F461878

General Info

Members Datasets Scaffolds Average Seq Length
545 340 510 249

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001334|Ga0265327_1000133417
Length 282
Sequence VGTSPHGGTWLVRRPVAYCAHVPIETVRDREGVAEVVIDHPPVNALDVAGWFALADALVAAGQSPETTVVVLRAEGRGFCAGVDIKEIQAEGDRALVGVNRGCAAAFAAVYDCEVPVIAAVGGFCLGGGIGLVGNADIVIAADDATFGLPEVDRGALGAATHLARLVPQHKMREMVYTAKSVTADELAGYGSVSRVVPRAALRDAALDLADEIATKHPSIIRRAKESLNGIDPVDVKRSYRFEQGFTYELHVRGVADEQRAAFVEKRAPVVGHRGEGGGGSH

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231024 Pseudomonas sp. GM84 Isolate Nodule
4 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
7 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
8 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
9 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
10 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
11 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2738543024 Aminobacter sp. AP02 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
16 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
17 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
18 2818991452 Burkholderia cepacia 561 Isolate Unclassified
19 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
20 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
21 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
22 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
23 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
24 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
25 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
26 2928170801 Burkholderia sp. 572 Isolate Unclassified
27 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
28 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
29 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
218 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
224 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
225 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
326 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
327 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
331 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
332 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
333 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
336 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
337 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
338 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
339 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
340 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.21
Metatranscriptomes 0.37
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 1.47
Rhizoplane 5.5
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10164656 3300003322 Bacteria 1283
2 Ga0055532_1001927 3300003758 Bacteria 4930
3 Ga0055532_1001930 3300003758 Bacteria 4918
4 Ga0055527_1000103 3300003760 Bacteria 62002
5 Ga0055535_1000209 3300003761 Bacteria 62002
6 Ga0055542_1001293 3300003762 Bacteria 13359
7 Ga0070658_10007745 3300005327 Bacteria 8655
8 Ga0070676_10006570 3300005328 Bacteria 6217
9 Ga0070670_100218700 3300005331 Bacteria 1657
10 Ga0070666_10064701 3300005335 Bacteria 2480
11 Ga0068868_100122815 3300005338 Bacteria 2119
12 Ga0068868_100704217 3300005338 Bacteria 904
13 Ga0070660_100118361 3300005339 Bacteria 2113
14 Ga0070691_10054011 3300005341 Bacteria 1923
15 Ga0070668_100002771 3300005347 Bacteria 12883
16 Ga0070668_100036337 3300005347 Bacteria 3759
17 Ga0070668_100250604 3300005347 Bacteria 1470
18 Ga0070671_100024285 3300005355 Bacteria 4962
19 Ga0070674_100012675 3300005356 Bacteria 5183
20 Ga0070673_100026276 3300005364 Bacteria 4299
21 Ga0070659_100413529 3300005366 Bacteria 1140
22 Ga0070667_100545757 3300005367 Bacteria 1065
23 Ga0070667_100616896 3300005367 Bacteria 1000
24 Ga0070709_10032498 3300005434 Bacteria 3147
25 Ga0070709_10104308 3300005434 Bacteria 1894
26 Ga0070714_100043027 3300005435 Bacteria 3818
27 Ga0070714_100073810 3300005435 Bacteria 2956
28 Ga0070714_100232846 3300005435 Bacteria 1698
29 Ga0070714_100611116 3300005435 Bacteria 1047
30 Ga0070714_100625640 3300005435 Bacteria 1035
31 Ga0070713_100010434 3300005436 Bacteria 6709
32 Ga0070713_100028818 3300005436 Bacteria 4388
33 Ga0070713_100161365 3300005436 Bacteria 2001
34 Ga0070713_100461444 3300005436 Bacteria 1194
35 Ga0070710_10002583 3300005437 Bacteria 8605
36 Ga0070710_10011934 3300005437 Bacteria 4305
37 Ga0070710_10025429 3300005437 Bacteria 3135
38 Ga0070694_100298496 3300005444 Bacteria 1234
39 Ga0070708_100035685 3300005445 Bacteria 4333
40 Ga0070678_100001371 3300005456 Bacteria 12958
41 Ga0070662_100067085 3300005457 Bacteria 2634
42 Ga0068867_100449265 3300005459 Bacteria 1098
43 Ga0070707_100049989 3300005468 Bacteria 4008
44 Ga0070707_100101437 3300005468 Bacteria 2789
45 Ga0070699_100154238 3300005518 Bacteria 2032
46 Ga0070697_100021918 3300005536 Bacteria 5067
47 Ga0068853_100421945 3300005539 Bacteria 1251
48 Ga0070672_100383445 3300005543 Bacteria 1202
49 Ga0070693_100079426 3300005547 Bacteria 1952
50 Ga0070693_100379360 3300005547 Bacteria 975
51 Ga0070665_100001428 3300005548 Bacteria 28009
52 Ga0070704_100219440 3300005549 Bacteria 1545
53 Ga0068855_100002217 3300005563 Bacteria 24047
54 Ga0068855_100146500 3300005563 Bacteria 2687
55 Ga0068855_100197368 3300005563 Bacteria 2267
56 Ga0068855_100214837 3300005563 Bacteria 2159
57 Ga0068855_100424118 3300005563 Bacteria 1455
58 Ga0068857_100476935 3300005577 Bacteria 1169
59 Ga0068864_100598144 3300005618 Bacteria 1070
60 Ga0068866_10027292 3300005718 Bacteria 2706
61 Ga0068870_10009358 3300005840 Bacteria 4453
62 Ga0068863_100553946 3300005841 Bacteria 1135
63 Ga0068858_100023429 3300005842 Bacteria 5751
64 Ga0068858_100031738 3300005842 Bacteria 4909
65 Ga0068858_100033104 3300005842 Bacteria 4800
66 Ga0068860_100006204 3300005843 Bacteria 12016
67 Ga0068860_100028090 3300005843 Bacteria 5416
68 Ga0068862_100011608 3300005844 Bacteria 7268
69 Ga0081455_10054664 3300005937 Bacteria 3401
70 Ga0081540_1055828 3300005983 Bacteria 1921
71 Ga0070717_10081359 3300006028 Bacteria 2719
72 Ga0070717_10092180 3300006028 Bacteria 2559
73 Ga0070717_10263813 3300006028 Bacteria 1524
74 Ga0070715_10000618 3300006163 Bacteria 9385
75 Ga0070716_100249191 3300006173 Bacteria 1209
76 Ga0070712_100051032 3300006175 Bacteria 2880
77 Ga0070712_100073392 3300006175 Bacteria 2454
78 Ga0070712_100106467 3300006175 Bacteria 2085
79 Ga0070712_100130813 3300006175 Bacteria 1902
80 Ga0070712_100148673 3300006175 Bacteria 1796
81 Ga0070712_100169996 3300006175 Bacteria 1690
82 Ga0070712_100355791 3300006175 Bacteria 1199
83 Ga0097621_100043869 3300006237 Bacteria 3606
84 Ga0075428_100003036 3300006844 Bacteria 18329
85 Ga0075428_100224042 3300006844 Bacteria 2030
86 Ga0075430_100253487 3300006846 Bacteria 1458
87 Ga0075430_100353476 3300006846 Bacteria 1213
88 Ga0075431_100027540 3300006847 Bacteria 5833
89 Ga0075431_100285608 3300006847 Bacteria 1670
90 Ga0075431_100366999 3300006847 Bacteria 1445
91 Ga0075429_100063985 3300006880 Bacteria 3204
92 Ga0068865_100464061 3300006881 Bacteria 1049
93 Ga0075435_100367433 3300007076 Bacteria 1235
94 Ga0105245_10030968 3300009098 Bacteria 4732
95 Ga0105245_10829488 3300009098 Bacteria 964
96 Ga0105247_10023102 3300009101 Bacteria 3745
97 Ga0114129_10307472 3300009147 Bacteria 2111
98 Ga0114129_10858044 3300009147 Bacteria 1154
99 Ga0105241_10011887 3300009174 Bacteria 6397
100 Ga0105242_10007934 3300009176 Bacteria 8175
101 Ga0105237_10247412 3300009545 Bacteria 1785
102 Ga0105237_10305317 3300009545 Bacteria 1594
103 Ga0105238_10002317 3300009551 Bacteria 19137
104 Ga0105238_10319956 3300009551 Bacteria 1537
105 Ga0105239_10009458 3300010375 Bacteria 10983
106 Ga0157369_10047435 3300013105 Bacteria 4664
107 Ga0157369_10262634 3300013105 Bacteria 1800
108 Ga0157369_10388678 3300013105 Bacteria 1448
109 Ga0157374_10057897 3300013296 Bacteria 3620
110 Ga0157378_10222067 3300013297 Bacteria 1797
111 Ga0157372_10880232 3300013307 Bacteria 1039
112 Ga0163163_10104254 3300014325 Bacteria 2861
113 Ga0163163_10330570 3300014325 Bacteria 1578
114 Ga0157379_10119526 3300014968 Bacteria 2370
115 Ga0157376_10040783 3300014969 Bacteria 3796
116 Ga0157376_10185312 3300014969 Bacteria 1905
117 Ga0182007_10014081 3300015262 Bacteria 3028
118 Ga0206354_11368094 3300020081 Bacteria 1991
119 Ga0206353_10656357 3300020082 Bacteria 1443
120 Ga0213872_10000311 3300021361 Bacteria 41468
121 Ga0209566_100365 3300025225 Bacteria 37887
122 Ga0209674_104697 3300025226 Bacteria 2168
123 Ga0209672_100062 3300025228 Bacteria 204912
124 Ga0209147_100061 3300025229 Bacteria 248809
125 Ga0209147_100078 3300025229 Bacteria 204912
126 Ga0209258_100108 3300025242 Bacteria 204912
127 Ga0209233_1006721 3300025261 Bacteria 3687
128 Ga0209455_1000251 3300025272 Bacteria 63875
129 Ga0209025_1000034 3300025294 Bacteria 413205
130 Ga0209051_1029255 3300025303 Bacteria 2159
131 Ga0207692_10062971 3300025898 Bacteria 1926
132 Ga0207692_10094059 3300025898 Bacteria 1631
133 Ga0207642_10084595 3300025899 Bacteria 1550
134 Ga0207710_10049501 3300025900 Bacteria 1883
135 Ga0207647_10080857 3300025904 Bacteria 1948
136 Ga0207685_10005718 3300025905 Bacteria 3315
137 Ga0207699_10011325 3300025906 Bacteria 4500
138 Ga0207645_10001237 3300025907 Bacteria 21011
139 Ga0207643_10012781 3300025908 Bacteria 4540
140 Ga0207705_10018322 3300025909 Bacteria 5007
141 Ga0207693_10000161 3300025915 Bacteria 61727
142 Ga0207693_10086339 3300025915 Bacteria 2458
143 Ga0207693_10164120 3300025915 Bacteria 1748
144 Ga0207693_10203018 3300025915 Bacteria 1559
145 Ga0207693_10216382 3300025915 Bacteria 1505
146 Ga0207663_10098440 3300025916 Bacteria 1958
147 Ga0207646_10099584 3300025922 Bacteria 2605
148 Ga0207694_10001252 3300025924 Bacteria 21941
149 Ga0207700_10006538 3300025928 Bacteria 7049
150 Ga0207664_10043733 3300025929 Bacteria 3505
151 Ga0207664_10447951 3300025929 Bacteria 1152
152 Ga0207664_10674177 3300025929 Bacteria 930
153 Ga0207706_10031269 3300025933 Bacteria 4743
154 Ga0207704_10655149 3300025938 Bacteria 865
155 Ga0207665_10010659 3300025939 Bacteria 6035
156 Ga0207665_10259126 3300025939 Bacteria 1288
157 Ga0207691_10001275 3300025940 Bacteria 25192
158 Ga0207689_10401220 3300025942 Bacteria 1143
159 Ga0207661_10262523 3300025944 Bacteria 1539
160 Ga0207667_10007751 3300025949 Bacteria 12832
161 Ga0207667_10215950 3300025949 Bacteria 1965
162 Ga0207667_10263707 3300025949 Bacteria 1762
163 Ga0207667_10372274 3300025949 Bacteria 1456
164 Ga0207668_10010415 3300025972 Bacteria 5615
165 Ga0207668_10179523 3300025972 Bacteria 1668
166 Ga0207658_10052002 3300025986 Bacteria 3021
167 Ga0207658_10127346 3300025986 Bacteria 2040
168 Ga0207703_10157464 3300026035 Bacteria 1986
169 Ga0207678_10076889 3300026067 Bacteria 2859
170 Ga0207708_10017628 3300026075 Bacteria 5376
171 Ga0207702_10047109 3300026078 Bacteria 3631
172 Ga0207702_10076903 3300026078 Bacteria 2885
173 Ga0207702_10237003 3300026078 Bacteria 1708
174 Ga0207702_10304279 3300026078 Bacteria 1514
175 Ga0207648_10006902 3300026089 Bacteria 11248
176 Ga0207676_10217654 3300026095 Bacteria 1699
177 Ga0207676_10251514 3300026095 Bacteria 1591
178 Ga0207674_10166233 3300026116 Bacteria 2160
179 Ga0207675_100007183 3300026118 Bacteria 10523
180 Ga0207683_10014642 3300026121 Bacteria 6680
181 Ga0209981_1024901 3300027378 Bacteria 865
182 Ga0209984_1018162 3300027424 Bacteria 948
183 Ga0209982_1021923 3300027552 Bacteria 985
184 Ga0210002_1025289 3300027617 Bacteria 971
185 Ga0209983_1000778 3300027665 Bacteria 6936
186 Ga0209971_1000645 3300027682 Bacteria 9092
187 Ga0209998_10000369 3300027717 Bacteria 13058
188 Ga0209974_10000695 3300027876 Bacteria 11471
189 Ga0207428_10129090 3300027907 Bacteria 1935
190 Ga0268266_10000945 3300028379 Bacteria 36992
191 Ga0268265_10139025 3300028380 Bacteria 2030
192 Ga0268265_10143935 3300028380 Bacteria 2000
193 Ga0265337_1000136 3300028556 Bacteria 37039
194 Ga0265326_10000701 3300028558 Bacteria 12388
195 Ga0265326_10041604 3300028558 Bacteria 1305
196 Ga0265319_1001835 3300028563 Bacteria 12110
197 Ga0265334_10000468 3300028573 Bacteria 20832
198 Ga0265323_10001755 3300028653 Bacteria 10292
199 Ga0265322_10001776 3300028654 Bacteria 6843
200 Ga0265336_10001798 3300028666 Bacteria 9374
201 Ga0307517_10083105 3300028786 Bacteria 2711
202 Ga0307517_10204258 3300028786 Bacteria 1229
203 Ga0307515_10008714 3300028794 Bacteria 19719
204 Ga0307515_10043536 3300028794 Bacteria 6974
205 Ga0265338_10009448 3300028800 Bacteria 11622
206 Ga0265338_10159528 3300028800 Bacteria 1743
207 Ga0265324_10001624 3300029957 Bacteria 12483
208 Ga0307512_10026940 3300030522 Bacteria 5067
209 Ga0265332_10001612 3300031238 Bacteria 12359
210 Ga0265320_10002827 3300031240 Bacteria 11938
211 Ga0265325_10006977 3300031241 Bacteria 6809
212 Ga0265340_10023192 3300031247 Bacteria 3166
213 Ga0265327_10000104 3300031251 Bacteria 185298
214 Ga0265327_10000229 3300031251 Bacteria 113907
215 Ga0265327_10000774 3300031251 Bacteria 49307
216 Ga0265327_10001334 3300031251 Bacteria 31995
217 Ga0265316_10002565 3300031344 Bacteria 18770
218 Ga0307513_10010075 3300031456 Bacteria 11904
219 Ga0307513_10195259 3300031456 Bacteria 1871
220 Ga0307513_10211154 3300031456 Bacteria 1772
221 Ga0307513_10258916 3300031456 Bacteria 1531
222 Ga0307509_10007990 3300031507 Bacteria 13634
223 Ga0307509_10109155 3300031507 Bacteria 2778
224 Ga0307509_10138524 3300031507 Bacteria 2374
225 Ga0265313_10010060 3300031595 Bacteria 6050
226 Ga0307508_10002491 3300031616 Bacteria 19419
227 Ga0307508_10044916 3300031616 Bacteria 3949
228 Ga0265314_10004380 3300031711 Bacteria 13132
229 Ga0265342_10002497 3300031712 Bacteria 15841
230 Ga0307516_10001391 3300031730 Bacteria 33410
231 Ga0307516_10145394 3300031730 Bacteria 2137
232 Ga0307405_10122414 3300031731 Bacteria 1782
233 Ga0316577_10158188 3300031733 Bacteria 1278
234 Ga0307406_10071387 3300031901 Bacteria 2276
235 Ga0307412_10156585 3300031911 Bacteria 1687
236 Ga0307409_100245995 3300031995 Bacteria 1632
237 Ga0307416_100262272 3300032002 Bacteria 1690
238 Ga0307411_10292491 3300032005 Bacteria 1302
239 Ga0307507_10108957 3300033179 Bacteria 2274
240 Ga0307507_10146674 3300033179 Bacteria 1790
241 Ga0373938_0013800 3300034957 Bacteria 1540
242 Ga0373938_0033606 3300034957 Bacteria 1110
243 Ga0373926_0011101 3300035083 Bacteria 3027
244 Ga0373926_0012938 3300035083 Bacteria 2826
245 Ga0373923_0000147 3300035111 Bacteria 13643
246 Ga0373923_0023496 3300035111 Bacteria 2426
247 Ga0373936_0005085 3300035113 Bacteria 4951
248 Ga0373936_0090465 3300035113 Bacteria 1283
249 Ga0373941_0000662 3300035115 Bacteria 6973
250 Ga0373945_0028187 3300035116 Bacteria 1966
251 Ga0373953_0035103 3300035117 Bacteria 1969
252 Ga0373953_0059453 3300035117 Bacteria 1560
253 Ga0373956_0004840 3300035119 Bacteria 5390
254 Ga0373956_0112148 3300035119 Bacteria 1270
255 Ga0373956_0116781 3300035119 Bacteria 1245
256 Ga0373957_0060838 3300035120 Bacteria 1463
257 Ga0373943_0128234 3300035170 Bacteria 1355
258 Ga0373955_0019966 3300035172 Bacteria 3360
259 Ga0373955_0084490 3300035172 Bacteria 1800
260 Ga0373955_0129442 3300035172 Bacteria 1472
261 Ga0373942_0000794 3300035207 Bacteria 8718
262 Ga0373962_0004406 3300035242 Bacteria 3402
263 Ga0316574_0047710 3300035398 Bacteria 2659
264 Ga0316574_0397832 3300035398 Bacteria 868
265 Ga0373924_0003695 3300035410 Bacteria 5280
266 Ga0373924_0036914 3300035410 Bacteria 1987
267 Ga0373924_0054206 3300035410 Bacteria 1667
268 Ga0373935_0010906 3300035692 Bacteria 5457
269 Ga0373935_0064729 3300035692 Bacteria 2345
270 Ga0373935_0091565 3300035692 Bacteria 1991
271 Ga0373935_0127961 3300035692 Bacteria 1704
272 Ga0373935_0399079 3300035692 Bacteria 987
273 Ga0373935_0882161 3300035692 Bacteria 662
274 Ga0373927_0174237 3300035695 Bacteria 1411
275 Ga0373933_0024047 3300035724 Bacteria 3487
276 Ga0373933_0068363 3300035724 Bacteria 2157
277 Ga0373933_0114417 3300035724 Bacteria 1685
278 Ga0373933_0352000 3300035724 Bacteria 957
279 Ga0373947_0037442 3300035725 Bacteria 2879
280 Ga0373947_0089663 3300035725 Bacteria 1916
281 Ga0373947_0221047 3300035725 Bacteria 1245
282 Ga0373937_0051584 3300036401 Bacteria 3770
283 Ga0373937_0122683 3300036401 Bacteria 2422
284 Ga0373937_0245717 3300036401 Bacteria 1686
285 Ga0373925_0004361 3300037068 Bacteria 10703
286 Ga0373925_0041216 3300037068 Bacteria 3422
287 Ga0373925_0047295 3300037068 Bacteria 3202
288 Ga0373925_0057575 3300037068 Bacteria 2912
289 Ga0373925_0116500 3300037068 Bacteria 2069
290 Ga0373925_0141929 3300037068 Bacteria 1880
291 Ga0395899_0128285 3300037312 Bacteria 1813
292 Ga0395905_0095170 3300037471 Bacteria 2795
293 Ga0436364_1136910 3300037853 Bacteria 7245
294 Ga0395901_0259271 3300038443 Bacteria 1810
295 Ga0237819_00736 3300038705 Bacteria 10536
296 Ga0237816_01631 3300039145 Bacteria 1808
297 Ga0436365_1911032 3300039437 Bacteria 3679
298 Ga0436360_0378152 3300039438 Bacteria 1636
299 Ga0436360_0759458 3300039438 Bacteria 896
300 Ga0436361_0396482 3300039447 Bacteria 62548
301 Ga0436361_0462475 3300039447 Bacteria 943
302 Ga0436361_1053652 3300039447 Bacteria 1274
303 Ga0436362_0406386 3300039453 Bacteria 1158
304 Ga0450921_001570 3300042123 Bacteria 1403
305 Ga0450888_026002 3300042126 Bacteria 767
306 Ga0450896_004073 3300042133 Bacteria 1970
307 Ga0439460_0076759 3300042461 Bacteria 1043
308 Ga0466966_0052352 3300044684 Bacteria 2593
309 Ga0466964_0002956 3300044706 Bacteria 6142
310 Ga0466964_0129010 3300044706 Bacteria 1149
311 Ga0466971_0043071 3300044719 Bacteria 2028
312 Ga0466970_0004895 3300044765 Bacteria 6613
313 Ga0466959_0007742 3300045049 Bacteria 7551
314 Ga0466959_0199975 3300045049 Bacteria 1392
315 Ga0466958_0128924 3300045836 Bacteria 1587
316 Ga0495592_0019238 3300046454 Bacteria 5195
317 Ga0495592_0105615 3300046454 Bacteria 2000
318 Ga0495592_0180422 3300046454 Bacteria 1438
319 Ga0495592_0303547 3300046454 Bacteria 1037
320 Ga0495603_0010275 3300046455 Bacteria 5667
321 Ga0495629_0014073 3300046459 Bacteria 5762
322 Ga0495629_0024737 3300046459 Bacteria 4274
323 Ga0495641_0005925 3300046461 Bacteria 8060
324 Ga0495641_0012642 3300046461 Bacteria 4704
325 Ga0495651_0002432 3300046462 Bacteria 14373
326 Ga0495651_0006489 3300046462 Bacteria 8941
327 Ga0495651_0094101 3300046462 Bacteria 2243
328 Ga0495651_0203799 3300046462 Bacteria 1382
329 Ga0495653_0011935 3300046463 Bacteria 7096
330 Ga0495653_0037247 3300046463 Bacteria 3823
331 Ga0495653_0054218 3300046463 Bacteria 3064
332 Ga0495580_0000466 3300046472 Bacteria 33634
333 Ga0495580_0010620 3300046472 Bacteria 7162
334 Ga0495580_0013630 3300046472 Bacteria 6199
335 Ga0495580_0088500 3300046472 Bacteria 2156
336 Ga0495582_0031327 3300046473 Bacteria 2922
337 Ga0495582_0032510 3300046473 Bacteria 2868
338 Ga0495639_0024997 3300046475 Bacteria 2632
339 Ga0495639_0112616 3300046475 Bacteria 1293
340 Ga0495662_0004466 3300046476 Bacteria 7027
341 Ga0495662_0096909 3300046476 Bacteria 1442
342 Ga0495664_0037164 3300046477 Bacteria 2873
343 Ga0495664_0091788 3300046477 Bacteria 1826
344 Ga0495584_0000123 3300046491 Bacteria 53094
345 Ga0495594_0070653 3300046499 Bacteria 1941
346 Ga0495583_0000026 3300046506 Bacteria 256777
347 Ga0495583_0010261 3300046506 Bacteria 5489
348 Ga0495608_0021643 3300046511 Bacteria 4413
349 Ga0495608_0366539 3300046511 Bacteria 885
350 Ga0495618_0009994 3300046514 Bacteria 5742
351 Ga0495618_0036147 3300046514 Bacteria 3099
352 Ga0495618_0080052 3300046514 Bacteria 2084
353 Ga0495618_0157720 3300046514 Bacteria 1448
354 Ga0495628_0021991 3300046516 Bacteria 5241
355 Ga0495628_0091744 3300046516 Bacteria 2350
356 Ga0495628_0167940 3300046516 Bacteria 1664
357 Ga0495632_0041897 3300046519 Bacteria 2298
358 Ga0495632_0127306 3300046519 Bacteria 1187
359 Ga0495666_0023474 3300046526 Bacteria 3050
360 Ga0495652_0020718 3300046529 Bacteria 5844
361 Ga0495652_0024394 3300046529 Bacteria 5354
362 Ga0495652_0074090 3300046529 Bacteria 2832
363 Ga0495652_0089967 3300046529 Bacteria 2512
364 Ga0495652_0111707 3300046529 Bacteria 2197
365 Ga0495654_0054862 3300046530 Bacteria 1931
366 Ga0495665_0030582 3300046531 Bacteria 2882
367 Ga0495665_0035048 3300046531 Bacteria 2682
368 Ga0495640_0007859 3300046533 Bacteria 8385
369 Ga0495640_0019425 3300046533 Bacteria 5015
370 Ga0495586_0005623 3300046535 Bacteria 6705
371 Ga0495587_0019019 3300046536 Bacteria 4256
372 Ga0495587_0028904 3300046536 Bacteria 3368
373 Ga0495587_0082196 3300046536 Bacteria 1866
374 Ga0495645_0040635 3300046543 Bacteria 3392
375 Ga0495645_0057719 3300046543 Bacteria 2816
376 Ga0495645_0094115 3300046543 Bacteria 2138
377 Ga0495645_0168058 3300046543 Bacteria 1511
378 Ga0495667_0004159 3300046559 Bacteria 9737
379 Ga0495667_0033874 3300046559 Bacteria 3416
380 Ga0495667_0069433 3300046559 Bacteria 2299
381 Ga0495634_0035105 3300046642 Bacteria 3436
382 Ga0495634_0041028 3300046642 Bacteria 3144
383 Ga0495634_0242617 3300046642 Bacteria 1105
384 Ga0495625_0014779 3300046660 Bacteria 6214
385 Ga0495625_0389097 3300046660 Bacteria 873
386 Ga0495635_0033862 3300046663 Bacteria 3543
387 Ga0495635_0075050 3300046663 Bacteria 2316
388 Ga0495635_0311593 3300046663 Bacteria 1054
389 Ga0495659_0000018 3300046664 Bacteria 75257
390 Ga0495657_0002561 3300046675 Bacteria 15252
391 Ga0495657_0019678 3300046675 Bacteria 4866
392 Ga0495599_0000339 3300046678 Bacteria 27900
393 Ga0495599_0023458 3300046678 Bacteria 3858
394 Ga0495599_0033301 3300046678 Bacteria 3237
395 Ga0495599_0037988 3300046678 Bacteria 3025
396 Ga0495623_0006086 3300046679 Bacteria 7849
397 Ga0495646_0009125 3300046680 Bacteria 6290
398 Ga0495646_0032449 3300046680 Bacteria 3249
399 Ga0495647_0063609 3300046681 Bacteria 1461
400 Ga0495658_0096247 3300046683 Bacteria 1760
401 Ga0495613_0150327 3300046689 Bacteria 1661
402 Ga0495613_0259071 3300046689 Bacteria 1212
403 Ga0495624_0365702 3300046690 Bacteria 867
404 Ga0495600_0012485 3300046809 Bacteria 5314
405 Ga0495600_0047031 3300046809 Bacteria 2814
406 Ga0495600_0053582 3300046809 Bacteria 2634
407 Ga0495581_0010613 3300047315 Bacteria 5324
408 Ga0495581_0040771 3300047315 Bacteria 2686
409 Ga0495604_0011445 3300047317 Bacteria 7044
410 Ga0495604_0212948 3300047317 Bacteria 1334
411 Ga0495636_0023832 3300047318 Bacteria 2480
412 Ga0495674_0003706 3300047319 Bacteria 14855
413 Ga0495674_0027907 3300047319 Bacteria 5154
414 Ga0495674_0028392 3300047319 Bacteria 5101
415 Ga0495674_0072393 3300047319 Bacteria 2973
416 Ga0495674_0124956 3300047319 Bacteria 2171
417 Ga0495674_0125656 3300047319 Bacteria 2164
418 Ga0495674_0225654 3300047319 Bacteria 1547
419 Ga0495674_0254599 3300047319 Bacteria 1444
420 Ga0495672_0001818 3300047320 Bacteria 20410
421 Ga0495676_0279025 3300047321 Bacteria 1132
422 Ga0495680_0024972 3300047322 Bacteria 4948
423 Ga0495680_0062940 3300047322 Bacteria 2850
424 Ga0495680_0084987 3300047322 Bacteria 2383
425 Ga0495675_0004535 3300047444 Bacteria 8421
426 Ga0495675_0072155 3300047444 Bacteria 2178
427 Ga0495677_0001834 3300047445 Bacteria 8490
428 Ga0495685_090606 3300047447 Bacteria 1014
429 Ga0495684_0018892 3300047471 Bacteria 5307
430 Ga0495684_0129385 3300047471 Bacteria 1897
431 Ga0495593_0014131 3300047673 Bacteria 4542
432 Ga0495593_0154353 3300047673 Bacteria 1160
433 Ga0495602_0045686 3300048088 Bacteria 3961
434 Ga0495602_0095644 3300048088 Bacteria 2451
435 Ga0495602_0114727 3300048088 Bacteria 2180
436 Ga0495602_0139325 3300048088 Bacteria 1922
437 Ga0495602_0204393 3300048088 Bacteria 1504
438 Ga0495614_0019312 3300048089 Bacteria 2949
439 Ga0496102_0001045 3300048905 Bacteria 25687
440 Ga0496102_0232959 3300048905 Bacteria 1736
441 Ga0496103_0031374 3300048906 Bacteria 3237
442 Ga0496103_0106743 3300048906 Bacteria 1776
443 Ga0496104_0124650 3300048907 Bacteria 2473
444 Ga0496104_0134162 3300048907 Bacteria 2378
445 Ga0496105_0063025 3300048908 Bacteria 3059
446 Ga0496105_0195308 3300048908 Bacteria 1653
447 Ga0496106_0010983 3300048909 Bacteria 6696
448 Ga0496107_0354570 3300048910 Bacteria 1092
449 Ga0496108_0000041 3300048911 Bacteria 147365
450 Ga0496108_0011457 3300048911 Bacteria 7206
451 Ga0496108_0039840 3300048911 Bacteria 3916
452 Ga0496109_0110971 3300048912 Bacteria 2550
453 Ga0496110_0005954 3300048913 Bacteria 9598
454 Ga0496110_0149363 3300048913 Bacteria 2115
455 Ga0496111_0001142 3300048914 Bacteria 14731
456 Ga0496111_0304933 3300048914 Bacteria 1180
457 Ga0496112_0076949 3300048915 Bacteria 3299
458 Ga0496112_0102515 3300048915 Bacteria 2832
459 Ga0496113_0215194 3300048916 Bacteria 1530
460 Ga0496114_0013956 3300048917 Bacteria 6440
461 Ga0496115_0017554 3300048918 Bacteria 5474
462 Ga0496115_0102903 3300048918 Bacteria 2342
463 Ga0496116_0018495 3300048919 Bacteria 5370
464 Ga0496118_0172876 3300048921 Bacteria 1317
465 Ga0501032_0407499 3300049569 Bacteria 873
466 Ga0501034_0000384 3300049571 Bacteria 75553
467 Ga0501034_0002846 3300049571 Bacteria 20161
468 Ga0501034_0031029 3300049571 Bacteria 5431
469 Ga0501034_0338009 3300049571 Bacteria 1436
470 Ga0501037_0074843 3300049573 Bacteria 2460
471 Ga0501041_0059241 3300049577 Bacteria 2344
472 Ga0501042_0038790 3300049578 Bacteria 3383
473 Ga0501046_0477807 3300049580 Bacteria 894
474 Ga0501070_0388550 3300049586 Bacteria 1130
475 Ga0501077_0137132 3300049593 Bacteria 1552
476 Ga0501079_0256361 3300049741 Bacteria 1367
477 Ga0501080_0067236 3300049742 Bacteria 3333
478 Ga0501080_0210325 3300049742 Bacteria 1782
479 Ga0501044_0738867 3300049823 Bacteria 867
480 nmdc:mga05p37_206467_c1 3300050507 Bacteria 2376
481 nmdc:mga09592_368950_c1 3300050508 Bacteria 1242
482 nmdc:mga0qj67_115310_c1 3300050509 Bacteria 2171
483 nmdc:mga0qj67_163198_c1 3300050509 Bacteria 1809
484 nmdc:mga06r32_213884_c1 3300050510 Bacteria 1916
485 nmdc:mga06r32_24666_c1 3300050510 Bacteria 5585
486 nmdc:mga06r32_300369_c1 3300050510 Bacteria 1592
487 nmdc:mga0rr50_250959_c1 3300050513 Bacteria 1469
488 nmdc:mga0rr50_643011_c1 3300050513 Bacteria 905
489 nmdc:mga08x19_420230_c1 3300050514 Bacteria 939
490 Ga0495601_0129418 3300053077 Bacteria 1643
491 Ga0495601_0415158 3300053077 Bacteria 872
492 Ga0495612_0048938 3300053078 Bacteria 1733
493 Ga0495612_0204404 3300053078 Bacteria 872
494 Ga0495595_0004380 3300053084 Bacteria 5684
495 Ga0495595_0015816 3300053084 Bacteria 3221
496 Ga0495595_0028251 3300053084 Bacteria 2505
497 Ga0495619_0007613 3300053085 Bacteria 6855
498 Ga0495619_0019574 3300053085 Bacteria 4304
499 Ga0495619_0213226 3300053085 Bacteria 1337
500 Ga0500643_061832 3300053087 Bacteria 1050
501 Ga0500644_0111311 3300053088 Bacteria 1055
502 Ga0500647_0068181 3300053091 Bacteria 1711
503 Ga0500592_009215 3300053116 Bacteria 1568
504 Ga0500594_0029574 3300053118 Bacteria 1433
505 Ga0500595_003020 3300053119 Bacteria 8009
506 Ga0500588_0033469 3300053146 Bacteria 1499
507 Ga0500627_0000002 3300053158 Bacteria 235747
508 Ga0500630_135409 3300053159 Bacteria 1069
509 Ga0500596_000031 3300053735 Bacteria 19217
510 Ga0466962_0012086 3300061719 Bacteria 4151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0882161 Ga0373935_0882161_41_649 202
2 3300042126 Ga0450888_026002 Ga0450888_026002_11_646 211
3 3300049742 Ga0501080_0210325 Ga0501080_0210325_101_736 211
4 3300005347 Ga0070668_100002771 Ga0070668_10000277112 216
5 3300025972 Ga0207668_10010415 Ga0207668_100104153 216
6 3300050514 nmdc:mga08x19_420230_c1 nmdc:mga08x19_420230_c1_27_713 226
7 3300044684 Ga0466966_0052352 Ga0466966_0052352_1124_1876 229
8 3300044706 Ga0466964_0002956 Ga0466964_0002956_3559_4311 229
9 3300044719 Ga0466971_0043071 Ga0466971_0043071_856_1608 229
10 3300044765 Ga0466970_0004895 Ga0466970_0004895_585_1337 229
11 3300045049 Ga0466959_0007742 Ga0466959_0007742_5085_5837 229
12 3300061719 Ga0466962_0012086 Ga0466962_0012086_1500_2252 229
13 3300003758 Ga0055532_1001930 Ga0055532_10019302 232
14 3300003760 Ga0055527_1000103 Ga0055527_100010314 232
15 3300003761 Ga0055535_1000209 Ga0055535_100020914 232
16 3300003762 Ga0055542_1001293 Ga0055542_10012938 232
17 3300025228 Ga0209672_100062 Ga0209672_10006292 232
18 3300025229 Ga0209147_100078 Ga0209147_10007892 232
19 3300025242 Ga0209258_100108 Ga0209258_10010892 232
20 3300025272 Ga0209455_1000251 Ga0209455_100025149 232
21 3300028558 Ga0265326_10041604 Ga0265326_100416042 233
22 3300031251 Ga0265327_10000104 Ga0265327_10000104145 233
23 3300039447 Ga0436361_1053652 Ga0436361_1053652_465_1244 235
24 3300033179 Ga0307507_10108957 Ga0307507_101089573 236
25 3300049569 Ga0501032_0407499 Ga0501032_0407499_68_823 236
26 3300005435 Ga0070714_100625640 Ga0070714_1006256401 237
27 3300047319 Ga0495674_0072393 Ga0495674_0072393_1975_2790 237
28 3300045049 Ga0466959_0199975 Ga0466959_0199975_290_1039 239
29 iso_pu_bacteria 2751185782 2753265819 239
30 iso_pu_bacteria 2870782633 2870787860 239
31 3300005468 Ga0070707_100049989 Ga0070707_1000499892 241
32 3300028786 Ga0307517_10204258 Ga0307517_102042582 241
33 iso_pu_bacteria 8047710418 8047715962 241
34 3300006175 Ga0070712_100355791 Ga0070712_1003557912 242
35 3300035117 Ga0373953_0035103 Ga0373953_0035103_56_796 242
36 3300035724 Ga0373933_0024047 Ga0373933_0024047_58_798 242
37 3300036401 Ga0373937_0122683 Ga0373937_0122683_899_1639 242
38 3300037068 Ga0373925_0004361 Ga0373925_0004361_2628_3368 242
39 3300037068 Ga0373925_0116500 Ga0373925_0116500_1162_1902 242
40 3300037853 Ga0436364_1136910 Ga0436364_1136910_5862_6602 242
41 3300046454 Ga0495592_0105615 Ga0495592_0105615_116_856 242
42 3300046462 Ga0495651_0002432 Ga0495651_0002432_8017_8757 242
43 3300046463 Ga0495653_0011935 Ga0495653_0011935_4078_4818 242
44 3300046477 Ga0495664_0091788 Ga0495664_0091788_273_1013 242
45 3300046514 Ga0495618_0009994 Ga0495618_0009994_1191_1931 242
46 3300046516 Ga0495628_0167940 Ga0495628_0167940_177_917 242
47 3300046529 Ga0495652_0020718 Ga0495652_0020718_3961_4701 242
48 3300046533 Ga0495640_0019425 Ga0495640_0019425_3983_4723 242
49 3300046536 Ga0495587_0019019 Ga0495587_0019019_3139_3879 242
50 3300046559 Ga0495667_0004159 Ga0495667_0004159_7732_8472 242
51 3300046663 Ga0495635_0075050 Ga0495635_0075050_510_1250 242
52 3300046675 Ga0495657_0002561 Ga0495657_0002561_4602_5342 242
53 3300046678 Ga0495599_0037988 Ga0495599_0037988_11_751 242
54 3300046680 Ga0495646_0032449 Ga0495646_0032449_201_941 242
55 3300046809 Ga0495600_0047031 Ga0495600_0047031_1612_2352 242
56 3300047319 Ga0495674_0003706 Ga0495674_0003706_5453_6193 242
57 3300047322 Ga0495680_0084987 Ga0495680_0084987_748_1488 242
58 3300047471 Ga0495684_0129385 Ga0495684_0129385_236_976 242
59 3300048088 Ga0495602_0045686 Ga0495602_0045686_1483_2223 242
60 3300053084 Ga0495595_0028251 Ga0495595_0028251_973_1713 242
61 iso_pu_bacteria 2744054611 2744953630 242
62 3300005331 Ga0070670_100218700 Ga0070670_1002187002 243
63 3300005338 Ga0068868_100704217 Ga0068868_1007042171 243
64 3300005347 Ga0070668_100250604 Ga0070668_1002506042 243
65 3300005367 Ga0070667_100616896 Ga0070667_1006168961 243
66 3300005434 Ga0070709_10104308 Ga0070709_101043081 243
67 3300005539 Ga0068853_100421945 Ga0068853_1004219452 243
68 3300005841 Ga0068863_100553946 Ga0068863_1005539462 243
69 3300005842 Ga0068858_100023429 Ga0068858_1000234298 243
70 3300005843 Ga0068860_100028090 Ga0068860_1000280903 243
71 3300005983 Ga0081540_1055828 Ga0081540_10558282 243
72 3300006028 Ga0070717_10092180 Ga0070717_100921802 243
73 3300009098 Ga0105245_10829488 Ga0105245_108294882 243
74 3300009147 Ga0114129_10307472 Ga0114129_103074722 243
75 3300013297 Ga0157378_10222067 Ga0157378_102220672 243
76 3300025942 Ga0207689_10401220 Ga0207689_104012202 243
77 3300025944 Ga0207661_10262523 Ga0207661_102625232 243
78 3300025972 Ga0207668_10179523 Ga0207668_101795232 243
79 3300025986 Ga0207658_10127346 Ga0207658_101273463 243
80 3300026095 Ga0207676_10217654 Ga0207676_102176542 243
81 3300028786 Ga0307517_10083105 Ga0307517_100831053 243
82 3300028794 Ga0307515_10008714 Ga0307515_1000871415 243
83 3300028794 Ga0307515_10043536 Ga0307515_100435364 243
84 3300030522 Ga0307512_10026940 Ga0307512_100269402 243
85 3300031456 Ga0307513_10010075 Ga0307513_100100754 243
86 3300031456 Ga0307513_10211154 Ga0307513_102111542 243
87 3300031456 Ga0307513_10258916 Ga0307513_102589162 243
88 3300031507 Ga0307509_10007990 Ga0307509_100079904 243
89 3300031616 Ga0307508_10002491 Ga0307508_1000249116 243
90 3300031616 Ga0307508_10044916 Ga0307508_100449162 243
91 3300031730 Ga0307516_10001391 Ga0307516_1000139124 243
92 3300031730 Ga0307516_10145394 Ga0307516_101453942 243
93 3300031733 Ga0316577_10158188 Ga0316577_101581882 243
94 3300031901 Ga0307406_10071387 Ga0307406_100713872 243
95 3300031995 Ga0307409_100245995 Ga0307409_1002459951 243
96 3300032002 Ga0307416_100262272 Ga0307416_1002622722 243
97 3300035398 Ga0316574_0047710 Ga0316574_0047710_465_1220 243
98 3300035692 Ga0373935_0010906 Ga0373935_0010906_3267_4004 243
99 3300045836 Ga0466958_0128924 Ga0466958_0128924_432_1259 243
100 3300046519 Ga0495632_0041897 Ga0495632_0041897_1395_2135 243
101 3300046519 Ga0495632_0127306 Ga0495632_0127306_202_939 243
102 3300048911 Ga0496108_0000041 Ga0496108_0000041_85631_86368 243
103 3300050513 nmdc:mga0rr50_250959_c1 nmdc:mga0rr50_250959_c1_685_1425 243
104 3300053118 Ga0500594_0029574 Ga0500594_0029574_278_1018 243
105 3300053159 Ga0500630_135409 Ga0500630_135409_99_839 243
106 3300005338 Ga0068868_100122815 Ga0068868_1001228152 244
107 3300005434 Ga0070709_10032498 Ga0070709_100324983 244
108 3300005435 Ga0070714_100043027 Ga0070714_1000430272 244
109 3300005435 Ga0070714_100073810 Ga0070714_1000738102 244
110 3300005435 Ga0070714_100611116 Ga0070714_1006111161 244
111 3300005436 Ga0070713_100028818 Ga0070713_1000288183 244
112 3300005436 Ga0070713_100161365 Ga0070713_1001613652 244
113 3300005436 Ga0070713_100461444 Ga0070713_1004614442 244
114 3300005437 Ga0070710_10011934 Ga0070710_100119343 244
115 3300005437 Ga0070710_10025429 Ga0070710_100254292 244
116 3300005547 Ga0070693_100379360 Ga0070693_1003793601 244
117 3300005618 Ga0068864_100598144 Ga0068864_1005981441 244
118 3300005842 Ga0068858_100031738 Ga0068858_1000317385 244
119 3300006028 Ga0070717_10263813 Ga0070717_102638132 244
120 3300006173 Ga0070716_100249191 Ga0070716_1002491912 244
121 3300006175 Ga0070712_100106467 Ga0070712_1001064672 244
122 3300006175 Ga0070712_100130813 Ga0070712_1001308132 244
123 3300006175 Ga0070712_100169996 Ga0070712_1001699962 244
124 3300007076 Ga0075435_100367433 Ga0075435_1003674332 244
125 3300009545 Ga0105237_10305317 Ga0105237_103053172 244
126 3300009551 Ga0105238_10319956 Ga0105238_103199562 244
127 3300013105 Ga0157369_10262634 Ga0157369_102626342 244
128 3300013307 Ga0157372_10880232 Ga0157372_108802322 244
129 3300014325 Ga0163163_10330570 Ga0163163_103305703 244
130 3300014969 Ga0157376_10040783 Ga0157376_100407833 244
131 3300025898 Ga0207692_10062971 Ga0207692_100629712 244
132 3300025898 Ga0207692_10094059 Ga0207692_100940592 244
133 3300025915 Ga0207693_10216382 Ga0207693_102163821 244
134 3300025929 Ga0207664_10043733 Ga0207664_100437332 244
135 3300025929 Ga0207664_10674177 Ga0207664_106741771 244
136 3300025939 Ga0207665_10259126 Ga0207665_102591262 244
137 3300026035 Ga0207703_10157464 Ga0207703_101574641 244
138 3300026078 Ga0207702_10047109 Ga0207702_100471093 244
139 3300026078 Ga0207702_10076903 Ga0207702_100769034 244
140 3300026078 Ga0207702_10304279 Ga0207702_103042792 244
141 3300026095 Ga0207676_10251514 Ga0207676_102515142 244
142 3300026116 Ga0207674_10166233 Ga0207674_101662333 244
143 3300034957 Ga0373938_0033606 Ga0373938_0033606_312_1052 244
144 3300035083 Ga0373926_0012938 Ga0373926_0012938_691_1434 244
145 3300035111 Ga0373923_0000147 Ga0373923_0000147_6363_7106 244
146 3300035113 Ga0373936_0005085 Ga0373936_0005085_313_1056 244
147 3300035113 Ga0373936_0090465 Ga0373936_0090465_356_1120 244
148 3300035115 Ga0373941_0000662 Ga0373941_0000662_1285_2025 244
149 3300035116 Ga0373945_0028187 Ga0373945_0028187_131_874 244
150 3300035117 Ga0373953_0059453 Ga0373953_0059453_180_923 244
151 3300035119 Ga0373956_0004840 Ga0373956_0004840_4245_4988 244
152 3300035119 Ga0373956_0112148 Ga0373956_0112148_441_1184 244
153 3300035120 Ga0373957_0060838 Ga0373957_0060838_127_891 244
154 3300035170 Ga0373943_0128234 Ga0373943_0128234_135_878 244
155 3300035172 Ga0373955_0019966 Ga0373955_0019966_1851_2594 244
156 3300035172 Ga0373955_0129442 Ga0373955_0129442_36_779 244
157 3300035207 Ga0373942_0000794 Ga0373942_0000794_4146_4886 244
158 3300035242 Ga0373962_0004406 Ga0373962_0004406_465_1205 244
159 3300035410 Ga0373924_0003695 Ga0373924_0003695_2723_3466 244
160 3300035410 Ga0373924_0036914 Ga0373924_0036914_48_791 244
161 3300035692 Ga0373935_0091565 Ga0373935_0091565_180_923 244
162 3300035692 Ga0373935_0399079 Ga0373935_0399079_220_963 244
163 3300035695 Ga0373927_0174237 Ga0373927_0174237_290_1036 244
164 3300035724 Ga0373933_0068363 Ga0373933_0068363_1389_2132 244
165 3300035724 Ga0373933_0114417 Ga0373933_0114417_120_863 244
166 3300035725 Ga0373947_0037442 Ga0373947_0037442_1985_2728 244
167 3300035725 Ga0373947_0089663 Ga0373947_0089663_179_922 244
168 3300035725 Ga0373947_0221047 Ga0373947_0221047_217_960 244
169 3300036401 Ga0373937_0245717 Ga0373937_0245717_36_779 244
170 3300037068 Ga0373925_0047295 Ga0373925_0047295_2074_2817 244
171 3300037068 Ga0373925_0057575 Ga0373925_0057575_1001_1744 244
172 3300037068 Ga0373925_0141929 Ga0373925_0141929_1005_1748 244
173 3300039453 Ga0436362_0406386 Ga0436362_0406386_157_903 244
174 3300042123 Ga0450921_001570 Ga0450921_001570_371_1105 244
175 3300046454 Ga0495592_0019238 Ga0495592_0019238_4195_4938 244
176 3300046454 Ga0495592_0180422 Ga0495592_0180422_558_1301 244
177 3300046455 Ga0495603_0010275 Ga0495603_0010275_2925_3668 244
178 3300046459 Ga0495629_0014073 Ga0495629_0014073_4407_5150 244
179 3300046461 Ga0495641_0005925 Ga0495641_0005925_6804_7547 244
180 3300046461 Ga0495641_0012642 Ga0495641_0012642_999_1742 244
181 3300046462 Ga0495651_0006489 Ga0495651_0006489_6798_7541 244
182 3300046462 Ga0495651_0203799 Ga0495651_0203799_179_922 244
183 3300046463 Ga0495653_0037247 Ga0495653_0037247_2844_3587 244
184 3300046463 Ga0495653_0054218 Ga0495653_0054218_216_959 244
185 3300046472 Ga0495580_0088500 Ga0495580_0088500_505_1248 244
186 3300046473 Ga0495582_0031327 Ga0495582_0031327_1228_1971 244
187 3300046473 Ga0495582_0032510 Ga0495582_0032510_706_1449 244
188 3300046475 Ga0495639_0024997 Ga0495639_0024997_1355_2098 244
189 3300046475 Ga0495639_0112616 Ga0495639_0112616_14_760 244
190 3300046476 Ga0495662_0004466 Ga0495662_0004466_1354_2097 244
191 3300046477 Ga0495664_0037164 Ga0495664_0037164_79_822 244
192 3300046499 Ga0495594_0070653 Ga0495594_0070653_1059_1802 244
193 3300046511 Ga0495608_0021643 Ga0495608_0021643_2254_2997 244
194 3300046511 Ga0495608_0366539 Ga0495608_0366539_23_766 244
195 3300046514 Ga0495618_0036147 Ga0495618_0036147_242_985 244
196 3300046514 Ga0495618_0080052 Ga0495618_0080052_1052_1795 244
197 3300046516 Ga0495628_0021991 Ga0495628_0021991_258_1001 244
198 3300046516 Ga0495628_0091744 Ga0495628_0091744_1042_1785 244
199 3300046526 Ga0495666_0023474 Ga0495666_0023474_957_1700 244
200 3300046529 Ga0495652_0024394 Ga0495652_0024394_3352_4095 244
201 3300046529 Ga0495652_0074090 Ga0495652_0074090_34_777 244
202 3300046529 Ga0495652_0089967 Ga0495652_0089967_150_893 244
203 3300046529 Ga0495652_0111707 Ga0495652_0111707_628_1374 244
204 3300046531 Ga0495665_0030582 Ga0495665_0030582_1255_1998 244
205 3300046531 Ga0495665_0035048 Ga0495665_0035048_901_1644 244
206 3300046533 Ga0495640_0007859 Ga0495640_0007859_5407_6150 244
207 3300046535 Ga0495586_0005623 Ga0495586_0005623_4921_5664 244
208 3300046536 Ga0495587_0028904 Ga0495587_0028904_1105_1848 244
209 3300046536 Ga0495587_0082196 Ga0495587_0082196_1088_1831 244
210 3300046543 Ga0495645_0040635 Ga0495645_0040635_2052_2795 244
211 3300046543 Ga0495645_0057719 Ga0495645_0057719_1042_1785 244
212 3300046543 Ga0495645_0168058 Ga0495645_0168058_526_1272 244
213 3300046559 Ga0495667_0033874 Ga0495667_0033874_236_979 244
214 3300046559 Ga0495667_0069433 Ga0495667_0069433_33_776 244
215 3300046642 Ga0495634_0041028 Ga0495634_0041028_1356_2099 244
216 3300046642 Ga0495634_0242617 Ga0495634_0242617_280_1023 244
217 3300046663 Ga0495635_0033862 Ga0495635_0033862_1999_2742 244
218 3300046663 Ga0495635_0311593 Ga0495635_0311593_131_874 244
219 3300046675 Ga0495657_0019678 Ga0495657_0019678_2116_2859 244
220 3300046678 Ga0495599_0023458 Ga0495599_0023458_2558_3301 244
221 3300046678 Ga0495599_0033301 Ga0495599_0033301_2265_3008 244
222 3300046680 Ga0495646_0009125 Ga0495646_0009125_1340_2083 244
223 3300046681 Ga0495647_0063609 Ga0495647_0063609_91_834 244
224 3300046683 Ga0495658_0096247 Ga0495658_0096247_312_1055 244
225 3300046689 Ga0495613_0150327 Ga0495613_0150327_517_1260 244
226 3300046689 Ga0495613_0259071 Ga0495613_0259071_209_952 244
227 3300046690 Ga0495624_0365702 Ga0495624_0365702_13_756 244
228 3300046809 Ga0495600_0012485 Ga0495600_0012485_1253_1996 244
229 3300046809 Ga0495600_0053582 Ga0495600_0053582_536_1279 244
230 3300047315 Ga0495581_0010613 Ga0495581_0010613_3375_4118 244
231 3300047315 Ga0495581_0040771 Ga0495581_0040771_756_1499 244
232 3300047317 Ga0495604_0011445 Ga0495604_0011445_3322_4065 244
233 3300047317 Ga0495604_0212948 Ga0495604_0212948_325_1068 244
234 3300047319 Ga0495674_0027907 Ga0495674_0027907_2208_2951 244
235 3300047319 Ga0495674_0124956 Ga0495674_0124956_1026_1769 244
236 3300047319 Ga0495674_0125656 Ga0495674_0125656_206_949 244
237 3300047319 Ga0495674_0225654 Ga0495674_0225654_289_1035 244
238 3300047321 Ga0495676_0279025 Ga0495676_0279025_376_1119 244
239 3300047322 Ga0495680_0024972 Ga0495680_0024972_1188_1931 244
240 3300047322 Ga0495680_0062940 Ga0495680_0062940_258_1001 244
241 3300047444 Ga0495675_0004535 Ga0495675_0004535_1009_1752 244
242 3300047444 Ga0495675_0072155 Ga0495675_0072155_1241_1984 244
243 3300047471 Ga0495684_0018892 Ga0495684_0018892_257_1000 244
244 3300047673 Ga0495593_0014131 Ga0495593_0014131_2778_3521 244
245 3300047673 Ga0495593_0154353 Ga0495593_0154353_181_924 244
246 3300048088 Ga0495602_0095644 Ga0495602_0095644_381_1124 244
247 3300048088 Ga0495602_0114727 Ga0495602_0114727_902_1645 244
248 3300048088 Ga0495602_0139325 Ga0495602_0139325_38_781 244
249 3300048089 Ga0495614_0019312 Ga0495614_0019312_1858_2601 244
250 3300048905 Ga0496102_0001045 Ga0496102_0001045_18472_19218 244
251 3300048906 Ga0496103_0031374 Ga0496103_0031374_194_940 244
252 3300048907 Ga0496104_0124650 Ga0496104_0124650_1272_2015 244
253 3300048908 Ga0496105_0063025 Ga0496105_0063025_1359_2102 244
254 3300048911 Ga0496108_0011457 Ga0496108_0011457_3793_4536 244
255 3300048913 Ga0496110_0149363 Ga0496110_0149363_215_958 244
256 3300048914 Ga0496111_0304933 Ga0496111_0304933_370_1113 244
257 3300048915 Ga0496112_0102515 Ga0496112_0102515_1065_1808 244
258 3300048916 Ga0496113_0215194 Ga0496113_0215194_684_1427 244
259 3300049578 Ga0501042_0038790 Ga0501042_0038790_768_1514 244
260 3300050513 nmdc:mga0rr50_643011_c1 nmdc:mga0rr50_643011_c1_29_772 244
261 3300053077 Ga0495601_0129418 Ga0495601_0129418_230_973 244
262 3300053078 Ga0495612_0048938 Ga0495612_0048938_421_1164 244
263 3300053084 Ga0495595_0004380 Ga0495595_0004380_3917_4660 244
264 3300053084 Ga0495595_0015816 Ga0495595_0015816_2275_3018 244
265 3300053085 Ga0495619_0007613 Ga0495619_0007613_5147_5890 244
266 3300053085 Ga0495619_0019574 Ga0495619_0019574_1245_1988 244
267 3300053085 Ga0495619_0213226 Ga0495619_0213226_334_1077 244
268 3300053088 Ga0500644_0111311 Ga0500644_0111311_232_978 244
269 3300005435 Ga0070714_100232846 Ga0070714_1002328462 245
270 3300005436 Ga0070713_100010434 Ga0070713_1000104346 245
271 3300005445 Ga0070708_100035685 Ga0070708_1000356853 245
272 3300005468 Ga0070707_100101437 Ga0070707_1001014372 245
273 3300006028 Ga0070717_10081359 Ga0070717_100813592 245
274 3300006175 Ga0070712_100051032 Ga0070712_1000510323 245
275 3300013105 Ga0157369_10047435 Ga0157369_100474354 245
276 3300025915 Ga0207693_10203018 Ga0207693_102030182 245
277 3300025922 Ga0207646_10099584 Ga0207646_100995843 245
278 3300025929 Ga0207664_10447951 Ga0207664_104479512 245
279 3300028556 Ga0265337_1000136 Ga0265337_10001366 245
280 3300028558 Ga0265326_10000701 Ga0265326_100007016 245
281 3300028563 Ga0265319_1001835 Ga0265319_10018356 245
282 3300028573 Ga0265334_10000468 Ga0265334_1000046811 245
283 3300028653 Ga0265323_10001755 Ga0265323_100017555 245
284 3300028654 Ga0265322_10001776 Ga0265322_100017763 245
285 3300028666 Ga0265336_10001798 Ga0265336_100017986 245
286 3300028800 Ga0265338_10009448 Ga0265338_100094486 245
287 3300029957 Ga0265324_10001624 Ga0265324_100016246 245
288 3300031238 Ga0265332_10001612 Ga0265332_100016128 245
289 3300031240 Ga0265320_10002827 Ga0265320_100028276 245
290 3300031241 Ga0265325_10006977 Ga0265325_100069774 245
291 3300031247 Ga0265340_10023192 Ga0265340_100231923 245
292 3300031344 Ga0265316_10002565 Ga0265316_1000256519 245
293 3300031456 Ga0307513_10195259 Ga0307513_101952592 245
294 3300031507 Ga0307509_10138524 Ga0307509_101385242 245
295 3300031595 Ga0265313_10010060 Ga0265313_100100602 245
296 3300031711 Ga0265314_10004380 Ga0265314_100043806 245
297 3300031712 Ga0265342_10002497 Ga0265342_1000249712 245
298 3300033179 Ga0307507_10146674 Ga0307507_101466742 245
299 3300035083 Ga0373926_0011101 Ga0373926_0011101_63_809 245
300 3300046459 Ga0495629_0024737 Ga0495629_0024737_1219_1968 245
301 3300046642 Ga0495634_0035105 Ga0495634_0035105_1942_2688 245
302 3300048918 Ga0496115_0102903 Ga0496115_0102903_1035_1781 245
303 iso_pu_bacteria 2554235231 2555248798 245
304 iso_pu_bacteria 2599185161 2599364148 245
305 iso_pu_bacteria 2599185162 2599370468 245
306 iso_pu_bacteria 2599185163 2599377387 245
307 iso_pu_bacteria 2599185166 2599395693 245
308 iso_pu_bacteria 2599185168 2599408430 245
309 iso_pu_bacteria 2939651529 2939653770 245
310 3300005327 Ga0070658_10007745 Ga0070658_100077455 246
311 3300005459 Ga0068867_100449265 Ga0068867_1004492651 246
312 3300005518 Ga0070699_100154238 Ga0070699_1001542382 246
313 3300005536 Ga0070697_100021918 Ga0070697_1000219185 246
314 3300005563 Ga0068855_100146500 Ga0068855_1001465004 246
315 3300005577 Ga0068857_100476935 Ga0068857_1004769352 246
316 3300013105 Ga0157369_10388678 Ga0157369_103886782 246
317 3300020081 Ga0206354_11368094 Ga0206354_113680944 246
318 3300020082 Ga0206353_10656357 Ga0206353_106563572 246
319 3300025904 Ga0207647_10080857 Ga0207647_100808572 246
320 3300025909 Ga0207705_10018322 Ga0207705_100183225 246
321 3300025915 Ga0207693_10086339 Ga0207693_100863392 246
322 3300025949 Ga0207667_10215950 Ga0207667_102159502 246
323 3300026067 Ga0207678_10076889 Ga0207678_100768893 246
324 3300028800 Ga0265338_10159528 Ga0265338_101595282 246
325 3300031251 Ga0265327_10000774 Ga0265327_1000077439 246
326 3300031251 Ga0265327_10001334 Ga0265327_1000133417 246
327 3300034957 Ga0373938_0013800 Ga0373938_0013800_535_1311 246
328 3300035692 Ga0373935_0064729 Ga0373935_0064729_550_1323 246
329 3300039438 Ga0436360_0378152 Ga0436360_0378152_739_1497 246
330 3300039438 Ga0436360_0759458 Ga0436360_0759458_116_874 246
331 3300047319 Ga0495674_0254599 Ga0495674_0254599_328_1086 246
332 3300049573 Ga0501037_0074843 Ga0501037_0074843_1605_2399 246
333 3300053077 Ga0495601_0415158 Ga0495601_0415158_91_849 246
334 3300053078 Ga0495612_0204404 Ga0495612_0204404_62_835 246
335 iso_pu_bacteria 2510917013 2511094126 246
336 iso_pu_bacteria 2511231024 2511375391 246
337 iso_pu_bacteria 2738543024 2739306784 246
338 iso_pu_bacteria 3007803356 3007805450 246
339 iso_pu_bacteria 8002285264 8002286007 246
340 3300005937 Ga0081455_10054664 Ga0081455_100546643 247
341 3300044706 Ga0466964_0129010 Ga0466964_0129010_190_1023 247
342 3300049586 Ga0501070_0388550 Ga0501070_0388550_20_799 247
343 3300003758 Ga0055532_1001927 Ga0055532_10019272 248
344 3300005339 Ga0070660_100118361 Ga0070660_1001183612 248
345 3300005367 Ga0070667_100545757 Ga0070667_1005457572 248
346 3300005548 Ga0070665_100001428 Ga0070665_10000142822 248
347 3300005563 Ga0068855_100002217 Ga0068855_10000221711 248
348 3300005563 Ga0068855_100214837 Ga0068855_1002148372 248
349 3300005563 Ga0068855_100424118 Ga0068855_1004241181 248
350 3300009545 Ga0105237_10247412 Ga0105237_102474122 248
351 3300009551 Ga0105238_10002317 Ga0105238_100023172 248
352 3300015262 Ga0182007_10014081 Ga0182007_100140814 248
353 3300021361 Ga0213872_10000311 Ga0213872_1000031126 248
354 3300025225 Ga0209566_100365 Ga0209566_10036528 248
355 3300025226 Ga0209674_104697 Ga0209674_1046972 248
356 3300025229 Ga0209147_100061 Ga0209147_100061211 248
357 3300025294 Ga0209025_1000034 Ga0209025_1000034303 248
358 3300025303 Ga0209051_1029255 Ga0209051_10292552 248
359 3300025924 Ga0207694_10001252 Ga0207694_100012527 248
360 3300025949 Ga0207667_10007751 Ga0207667_100077518 248
361 3300025949 Ga0207667_10263707 Ga0207667_102637072 248
362 3300025949 Ga0207667_10372274 Ga0207667_103722742 248
363 3300026078 Ga0207702_10237003 Ga0207702_102370032 248
364 3300028379 Ga0268266_10000945 Ga0268266_100009458 248
365 3300031251 Ga0265327_10000229 Ga0265327_10000229111 248
366 3300031731 Ga0307405_10122414 Ga0307405_101224142 248
367 3300032005 Ga0307411_10292491 Ga0307411_102924912 248
368 3300035398 Ga0316574_0397832 Ga0316574_0397832_46_798 248
369 3300037312 Ga0395899_0128285 Ga0395899_0128285_954_1709 248
370 3300037471 Ga0395905_0095170 Ga0395905_0095170_357_1112 248
371 3300038443 Ga0395901_0259271 Ga0395901_0259271_239_994 248
372 3300039437 Ga0436365_1911032 Ga0436365_1911032_599_1408 248
373 3300039447 Ga0436361_0396482 Ga0436361_0396482_22606_23367 248
374 3300039447 Ga0436361_0462475 Ga0436361_0462475_129_881 248
375 3300046491 Ga0495584_0000123 Ga0495584_0000123_29762_30520 248
376 3300046506 Ga0495583_0000026 Ga0495583_0000026_54258_55013 248
377 3300046664 Ga0495659_0000018 Ga0495659_0000018_20442_21224 248
378 3300046678 Ga0495599_0000339 Ga0495599_0000339_6188_6961 248
379 3300046679 Ga0495623_0006086 Ga0495623_0006086_6029_6802 248
380 3300047318 Ga0495636_0023832 Ga0495636_0023832_197_982 248
381 3300047320 Ga0495672_0001818 Ga0495672_0001818_969_1751 248
382 3300047447 Ga0495685_090606 Ga0495685_090606_79_855 248
383 3300048088 Ga0495602_0204393 Ga0495602_0204393_738_1493 248
384 3300048905 Ga0496102_0232959 Ga0496102_0232959_477_1271 248
385 3300048919 Ga0496116_0018495 Ga0496116_0018495_1550_2344 248
386 3300048921 Ga0496118_0172876 Ga0496118_0172876_285_1043 248
387 3300049571 Ga0501034_0000384 Ga0501034_0000384_58483_59286 248
388 3300049571 Ga0501034_0002846 Ga0501034_0002846_4100_4864 248
389 3300049571 Ga0501034_0031029 Ga0501034_0031029_3029_3793 248
390 3300049571 Ga0501034_0338009 Ga0501034_0338009_130_909 248
391 3300049742 Ga0501080_0067236 Ga0501080_0067236_2485_3255 248
392 3300049823 Ga0501044_0738867 Ga0501044_0738867_55_810 248
393 3300053087 Ga0500643_061832 Ga0500643_061832_159_905 248
394 3300053091 Ga0500647_0068181 Ga0500647_0068181_502_1257 248
395 3300053119 Ga0500595_003020 Ga0500595_003020_1650_2405 248
396 3300053146 Ga0500588_0033469 Ga0500588_0033469_53_808 248
397 iso_pu_bacteria 2501025502 2501079788 248
398 iso_pu_bacteria 2513237150 2513953720 248
399 iso_pu_bacteria 2513237165 2514040376 248
400 iso_pu_bacteria 2599185239 2599734803 248
401 iso_pu_bacteria 2744054900 2746091356 248
402 iso_pu_bacteria 2744054901 2746097789 248
403 iso_pu_bacteria 2818991452 2819635751 248
404 iso_pu_bacteria 2842324504 2842325294 248
405 iso_pu_bacteria 2842348783 2842349573 248
406 iso_pu_bacteria 2842454564 2842455189 248
407 iso_pu_bacteria 2858688981 2858690130 248
408 iso_pu_bacteria 2870068957 2870075397 248
409 iso_pu_bacteria 2900634093 2900640226 248
410 iso_pu_bacteria 2928170801 2928175257 248
411 iso_pu_bacteria 2981990288 2981992540 248
412 iso_pu_bacteria 641736154 642418583 248
413 iso_pu_bacteria 644736347 644750555 248
414 iso_pu_bacteria 8018845410 8018847869 248
415 iso_pu_bacteria 8021120328 8021121832 248
416 3300003322 rootL2_10164656 rootL2_101646562 249
417 3300005328 Ga0070676_10006570 Ga0070676_100065705 249
418 3300005335 Ga0070666_10064701 Ga0070666_100647013 249
419 3300005341 Ga0070691_10054011 Ga0070691_100540112 249
420 3300005347 Ga0070668_100036337 Ga0070668_1000363374 249
421 3300005355 Ga0070671_100024285 Ga0070671_1000242851 249
422 3300005356 Ga0070674_100012675 Ga0070674_1000126751 249
423 3300005364 Ga0070673_100026276 Ga0070673_1000262764 249
424 3300005366 Ga0070659_100413529 Ga0070659_1004135291 249
425 3300005437 Ga0070710_10002583 Ga0070710_100025838 249
426 3300005444 Ga0070694_100298496 Ga0070694_1002984962 249
427 3300005456 Ga0070678_100001371 Ga0070678_10000137111 249
428 3300005457 Ga0070662_100067085 Ga0070662_1000670852 249
429 3300005543 Ga0070672_100383445 Ga0070672_1003834451 249
430 3300005547 Ga0070693_100079426 Ga0070693_1000794262 249
431 3300005549 Ga0070704_100219440 Ga0070704_1002194402 249
432 3300005563 Ga0068855_100197368 Ga0068855_1001973683 249
433 3300005718 Ga0068866_10027292 Ga0068866_100272923 249
434 3300005840 Ga0068870_10009358 Ga0068870_100093582 249
435 3300005842 Ga0068858_100033104 Ga0068858_1000331045 249
436 3300005843 Ga0068860_100006204 Ga0068860_1000062044 249
437 3300005844 Ga0068862_100011608 Ga0068862_1000116083 249
438 3300006163 Ga0070715_10000618 Ga0070715_100006188 249
439 3300006175 Ga0070712_100073392 Ga0070712_1000733921 249
440 3300006175 Ga0070712_100148673 Ga0070712_1001486732 249
441 3300006237 Ga0097621_100043869 Ga0097621_1000438693 249
442 3300006844 Ga0075428_100003036 Ga0075428_10000303620 249
443 3300006844 Ga0075428_100224042 Ga0075428_1002240422 249
444 3300006846 Ga0075430_100253487 Ga0075430_1002534872 249
445 3300006846 Ga0075430_100353476 Ga0075430_1003534761 249
446 3300006847 Ga0075431_100027540 Ga0075431_1000275405 249
447 3300006847 Ga0075431_100285608 Ga0075431_1002856082 249
448 3300006847 Ga0075431_100366999 Ga0075431_1003669992 249
449 3300006880 Ga0075429_100063985 Ga0075429_1000639852 249
450 3300006881 Ga0068865_100464061 Ga0068865_1004640611 249
451 3300009098 Ga0105245_10030968 Ga0105245_100309681 249
452 3300009101 Ga0105247_10023102 Ga0105247_100231023 249
453 3300009147 Ga0114129_10858044 Ga0114129_108580441 249
454 3300009174 Ga0105241_10011887 Ga0105241_100118873 249
455 3300009176 Ga0105242_10007934 Ga0105242_100079342 249
456 3300010375 Ga0105239_10009458 Ga0105239_100094586 249
457 3300013296 Ga0157374_10057897 Ga0157374_100578973 249
458 3300014325 Ga0163163_10104254 Ga0163163_101042543 249
459 3300014968 Ga0157379_10119526 Ga0157379_101195263 249
460 3300014969 Ga0157376_10185312 Ga0157376_101853121 249
461 3300025261 Ga0209233_1006721 Ga0209233_10067212 249
462 3300025899 Ga0207642_10084595 Ga0207642_100845952 249
463 3300025900 Ga0207710_10049501 Ga0207710_100495012 249
464 3300025905 Ga0207685_10005718 Ga0207685_100057182 249
465 3300025906 Ga0207699_10011325 Ga0207699_100113252 249
466 3300025907 Ga0207645_10001237 Ga0207645_1000123712 249
467 3300025908 Ga0207643_10012781 Ga0207643_100127814 249
468 3300025915 Ga0207693_10000161 Ga0207693_1000016157 249
469 3300025915 Ga0207693_10164120 Ga0207693_101641202 249
470 3300025916 Ga0207663_10098440 Ga0207663_100984402 249
471 3300025928 Ga0207700_10006538 Ga0207700_100065386 249
472 3300025933 Ga0207706_10031269 Ga0207706_100312692 249
473 3300025938 Ga0207704_10655149 Ga0207704_106551491 249
474 3300025939 Ga0207665_10010659 Ga0207665_100106592 249
475 3300025940 Ga0207691_10001275 Ga0207691_1000127514 249
476 3300025986 Ga0207658_10052002 Ga0207658_100520024 249
477 3300026075 Ga0207708_10017628 Ga0207708_100176286 249
478 3300026089 Ga0207648_10006902 Ga0207648_100069023 249
479 3300026118 Ga0207675_100007183 Ga0207675_10000718311 249
480 3300026121 Ga0207683_10014642 Ga0207683_100146425 249
481 3300027378 Ga0209981_1024901 Ga0209981_10249011 249
482 3300027424 Ga0209984_1018162 Ga0209984_10181622 249
483 3300027552 Ga0209982_1021923 Ga0209982_10219232 249
484 3300027617 Ga0210002_1025289 Ga0210002_10252892 249
485 3300027665 Ga0209983_1000778 Ga0209983_10007783 249
486 3300027682 Ga0209971_1000645 Ga0209971_10006459 249
487 3300027717 Ga0209998_10000369 Ga0209998_100003697 249
488 3300027876 Ga0209974_10000695 Ga0209974_100006956 249
489 3300027907 Ga0207428_10129090 Ga0207428_101290902 249
490 3300028380 Ga0268265_10139025 Ga0268265_101390252 249
491 3300028380 Ga0268265_10143935 Ga0268265_101439352 249
492 3300031507 Ga0307509_10109155 Ga0307509_101091553 249
493 3300031911 Ga0307412_10156585 Ga0307412_101565852 249
494 3300035111 Ga0373923_0023496 Ga0373923_0023496_923_1672 249
495 3300035119 Ga0373956_0116781 Ga0373956_0116781_68_817 249
496 3300035172 Ga0373955_0084490 Ga0373955_0084490_329_1078 249
497 3300035410 Ga0373924_0054206 Ga0373924_0054206_191_940 249
498 3300035692 Ga0373935_0127961 Ga0373935_0127961_133_882 249
499 3300035724 Ga0373933_0352000 Ga0373933_0352000_56_805 249
500 3300036401 Ga0373937_0051584 Ga0373937_0051584_1941_2690 249
501 3300037068 Ga0373925_0041216 Ga0373925_0041216_1070_1819 249
502 3300038705 Ga0237819_00736 Ga0237819_00736_6813_7562 249
503 3300039145 Ga0237816_01631 Ga0237816_01631_107_856 249
504 3300042133 Ga0450896_004073 Ga0450896_004073_126_875 249
505 3300042461 Ga0439460_0076759 Ga0439460_0076759_19_768 249
506 3300046454 Ga0495592_0303547 Ga0495592_0303547_13_762 249
507 3300046462 Ga0495651_0094101 Ga0495651_0094101_178_927 249
508 3300046472 Ga0495580_0000466 Ga0495580_0000466_13212_13961 249
509 3300046472 Ga0495580_0010620 Ga0495580_0010620_2684_3433 249
510 3300046472 Ga0495580_0013630 Ga0495580_0013630_650_1399 249
511 3300046476 Ga0495662_0096909 Ga0495662_0096909_351_1100 249
512 3300046506 Ga0495583_0010261 Ga0495583_0010261_2532_3281 249
513 3300046514 Ga0495618_0157720 Ga0495618_0157720_178_927 249
514 3300046530 Ga0495654_0054862 Ga0495654_0054862_162_911 249
515 3300046543 Ga0495645_0094115 Ga0495645_0094115_1289_2038 249
516 3300046660 Ga0495625_0014779 Ga0495625_0014779_2575_3324 249
517 3300046660 Ga0495625_0389097 Ga0495625_0389097_114_863 249
518 3300047319 Ga0495674_0028392 Ga0495674_0028392_3788_4537 249
519 3300047445 Ga0495677_0001834 Ga0495677_0001834_1424_2173 249
520 3300048906 Ga0496103_0106743 Ga0496103_0106743_169_918 249
521 3300048907 Ga0496104_0134162 Ga0496104_0134162_23_772 249
522 3300048908 Ga0496105_0195308 Ga0496105_0195308_23_772 249
523 3300048909 Ga0496106_0010983 Ga0496106_0010983_810_1559 249
524 3300048910 Ga0496107_0354570 Ga0496107_0354570_149_898 249
525 3300048911 Ga0496108_0039840 Ga0496108_0039840_1305_2054 249
526 3300048912 Ga0496109_0110971 Ga0496109_0110971_1680_2429 249
527 3300048913 Ga0496110_0005954 Ga0496110_0005954_748_1497 249
528 3300048914 Ga0496111_0001142 Ga0496111_0001142_8132_8881 249
529 3300048915 Ga0496112_0076949 Ga0496112_0076949_1509_2258 249
530 3300048917 Ga0496114_0013956 Ga0496114_0013956_2062_2811 249
531 3300048918 Ga0496115_0017554 Ga0496115_0017554_4655_5404 249
532 3300049577 Ga0501041_0059241 Ga0501041_0059241_1459_2208 249
533 3300049580 Ga0501046_0477807 Ga0501046_0477807_52_801 249
534 3300049593 Ga0501077_0137132 Ga0501077_0137132_194_943 249
535 3300049741 Ga0501079_0256361 Ga0501079_0256361_89_838 249
536 3300050507 nmdc:mga05p37_206467_c1 nmdc:mga05p37_206467_c1_1179_1928 249
537 3300050508 nmdc:mga09592_368950_c1 nmdc:mga09592_368950_c1_223_972 249
538 3300050509 nmdc:mga0qj67_115310_c1 nmdc:mga0qj67_115310_c1_569_1318 249
539 3300050509 nmdc:mga0qj67_163198_c1 nmdc:mga0qj67_163198_c1_188_937 249
540 3300050510 nmdc:mga06r32_213884_c1 nmdc:mga06r32_213884_c1_377_1126 249
541 3300050510 nmdc:mga06r32_24666_c1 nmdc:mga06r32_24666_c1_90_839 249
542 3300050510 nmdc:mga06r32_300369_c1 nmdc:mga06r32_300369_c1_390_1139 249
543 3300053116 Ga0500592_009215 Ga0500592_009215_792_1541 249
544 3300053158 Ga0500627_0000002 Ga0500627_0000002_189000_189749 249
545 3300053735 Ga0500596_000031 Ga0500596_000031_901_1653 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

28

274

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

35

249

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9287 2 242
3pea-assembly2.cif.gz_D crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9234 1 249
3p5m-assembly1.cif.gz_B crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9229 2 249
4lk5-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9209 2 239
3p5m-assembly1.cif.gz_F crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9203 2 249
ID Description Score Start End Superfamily
af_I6Y3U6_5_247_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9727 10 243 3.90.226.10
5wydE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9397 2 190 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9377 1 193 3.90.226.10
af_D1MN80_22_227_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.934 6 190 3.90.226.10
af_I6Y3U6_5_247_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9335 10 243 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A3C1KPJ6-F1-model_v4 Enoyl-CoA hydratase 0.9916 2 111 GO:0016020
AF-A0A7C7U5P0-F1-model_v4 Enoyl-CoA hydratase family protein 0.9901 1 170
AF-A0A7C7S7D3-F1-model_v4 deleted 0.9877 1 249
AF-A0A3B7DQZ8-F1-model_v4 deleted 0.9855 1 249
AF-A0A7C7U5P0-F1-model_v4 Enoyl-CoA hydratase family protein 0.9843 1 170

Feature Viewer

pLDDT pTM Quality
95.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map