484 | 3300027617 | Ga0210002_1025289 | Ga0210002_10252892 | 249 |
| 485 | 3300027665 | Ga0209983_1000778 | Ga0209983_10007783 | 249 |
| 486 | 3300027682 | Ga0209971_1000645 | Ga0209971_10006459 | 249 |
| 487 | 3300027717 | Ga0209998_10000369 | Ga0209998_100003697 | 249 |
| 488 | 3300027876 | Ga0209974_10000695 | Ga0209974_100006956 | 249 |
| 489 | 3300027907 | Ga0207428_10129090 | Ga0207428_101290902 | 249 |
| 490 | 3300028380 | Ga0268265_10139025 | Ga0268265_101390252 | 249 |
| 491 | 3300028380 | Ga0268265_10143935 | Ga0268265_101439352 | 249 |
| 492 | 3300031507 | Ga0307509_10109155 | Ga0307509_101091553 | 249 |
| 493 | 3300031911 | Ga0307412_10156585 | Ga0307412_101565852 | 249 |
| 494 | 3300035111 | Ga0373923_0023496 | Ga0373923_0023496_923_1672 | 249 |
| 495 | 3300035119 | Ga0373956_0116781 | Ga0373956_0116781_68_817 | 249 |
| 496 | 3300035172 | Ga0373955_0084490 | Ga0373955_0084490_329_1078 | 249 |
| 497 | 3300035410 | Ga0373924_0054206 | Ga0373924_0054206_191_940 | 249 |
| 498 | 3300035692 | Ga0373935_0127961 | Ga0373935_0127961_133_882 | 249 |
| 499 | 3300035724 | Ga0373933_0352000 | Ga0373933_0352000_56_805 | 249 |
| 500 | 3300036401 | Ga0373937_0051584 | Ga0373937_0051584_1941_2690 | 249 |
| 501 | 3300037068 | Ga0373925_0041216 | Ga0373925_0041216_1070_1819 | 249 |
| 502 | 3300038705 | Ga0237819_00736 | Ga0237819_00736_6813_7562 | 249 |
| 503 | 3300039145 | Ga0237816_01631 | Ga0237816_01631_107_856 | 249 |
| 504 | 3300042133 | Ga0450896_004073 | Ga0450896_004073_126_875 | 249 |
| 505 | 3300042461 | Ga0439460_0076759 | Ga0439460_0076759_19_768 | 249 |
| 506 | 3300046454 | Ga0495592_0303547 | Ga0495592_0303547_13_762 | 249 |
| 507 | 3300046462 | Ga0495651_0094101 | Ga0495651_0094101_178_927 | 249 |
| 508 | 3300046472 | Ga0495580_0000466 | Ga0495580_0000466_13212_13961 | 249 |
| 509 | 3300046472 | Ga0495580_0010620 | Ga0495580_0010620_2684_3433 | 249 |
| 510 | 3300046472 | Ga0495580_0013630 | Ga0495580_0013630_650_1399 | 249 |
| 511 | 3300046476 | Ga0495662_0096909 | Ga0495662_0096909_351_1100 | 249 |
| 512 | 3300046506 | Ga0495583_0010261 | Ga0495583_0010261_2532_3281 | 249 |
| 513 | 3300046514 | Ga0495618_0157720 | Ga0495618_0157720_178_927 | 249 |
| 514 | 3300046530 | Ga0495654_0054862 | Ga0495654_0054862_162_911 | 249 |
| 515 | 3300046543 | Ga0495645_0094115 | Ga0495645_0094115_1289_2038 | 249 |
| 516 | 3300046660 | Ga0495625_0014779 | Ga0495625_0014779_2575_3324 | 249 |
| 517 | 3300046660 | Ga0495625_0389097 | Ga0495625_0389097_114_863 | 249 |
| 518 | 3300047319 | Ga0495674_0028392 | Ga0495674_0028392_3788_4537 | 249 |
| 519 | 3300047445 | Ga0495677_0001834 | Ga0495677_0001834_1424_2173 | 249 |
| 520 | 3300048906 | Ga0496103_0106743 | Ga0496103_0106743_169_918 | 249 |
| 521 | 3300048907 | Ga0496104_0134162 | Ga0496104_0134162_23_772 | 249 |
| 522 | 3300048908 | Ga0496105_0195308 | Ga0496105_0195308_23_772 | 249 |
| 523 | 3300048909 | Ga0496106_0010983 | Ga0496106_0010983_810_1559 | 249 |
| 524 | 3300048910 | Ga0496107_0354570 | Ga0496107_0354570_149_898 | 249 |
| 525 | 3300048911 | Ga0496108_0039840 | Ga0496108_0039840_1305_2054 | 249 |
| 526 | 3300048912 | Ga0496109_0110971 | Ga0496109_0110971_1680_2429 | 249 |
| 527 | 3300048913 | Ga0496110_0005954 | Ga0496110_0005954_748_1497 | 249 |
| 528 | 3300048914 | Ga0496111_0001142 | Ga0496111_0001142_8132_8881 | 249 |
| 529 | 3300048915 | Ga0496112_0076949 | Ga0496112_0076949_1509_2258 | 249 |
| 530 | 3300048917 | Ga0496114_0013956 | Ga0496114_0013956_2062_2811 | 249 |
| 531 | 3300048918 | Ga0496115_0017554 | Ga0496115_0017554_4655_5404 | 249 |
| 532 | 3300049577 | Ga0501041_0059241 | Ga0501041_0059241_1459_2208 | 249 |
| 533 | 3300049580 | Ga0501046_0477807 | Ga0501046_0477807_52_801 | 249 |
| 534 | 3300049593 | Ga0501077_0137132 | Ga0501077_0137132_194_943 | 249 |
| 535 | 3300049741 | Ga0501079_0256361 | Ga0501079_0256361_89_838 | 249 |
| 536 | 3300050507 | nmdc:mga05p37_206467_c1 | nmdc:mga05p37_206467_c1_1179_1928 | 249 |
| 537 | 3300050508 | nmdc:mga09592_368950_c1 | nmdc:mga09592_368950_c1_223_972 | 249 |
| 538 | 3300050509 | nmdc:mga0qj67_115310_c1 | nmdc:mga0qj67_115310_c1_569_1318 | 249 |
| 539 | 3300050509 | nmdc:mga0qj67_163198_c1 | nmdc:mga0qj67_163198_c1_188_937 | 249 |
| 540 | 3300050510 | nmdc:mga06r32_213884_c1 | nmdc:mga06r32_213884_c1_377_1126 | 249 |
| 541 | 3300050510 | nmdc:mga06r32_24666_c1 | nmdc:mga06r32_24666_c1_90_839 | 249 |
| 542 | 3300050510 | nmdc:mga06r32_300369_c1 | nmdc:mga06r32_300369_c1_390_1139 | 249 |
| 543 | 3300053116 | Ga0500592_009215 | Ga0500592_009215_792_1541 | 249 |
| 544 | 3300053158 | Ga0500627_0000002 | Ga0500627_0000002_189000_189749 | 249 |
| 545 | 3300053735 | Ga0500596_000031 | Ga0500596_000031_901_1653 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lk5-assembly1.cif.gz_B | crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 | 0.9287 | 2 | 242 |
| 3pea-assembly2.cif.gz_D | crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' | 0.9234 | 1 | 249 |
| 3p5m-assembly1.cif.gz_B | crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium | 0.9229 | 2 | 249 |
| 4lk5-assembly1.cif.gz_A | crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 | 0.9209 | 2 | 239 |
| 3p5m-assembly1.cif.gz_F | crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium | 0.9203 | 2 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y3U6_5_247_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9727 | 10 | 243 | 3.90.226.10 |
| 5wydE01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9397 | 2 | 190 | 3.90.226.10 |
| 3mybC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9377 | 1 | 193 | 3.90.226.10 |
| af_D1MN80_22_227_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.934 | 6 | 190 | 3.90.226.10 |
| af_I6Y3U6_5_247_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9335 | 10 | 243 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1KPJ6-F1-model_v4 | Enoyl-CoA hydratase | 0.9916 | 2 | 111 |
GO:0016020
|
| AF-A0A7C7U5P0-F1-model_v4 | Enoyl-CoA hydratase family protein | 0.9901 | 1 | 170 |
|
| AF-A0A7C7S7D3-F1-model_v4 | deleted | 0.9877 | 1 | 249 |
|
| AF-A0A3B7DQZ8-F1-model_v4 | deleted | 0.9855 | 1 | 249 |
|
| AF-A0A7C7U5P0-F1-model_v4 | Enoyl-CoA hydratase family protein | 0.9843 | 1 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar