F461677

General Info

Members Datasets Scaffolds Average Seq Length
543 250 1086 140

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_964747_c1|nmdc:mga0qj67_964747_c1_25_447
Length 140
Sequence MKTHTTYLTFNTKHRQEIIDITDDVEACRAAAGIREGFVLVSAMHISASVFVNDHESGLWKDILDWLEHRIAPWDPEHYRHNSGTGEDNAAAHLRSLTVGHEVIVPVTDGKLDFGPWQRVFYGEWDGQRKKRVIIKAMGE

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
148 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
155 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
215 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
216 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
217 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
218 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
222 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
229 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
230 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
231 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
232 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
233 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.66
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 16.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_964747_c1 3300050509 Bacteria 670
2 rootL2_10197681 3300003322 Bacteria 1817
3 Ga0065707_10513296 3300005295 Bacteria 748
4 Ga0070683_100032788 3300005329 Bacteria 4733
5 Ga0070683_100257552 3300005329 Bacteria 1660
6 Ga0070690_100392379 3300005330 Bacteria 1017
7 Ga0070670_100412532 3300005331 Bacteria 1193
8 Ga0070677_10095692 3300005333 Bacteria 1300
9 Ga0068869_100026029 3300005334 Bacteria 4068
10 Ga0070680_100446299 3300005336 Bacteria 1105
11 Ga0070680_101056427 3300005336 Bacteria 702
12 Ga0068868_100343286 3300005338 Bacteria 1277
13 Ga0070660_100449544 3300005339 Bacteria 1069
14 Ga0070691_10550200 3300005341 Unclassified 674
15 Ga0070687_100092345 3300005343 Bacteria 1677
16 Ga0070687_100209969 3300005343 Bacteria 1185
17 Ga0070661_100032316 3300005344 Bacteria 3788
18 Ga0070692_10097828 3300005345 Bacteria 1604
19 Ga0070669_101187921 3300005353 Bacteria 659
20 Ga0070675_100227077 3300005354 Bacteria 1628
21 Ga0070675_100827578 3300005354 Unclassified 847
22 Ga0070674_100556464 3300005356 Unclassified 963
23 Ga0070673_100784301 3300005364 Bacteria 879
24 Ga0070667_100216634 3300005367 Bacteria 1703
25 Ga0070703_10000266 3300005406 Bacteria 25133
26 Ga0070709_10314227 3300005434 Bacteria 1148
27 Ga0070713_100290578 3300005436 Bacteria 1502
28 Ga0070705_100003007 3300005440 Bacteria 8341
29 Ga0070705_100010519 3300005440 Bacteria 4635
30 Ga0070705_100113106 3300005440 Bacteria 1738
31 Ga0070694_100003430 3300005444 Bacteria 9497
32 Ga0070694_100003799 3300005444 Bacteria 9013
33 Ga0070694_100015498 3300005444 Bacteria 4789
34 Ga0070694_100134468 3300005444 Bacteria 1790
35 Ga0070694_100217298 3300005444 Bacteria 1432
36 Ga0070694_100240591 3300005444 Bacteria 1365
37 Ga0070708_100167489 3300005445 Bacteria 2050
38 Ga0070708_100195167 3300005445 Bacteria 1894
39 Ga0070708_100204581 3300005445 Unclassified 1849
40 Ga0070663_100146694 3300005455 Bacteria 1806
41 Ga0070662_100318222 3300005457 Bacteria 1268
42 Ga0070681_10005913 3300005458 Bacteria 11840
43 Ga0070706_100016643 3300005467 Bacteria 6792
44 Ga0070706_100031952 3300005467 Unclassified 4854
45 Ga0070706_100172222 3300005467 Bacteria 2021
46 Ga0070706_100310568 3300005467 Bacteria 1471
47 Ga0070707_100002251 3300005468 Bacteria 18406
48 Ga0070707_100006885 3300005468 Bacteria 10526
49 Ga0070707_100181221 3300005468 Bacteria 2053
50 Ga0070707_100677290 3300005468 Bacteria 994
51 Ga0070707_101270570 3300005468 Bacteria 702
52 Ga0070698_100027131 3300005471 Bacteria 5956
53 Ga0070698_100064917 3300005471 Bacteria 3677
54 Ga0070698_100096375 3300005471 Bacteria 2935
55 Ga0070698_100276482 3300005471 Unclassified 1611
56 Ga0070698_100751732 3300005471 Bacteria 918
57 Ga0070699_100000263 3300005518 Bacteria 50474
58 Ga0070699_100000532 3300005518 Bacteria 36038
59 Ga0070699_100003845 3300005518 Bacteria 13269
60 Ga0070699_100008011 3300005518 Bacteria 9173
61 Ga0070699_100065485 3300005518 Bacteria 3154
62 Ga0070699_100100167 3300005518 Bacteria 2540
63 Ga0070699_100232585 3300005518 Bacteria 1644
64 Ga0070679_100003032 3300005530 Bacteria 15342
65 Ga0070679_100004307 3300005530 Bacteria 13140
66 Ga0070679_100624654 3300005530 Bacteria 1021
67 Ga0070684_100112318 3300005535 Bacteria 2444
68 Ga0070684_101126263 3300005535 Bacteria 738
69 Ga0070684_101979159 3300005535 Bacteria 550
70 Ga0070697_100002462 3300005536 Bacteria 14245
71 Ga0070697_100004633 3300005536 Bacteria 10553
72 Ga0070697_100356385 3300005536 Bacteria 1264
73 Ga0070697_100532609 3300005536 Bacteria 1029
74 Ga0070697_101014370 3300005536 Bacteria 738
75 Ga0070695_100001256 3300005545 Bacteria 13948
76 Ga0070695_100178671 3300005545 Unclassified 1502
77 Ga0070695_100774676 3300005545 Bacteria 767
78 Ga0070696_100005865 3300005546 Bacteria 8198
79 Ga0070696_100021167 3300005546 Bacteria 4409
80 Ga0070696_100032406 3300005546 Bacteria 3585
81 Ga0070696_100034417 3300005546 Bacteria 3485
82 Ga0070665_100281828 3300005548 Bacteria 1664
83 Ga0070704_100121715 3300005549 Bacteria 2006
84 Ga0070704_100560889 3300005549 Bacteria 999
85 Ga0070704_100704594 3300005549 Bacteria 896
86 Ga0070704_100943625 3300005549 Unclassified 778
87 Ga0070704_101266840 3300005549 Unclassified 674
88 Ga0068855_100341545 3300005563 Bacteria 1651
89 Ga0068857_100073157 3300005577 Unclassified 3053
90 Ga0068857_101447519 3300005577 Bacteria 669
91 Ga0068859_100028824 3300005617 Bacteria 5568
92 Ga0068859_100042430 3300005617 Bacteria 4569
93 Ga0068859_100052442 3300005617 Bacteria 4101
94 Ga0068864_100011116 3300005618 Bacteria 7440
95 Ga0068864_100048361 3300005618 Bacteria 3656
96 Ga0068864_100303130 3300005618 Unclassified 1496
97 Ga0068866_10343283 3300005718 Bacteria 946
98 Ga0068863_100055451 3300005841 Bacteria 3753
99 Ga0068863_100702743 3300005841 Bacteria 1005
100 Ga0068863_101139587 3300005841 Bacteria 785
101 Ga0068858_101237365 3300005842 Bacteria 734
102 Ga0068860_100487181 3300005843 Unclassified 1230
103 Ga0068860_101802494 3300005843 Unclassified 634
104 Ga0070715_10506757 3300006163 Bacteria 692
105 Ga0070712_100611637 3300006175 Bacteria 923
106 Ga0097621_101369056 3300006237 Unclassified 669
107 Ga0075428_100035916 3300006844 Bacteria 5461
108 Ga0075428_100436572 3300006844 Bacteria 1403
109 Ga0075430_100702161 3300006846 Bacteria 834
110 Ga0075430_100732538 3300006846 Bacteria 815
111 Ga0075431_100331696 3300006847 Bacteria 1532
112 Ga0075431_100340760 3300006847 Bacteria 1509
113 Ga0075433_10043552 3300006852 Bacteria 3897
114 Ga0075433_10103586 3300006852 Bacteria 2521
115 Ga0075433_10124145 3300006852 Bacteria 2293
116 Ga0075433_11396192 3300006852 Bacteria 606
117 Ga0075434_100026340 3300006871 Bacteria 5696
118 Ga0075434_100035511 3300006871 Bacteria 4928
119 Ga0075429_100001638 3300006880 Bacteria 18506
120 Ga0075429_100211035 3300006880 Bacteria 1701
121 Ga0075436_100396919 3300006914 Bacteria 999
122 Ga0075436_100739900 3300006914 Bacteria 730
123 Ga0075436_100855466 3300006914 Bacteria 679
124 Ga0097620_100028823 3300006931 Bacteria 5568
125 Ga0097620_100042428 3300006931 Bacteria 4569
126 Ga0097620_100052443 3300006931 Bacteria 4101
127 Ga0075435_100614974 3300007076 Unclassified 942
128 Ga0075435_101546849 3300007076 Unclassified 582
129 Ga0105240_10005621 3300009093 Bacteria 18609
130 Ga0111539_10194502 3300009094 Bacteria 2366
131 Ga0111539_11197951 3300009094 Bacteria 882
132 Ga0111539_12322328 3300009094 Bacteria 622
133 Ga0114129_10092983 3300009147 Bacteria 4178
134 Ga0114129_10189391 3300009147 Bacteria 2795
135 Ga0114129_10331311 3300009147 Bacteria 2021
136 Ga0114129_10808053 3300009147 Bacteria 1196
137 Ga0114129_10891629 3300009147 Bacteria 1128
138 Ga0114129_11951228 3300009147 Bacteria 711
139 Ga0105241_11217954 3300009174 Bacteria 714
140 Ga0105241_11390820 3300009174 Bacteria 671
141 Ga0105242_10668696 3300009176 Unclassified 1012
142 Ga0105248_11031250 3300009177 Unclassified 929
143 Ga0105248_11175761 3300009177 Bacteria 867
144 Ga0105237_10170610 3300009545 Unclassified 2175
145 Ga0105249_10031418 3300009553 Bacteria 4803
146 Ga0105249_10974546 3300009553 Bacteria 916
147 Ga0105239_10038042 3300010375 Bacteria 5272
148 Ga0105246_10665422 3300011119 Unclassified 908
149 Ga0105246_11192775 3300011119 Unclassified 700
150 Ga0157373_10040995 3300013100 Bacteria 3313
151 Ga0157370_10043671 3300013104 Bacteria 4312
152 Ga0157370_10227137 3300013104 Bacteria 1728
153 Ga0157369_10342289 3300013105 Bacteria 1553
154 Ga0157369_10405075 3300013105 Bacteria 1415
155 Ga0163162_11257779 3300013306 Unclassified 840
156 Ga0157375_11561918 3300013308 Unclassified 780
157 Ga0163163_10027538 3300014325 Bacteria 5447
158 Ga0163163_10054825 3300014325 Bacteria 3939
159 Ga0163163_10086150 3300014325 Bacteria 3150
160 Ga0163163_11290767 3300014325 Unclassified 792
161 Ga0157380_11250920 3300014326 Bacteria 788
162 Ga0182008_10131023 3300014497 Bacteria 1250
163 Ga0157377_10769379 3300014745 Unclassified 707
164 Ga0157379_10254510 3300014968 Bacteria 1595
165 Ga0213876_10258489 3300021384 Bacteria 925
166 Ga0207653_10000140 3300025885 Bacteria 51674
167 Ga0207682_10063553 3300025893 Bacteria 1550
168 Ga0207692_11034981 3300025898 Bacteria 543
169 Ga0207699_10039451 3300025906 Bacteria 2713
170 Ga0207643_10025789 3300025908 Bacteria 3252
171 Ga0207643_10329492 3300025908 Bacteria 955
172 Ga0207684_10095099 3300025910 Bacteria 2542
173 Ga0207684_10197964 3300025910 Unclassified 1733
174 Ga0207684_10199287 3300025910 Bacteria 1727
175 Ga0207684_10215009 3300025910 Bacteria 1658
176 Ga0207707_10003040 3300025912 Bacteria 14910
177 Ga0207707_10023875 3300025912 Bacteria 5348
178 Ga0207695_10006242 3300025913 Bacteria 15524
179 Ga0207695_10022707 3300025913 Bacteria 7112
180 Ga0207671_10205162 3300025914 Unclassified 1540
181 Ga0207663_10182265 3300025916 Bacteria 1501
182 Ga0207660_10010955 3300025917 Bacteria 5893
183 Ga0207660_10025937 3300025917 Bacteria 3985
184 Ga0207660_10208463 3300025917 Bacteria 1529
185 Ga0207660_11291526 3300025917 Unclassified 593
186 Ga0207657_10193091 3300025919 Bacteria 1641
187 Ga0207657_11189124 3300025919 Bacteria 580
188 Ga0207649_10216046 3300025920 Bacteria 1363
189 Ga0207652_10005974 3300025921 Bacteria 9851
190 Ga0207652_10009338 3300025921 Bacteria 7887
191 Ga0207646_10659113 3300025922 Bacteria 937
192 Ga0207646_10852291 3300025922 Bacteria 810
193 Ga0207646_11097979 3300025922 Bacteria 700
194 Ga0207681_10881858 3300025923 Bacteria 749
195 Ga0207650_10724569 3300025925 Bacteria 841
196 Ga0207659_10708075 3300025926 Unclassified 862
197 Ga0207706_10976125 3300025933 Bacteria 713
198 Ga0207686_10595065 3300025934 Unclassified 870
199 Ga0207670_10358433 3300025936 Bacteria 1157
200 Ga0207665_10832485 3300025939 Bacteria 730
201 Ga0207689_10238214 3300025942 Bacteria 1504
202 Ga0207661_10026652 3300025944 Bacteria 4407
203 Ga0207661_10232963 3300025944 Bacteria 1631
204 Ga0207661_10442885 3300025944 Bacteria 1182
205 Ga0207651_10857872 3300025960 Unclassified 807
206 Ga0207640_10010020 3300025981 Bacteria 5323
207 Ga0207658_10040323 3300025986 Bacteria 3375
208 Ga0207677_10349499 3300026023 Bacteria 1238
209 Ga0207703_10473579 3300026035 Bacteria 1173
210 Ga0207703_10743977 3300026035 Bacteria 934
211 Ga0207678_10048502 3300026067 Bacteria 3671
212 Ga0207708_10956601 3300026075 Unclassified 743
213 Ga0207641_11625713 3300026088 Bacteria 648
214 Ga0207648_10514035 3300026089 Bacteria 1097
215 Ga0207676_10036856 3300026095 Bacteria 3722
216 Ga0207676_12382700 3300026095 Unclassified 526
217 Ga0207674_10006644 3300026116 Bacteria 13587
218 Ga0207675_102703974 3300026118 Bacteria 505
219 Ga0209968_1014108 3300027526 Bacteria 1257
220 Ga0209974_10060433 3300027876 Bacteria 1282
221 Ga0268266_10219761 3300028379 Bacteria 1746
222 Ga0268265_12181276 3300028380 Unclassified 561
223 Ga0268264_10593180 3300028381 Unclassified 1091
224 Ga0316182_1228756 3300030745 Bacteria 2167
225 Ga0307408_100018876 3300031548 Unclassified 4636
226 Ga0307408_100031809 3300031548 Bacteria 3676
227 Ga0307408_100195766 3300031548 Bacteria 1632
228 Ga0307408_101839788 3300031548 Unclassified 579
229 Ga0307405_10013571 3300031731 Bacteria 4351
230 Ga0307405_10035240 3300031731 Bacteria 2987
231 Ga0307405_10110947 3300031731 Bacteria 1858
232 Ga0307413_10021376 3300031824 Bacteria 3463
233 Ga0307413_10046921 3300031824 Unclassified 2573
234 Ga0307413_10047415 3300031824 Bacteria 2562
235 Ga0307413_10152708 3300031824 Bacteria 1611
236 Ga0307413_10236923 3300031824 Bacteria 1344
237 Ga0307413_10380837 3300031824 Bacteria 1099
238 Ga0307410_10005690 3300031852 Bacteria 6634
239 Ga0307410_10006322 3300031852 Bacteria 6383
240 Ga0307410_10032566 3300031852 Bacteria 3356
241 Ga0307410_10034142 3300031852 Bacteria 3291
242 Ga0307410_10034382 3300031852 Bacteria 3282
243 Ga0307410_10131023 3300031852 Bacteria 1842
244 Ga0307410_10389127 3300031852 Bacteria 1124
245 Ga0307410_10577608 3300031852 Bacteria 935
246 Ga0307410_10744146 3300031852 Unclassified 830
247 Ga0307410_11530987 3300031852 Bacteria 588
248 Ga0307406_10064832 3300031901 Bacteria 2372
249 Ga0307406_10121012 3300031901 Unclassified 1820
250 Ga0307406_10276810 3300031901 Bacteria 1278
251 Ga0307406_10431460 3300031901 Bacteria 1052
252 Ga0307406_10757268 3300031901 Bacteria 816
253 Ga0307406_10843247 3300031901 Bacteria 776
254 Ga0307407_10137010 3300031903 Bacteria 1574
255 Ga0307407_10166108 3300031903 Bacteria 1449
256 Ga0307412_10229586 3300031911 Bacteria 1428
257 Ga0307412_10391299 3300031911 Bacteria 1129
258 Ga0307412_10450033 3300031911 Bacteria 1061
259 Ga0307409_100018118 3300031995 Bacteria 4719
260 Ga0307409_100031338 3300031995 Bacteria 3836
261 Ga0307409_100032677 3300031995 Bacteria 3776
262 Ga0307409_100054058 3300031995 Bacteria 3090
263 Ga0307409_100069820 3300031995 Bacteria 2786
264 Ga0307409_100209635 3300031995 Unclassified 1750
265 Ga0307409_100495819 3300031995 Bacteria 1188
266 Ga0307416_100009837 3300032002 Bacteria 6286
267 Ga0307416_100018223 3300032002 Bacteria 4940
268 Ga0307416_100047418 3300032002 Bacteria 3400
269 Ga0307416_100105611 3300032002 Bacteria 2466
270 Ga0307416_100167993 3300032002 Bacteria 2038
271 Ga0307414_10028833 3300032004 Bacteria 3605
272 Ga0307414_10101080 3300032004 Bacteria 2170
273 Ga0307414_10146695 3300032004 Bacteria 1855
274 Ga0307414_10176972 3300032004 Bacteria 1712
275 Ga0307414_10223255 3300032004 Bacteria 1548
276 Ga0307414_10290091 3300032004 Bacteria 1379
277 Ga0307414_10330289 3300032004 Bacteria 1301
278 Ga0307414_10374727 3300032004 Unclassified 1229
279 Ga0307414_10618458 3300032004 Bacteria 973
280 Ga0307414_11572255 3300032004 Unclassified 613
281 Ga0307411_10006951 3300032005 Bacteria 5712
282 Ga0307411_10030685 3300032005 Bacteria 3298
283 Ga0307411_10036954 3300032005 Bacteria 3066
284 Ga0307411_10114693 3300032005 Bacteria 1936
285 Ga0307411_10733929 3300032005 Bacteria 863
286 Ga0307411_11826202 3300032005 Bacteria 565
287 Ga0307415_100004520 3300032126 Bacteria 7236
288 Ga0307415_100049430 3300032126 Bacteria 2843
289 Ga0307415_100113046 3300032126 Bacteria 2019
290 Ga0307415_100184543 3300032126 Bacteria 1640
291 Ga0307415_100238262 3300032126 Bacteria 1470
292 Ga0307415_100298870 3300032126 Bacteria 1333
293 Ga0307415_100483840 3300032126 Bacteria 1078
294 Ga0307415_100565772 3300032126 Bacteria 1006
295 Ga0307415_100598465 3300032126 Bacteria 981
296 Ga0373930_0084732 3300034816 Bacteria 737
297 Ga0373959_0102796 3300034820 Bacteria 682
298 Ga0373928_0066726 3300035084 Bacteria 881
299 Ga0373940_0010014 3300035088 Bacteria 2218
300 Ga0373940_0138804 3300035088 Bacteria 767
301 Ga0373939_0031189 3300035114 Bacteria 1539
302 Ga0373941_0066320 3300035115 Bacteria 1188
303 Ga0373941_0246503 3300035115 Bacteria 696
304 Ga0373960_0048738 3300035121 Bacteria 1251
305 Ga0373960_0164752 3300035121 Bacteria 765
306 Ga0373942_0060323 3300035207 Bacteria 1086
307 Ga0373942_0069633 3300035207 Bacteria 1025
308 Ga0373962_0113805 3300035242 Bacteria 856
309 Ga0373931_0013716 3300035691 Bacteria 3951
310 Ga0373931_0301215 3300035691 Bacteria 990
311 Ga0395905_0070520 3300037471 Bacteria 3275
312 Ga0242419_001430 3300038698 Bacteria 1467
313 Ga0242420_000877 3300038996 Bacteria 3726
314 Ga0436365_1670746 3300039437 Bacteria 1423
315 Ga0439439_0009740 3300041406 Bacteria 2291
316 Ga0439439_0039920 3300041406 Bacteria 1214
317 Ga0439453_0014658 3300041408 Bacteria 1347
318 Ga0451802_0473963 3300041460 Bacteria 548
319 Ga0439448_0010155 3300042005 Bacteria 2785
320 Ga0450914_055329 3300042118 Unclassified 529
321 Ga0450898_066556 3300042134 Bacteria 716
322 Ga0439446_0026441 3300042156 Bacteria 1663
323 Ga0439458_0072216 3300042157 Bacteria 872
324 Ga0439434_0162605 3300042435 Unclassified 742
325 Ga0439434_0174538 3300042435 Bacteria 718
326 Ga0451577_0004011 3300042876 Bacteria 15834
327 Ga0451577_0008578 3300042876 Bacteria 9937
328 Ga0451577_0026329 3300042876 Bacteria 5268
329 Ga0451577_0035570 3300042876 Bacteria 4486
330 Ga0451577_0187498 3300042876 Bacteria 1865
331 Ga0451577_0526403 3300042876 Bacteria 1073
332 Ga0453683_0031436 3300044673 Bacteria 3355
333 Ga0453683_0093299 3300044673 Bacteria 1888
334 Ga0466964_0226422 3300044706 Bacteria 910
335 Ga0453684_0000294 3300044712 Bacteria 212051
336 Ga0453684_0053339 3300044712 Bacteria 5278
337 Ga0453684_0086475 3300044712 Bacteria 3890
338 Ga0453684_0121237 3300044712 Bacteria 3156
339 Ga0453684_1457199 3300044712 Unclassified 708
340 Ga0466960_0198080 3300044901 Bacteria 1096
341 Ga0451576_0045516 3300045051 Bacteria 4621
342 Ga0451576_0320787 3300045051 Bacteria 1621
343 Ga0466967_0825674 3300045976 Bacteria 921
344 Ga0466967_1876954 3300045976 Bacteria 596
345 Ga0495603_0346029 3300046455 Unclassified 853
346 Ga0495594_0177313 3300046499 Unclassified 1213
347 Ga0495586_0566063 3300046535 Bacteria 656
348 Ga0495622_0246941 3300046557 Bacteria 786
349 Ga0495588_0277463 3300046674 Bacteria 883
350 Ga0495636_0332230 3300047318 Bacteria 715
351 Ga0496100_0421845 3300048903 Unclassified 1019
352 Ga0496101_0015685 3300048904 Bacteria 5113
353 Ga0496102_0003758 3300048905 Bacteria 12836
354 Ga0496102_0027574 3300048905 Bacteria 5072
355 Ga0496102_0082018 3300048905 Bacteria 2974
356 Ga0496102_0124578 3300048905 Bacteria 2408
357 Ga0496102_0194193 3300048905 Unclassified 1913
358 Ga0496103_0571092 3300048906 Bacteria 721
359 Ga0496103_0730411 3300048906 Bacteria 627
360 Ga0496104_0006968 3300048907 Bacteria 9967
361 Ga0496104_0008642 3300048907 Bacteria 9060
362 Ga0496104_0015007 3300048907 Bacteria 7007
363 Ga0496104_1554723 3300048907 Unclassified 564
364 Ga0496105_0053584 3300048908 Bacteria 3331
365 Ga0496105_0138779 3300048908 Bacteria 2002
366 Ga0496106_0060819 3300048909 Bacteria 2864
367 Ga0496106_0113673 3300048909 Bacteria 2110
368 Ga0496106_0252299 3300048909 Bacteria 1411
369 Ga0496107_0270113 3300048910 Bacteria 1266
370 Ga0496107_0423548 3300048910 Unclassified 990
371 Ga0496108_0000162 3300048911 Bacteria 63296
372 Ga0496108_0005235 3300048911 Bacteria 10475
373 Ga0496108_0019015 3300048911 Bacteria 5635
374 Ga0496108_0080610 3300048911 Bacteria 2757
375 Ga0496109_0001612 3300048912 Bacteria 18839
376 Ga0496109_0021009 3300048912 Bacteria 5771
377 Ga0496109_0086648 3300048912 Bacteria 2892
378 Ga0496109_0280177 3300048912 Unclassified 1571
379 Ga0496110_0010371 3300048913 Bacteria 7574
380 Ga0496110_0020598 3300048913 Bacteria 5570
381 Ga0496110_0022407 3300048913 Bacteria 5363
382 Ga0496110_1434976 3300048913 Unclassified 600
383 Ga0496111_0002233 3300048914 Bacteria 11624
384 Ga0496111_0007826 3300048914 Bacteria 7039
385 Ga0496111_0012480 3300048914 Bacteria 5753
386 Ga0496111_0073770 3300048914 Bacteria 2485
387 Ga0496112_0000435 3300048915 Bacteria 27641
388 Ga0496112_0028467 3300048915 Bacteria 5393
389 Ga0496112_0056693 3300048915 Bacteria 3857
390 Ga0496112_0100023 3300048915 Bacteria 2869
391 Ga0496112_0288952 3300048915 Unclassified 1586
392 Ga0496113_0000082 3300048916 Bacteria 41671
393 Ga0496113_0001831 3300048916 Bacteria 12105
394 Ga0496113_0198477 3300048916 Bacteria 1594
395 Ga0496114_0072966 3300048917 Archaea 2888
396 Ga0496115_0656106 3300048918 Bacteria 829
397 Ga0501292_007240 3300049515 Unclassified 1599
398 Ga0501298_061157 3300049521 Bacteria 798
399 Ga0501031_0133453 3300049568 Unclassified 1622
400 Ga0501033_0246890 3300049570 Bacteria 1266
401 Ga0501034_0001315 3300049571 Bacteria 33642
402 Ga0501034_0735484 3300049571 Bacteria 883
403 Ga0501036_0135303 3300049572 Bacteria 2080
404 Ga0501036_0178185 3300049572 Bacteria 1790
405 Ga0501036_0507914 3300049572 Bacteria 1003
406 Ga0501038_0433341 3300049574 Bacteria 1013
407 Ga0501038_0815186 3300049574 Unclassified 693
408 Ga0501040_0065333 3300049576 Bacteria 2506
409 Ga0501040_0095591 3300049576 Bacteria 2068
410 Ga0501040_0115412 3300049576 Bacteria 1880
411 Ga0501040_0231794 3300049576 Unclassified 1315
412 Ga0501040_0432867 3300049576 Bacteria 946
413 Ga0501041_0684921 3300049577 Bacteria 656
414 Ga0501042_0005298 3300049578 Bacteria 8293
415 Ga0501042_0992574 3300049578 Bacteria 612
416 Ga0501046_0030291 3300049580 Bacteria 4393
417 Ga0501046_0081879 3300049580 Bacteria 2493
418 Ga0501046_0714649 3300049580 Bacteria 705
419 Ga0501048_0208457 3300049582 Bacteria 1386
420 Ga0501048_0214813 3300049582 Bacteria 1364
421 Ga0501067_0001316 3300049583 Bacteria 13448
422 Ga0501067_0018941 3300049583 Bacteria 3807
423 Ga0501067_0727664 3300049583 Unclassified 558
424 Ga0501068_0000545 3300049584 Bacteria 19083
425 Ga0501068_0020807 3300049584 Bacteria 3828
426 Ga0501069_0001804 3300049585 Bacteria 10708
427 Ga0501069_0004142 3300049585 Bacteria 7489
428 Ga0501069_0048675 3300049585 Unclassified 2355
429 Ga0501069_0637596 3300049585 Bacteria 641
430 Ga0501070_0031814 3300049586 Bacteria 4419
431 Ga0501070_0109079 3300049586 Bacteria 2287
432 Ga0501071_0073649 3300049587 Bacteria 2491
433 Ga0501071_0660507 3300049587 Bacteria 804
434 Ga0501071_0909175 3300049587 Bacteria 679
435 Ga0501072_0010140 3300049588 Bacteria 7173
436 Ga0501072_0016360 3300049588 Bacteria 5692
437 Ga0501073_0023640 3300049589 Bacteria 4410
438 Ga0501074_0012702 3300049590 Bacteria 6124
439 Ga0501074_0099455 3300049590 Bacteria 2082
440 Ga0501074_1259154 3300049590 Bacteria 518
441 Ga0501075_0007332 3300049591 Bacteria 7648
442 Ga0501075_0225490 3300049591 Bacteria 1429
443 Ga0501075_0277607 3300049591 Unclassified 1277
444 Ga0501076_0009162 3300049592 Bacteria 7294
445 Ga0501076_0146872 3300049592 Bacteria 1917
446 Ga0501076_0382415 3300049592 Unclassified 1157
447 Ga0501076_1250031 3300049592 Unclassified 611
448 Ga0501077_0000408 3300049593 Bacteria 25947
449 Ga0501077_0005423 3300049593 Bacteria 7756
450 Ga0501077_0323731 3300049593 Unclassified 983
451 Ga0501202_011564 3300049652 Bacteria 1655
452 Ga0501209_144814 3300049656 Bacteria 713
453 Ga0501217_004715 3300049661 Bacteria 2813
454 Ga0501230_005002 3300049667 Bacteria 1856
455 Ga0501248_006697 3300049678 Unclassified 944
456 Ga0501249_009031 3300049679 Bacteria 2072
457 Ga0501252_094357 3300049682 Bacteria 511
458 Ga0501256_005618 3300049685 Bacteria 1110
459 Ga0501257_175190 3300049686 Bacteria 604
460 Ga0501259_065837 3300049688 Bacteria 767
461 Ga0501261_018942 3300049690 Bacteria 975
462 Ga0501219_002854 3300049703 Bacteria 1287
463 Ga0501234_007914 3300049707 Unclassified 1661
464 Ga0501079_0010710 3300049741 Bacteria 6983
465 Ga0501079_0017629 3300049741 Bacteria 5454
466 Ga0501079_0075868 3300049741 Bacteria 2600
467 Ga0501079_0667892 3300049741 Unclassified 818
468 Ga0501080_0106179 3300049742 Bacteria 2602
469 Ga0501080_0114482 3300049742 Unclassified 2500
470 Ga0501081_0010146 3300049743 Bacteria 6146
471 Ga0501081_0174614 3300049743 Bacteria 1552
472 Ga0501081_0385018 3300049743 Bacteria 1037
473 Ga0501081_0640959 3300049743 Bacteria 796
474 Ga0501083_0012133 3300049744 Bacteria 6031
475 Ga0501083_0158962 3300049744 Bacteria 1479
476 Ga0501263_008812 3300049760 Unclassified 1211
477 Ga0501267_003814 3300049764 Unclassified 1385
478 Ga0501268_000564 3300049765 Bacteria 4103
479 Ga0501271_012179 3300049768 Bacteria 929
480 Ga0501273_001859 3300049770 Bacteria 2079
481 Ga0501281_11995 3300049777 Bacteria 620
482 Ga0501283_004318 3300049779 Unclassified 1916
483 Ga0501045_0539622 3300049824 Bacteria 865
484 Ga0501045_1372802 3300049824 Unclassified 513
485 Ga0501226_028340 3300049853 Bacteria 632
486 nmdc:mga05p37_132631_c1 3300050507 Bacteria 3056
487 nmdc:mga05p37_744246_c1 3300050507 Unclassified 1081
488 nmdc:mga05p37_90143_c1 3300050507 Bacteria 3779
489 nmdc:mga09592_205971_c1 3300050508 Bacteria 1704
490 nmdc:mga09592_64339_c1 3300050508 Unclassified 3105
491 nmdc:mga09592_863555_c1 3300050508 Bacteria 762
492 nmdc:mga0qj67_1328466_c1 3300050509 Unclassified 556
493 nmdc:mga0qj67_1582871_c1 3300050509 Bacteria 503
494 nmdc:mga06r32_1112887_c1 3300050510 Bacteria 739
495 nmdc:mga06r32_34439_c1 3300050510 Bacteria 4774
496 nmdc:mga06r32_732458_c1 3300050510 Bacteria 953
497 nmdc:mga0n895_1018155_c1 3300050512 Bacteria 809
498 nmdc:mga0n895_1251356_c1 3300050512 Unclassified 714
499 nmdc:mga0n895_1417190_c1 3300050512 Unclassified 663
500 nmdc:mga0n895_1813989_c1 3300050512 Unclassified 570
501 nmdc:mga0n895_47156_c1 3300050512 Bacteria 4212
502 nmdc:mga0n895_48422_c1 3300050512 Bacteria 4160
503 nmdc:mga0n895_573816_c1 3300050512 Bacteria 1132
504 nmdc:mga0rr50_1213738_c1 3300050513 Bacteria 641
505 nmdc:mga0rr50_160439_c1 3300050513 Bacteria 1825
506 nmdc:mga0rr50_170066_c1 3300050513 Unclassified 1775
507 nmdc:mga0rr50_305197_c1 3300050513 Bacteria 1332
508 nmdc:mga0rr50_535518_c1 3300050513 Bacteria 997
509 nmdc:mga08x19_149302_c1 3300050514 Bacteria 1582
510 nmdc:mga08x19_173031_c1 3300050514 Bacteria 1471
511 nmdc:mga08x19_283687_c1 3300050514 Unclassified 1148
512 nmdc:mga0a205_1317982_c1 3300050515 Unclassified 570
513 nmdc:mga0a205_134694_c1 3300050515 Bacteria 2371
514 nmdc:mga0a205_1451968_c1 3300050515 Unclassified 534
515 nmdc:mga0a205_283359_c1 3300050515 Unclassified 1532
516 nmdc:mga0a205_433593_c1 3300050515 Bacteria 1175
517 nmdc:mga0a205_526218_c1 3300050515 Bacteria 1039
518 nmdc:mga0a205_76959_c1 3300050515 Bacteria 3224
519 Ga0501084_0003779 3300054114 Bacteria 12309
520 Ga0501084_0019360 3300054114 Bacteria 5670
521 Ga0501084_0056234 3300054114 Bacteria 3292
522 Ga0501084_0400773 3300054114 Unclassified 1160
523 Ga0501084_0485104 3300054114 Bacteria 1045
524 Ga0590071_004205 3300059421 Unclassified 3506
525 Ga0590071_079502 3300059421 Bacteria 814
526 Ga0590071_118078 3300059421 Bacteria 676
527 Ga0590074_027924 3300059423 Unclassified 989
528 Ga0590074_063338 3300059423 Bacteria 690
529 Ga0590075_014097 3300059424 Unclassified 1953
530 Ga0590077_011116 3300059426 Unclassified 1856
531 Ga0590077_015531 3300059426 Bacteria 1593
532 Ga0501082_0010659 3300060353 Bacteria 7913
533 Ga0501082_0038369 3300060353 Bacteria 4132
534 Ga0501082_0051371 3300060353 Bacteria 3553
535 Ga0501082_0153170 3300060353 Bacteria 2003
536 Ga0501082_0158140 3300060353 Bacteria 1969
537 Ga0501082_0328458 3300060353 Bacteria 1333
538 Ga0501082_0904072 3300060353 Bacteria 772
539 Ga0501082_1559338 3300060353 Bacteria 577
540 Ga0530510_0029605 3300061734 Bacteria 3931
541 Ga0530510_0272358 3300061734 Bacteria 1263
542 Ga0530510_0448613 3300061734 Bacteria 975
543 Ga0530510_0636177 3300061734 Bacteria 812
544 nmdc:mga0qj67_964747_c1
545 rootL2_10197681
546 Ga0065707_10513296
547 Ga0070683_100032788
548 Ga0070683_100257552
549 Ga0070690_100392379
550 Ga0070670_100412532
551 Ga0070677_10095692
552 Ga0068869_100026029
553 Ga0070680_100446299
554 Ga0070680_101056427
555 Ga0068868_100343286
556 Ga0070660_100449544
557 Ga0070691_10550200
558 Ga0070687_100092345
559 Ga0070687_100209969
560 Ga0070661_100032316
561 Ga0070692_10097828
562 Ga0070669_101187921
563 Ga0070675_100227077
564 Ga0070675_100827578
565 Ga0070674_100556464
566 Ga0070673_100784301
567 Ga0070667_100216634
568 Ga0070703_10000266
569 Ga0070709_10314227
570 Ga0070713_100290578
571 Ga0070705_100003007
572 Ga0070705_100010519
573 Ga0070705_100113106
574 Ga0070694_100003430
575 Ga0070694_100003799
576 Ga0070694_100015498
577 Ga0070694_100134468
578 Ga0070694_100217298
579 Ga0070694_100240591
580 Ga0070708_100167489
581 Ga0070708_100195167
582 Ga0070708_100204581
583 Ga0070663_100146694
584 Ga0070662_100318222
585 Ga0070681_10005913
586 Ga0070706_100016643
587 Ga0070706_100031952
588 Ga0070706_100172222
589 Ga0070706_100310568
590 Ga0070707_100002251
591 Ga0070707_100006885
592 Ga0070707_100181221
593 Ga0070707_100677290
594 Ga0070707_101270570
595 Ga0070698_100027131
596 Ga0070698_100064917
597 Ga0070698_100096375
598 Ga0070698_100276482
599 Ga0070698_100751732
600 Ga0070699_100000263
601 Ga0070699_100000532
602 Ga0070699_100003845
603 Ga0070699_100008011
604 Ga0070699_100065485
605 Ga0070699_100100167
606 Ga0070699_100232585
607 Ga0070679_100003032
608 Ga0070679_100004307
609 Ga0070679_100624654
610 Ga0070684_100112318
611 Ga0070684_101126263
612 Ga0070684_101979159
613 Ga0070697_100002462
614 Ga0070697_100004633
615 Ga0070697_100356385
616 Ga0070697_100532609
617 Ga0070697_101014370
618 Ga0070695_100001256
619 Ga0070695_100178671
620 Ga0070695_100774676
621 Ga0070696_100005865
622 Ga0070696_100021167
623 Ga0070696_100032406
624 Ga0070696_100034417
625 Ga0070665_100281828
626 Ga0070704_100121715
627 Ga0070704_100560889
628 Ga0070704_100704594
629 Ga0070704_100943625
630 Ga0070704_101266840
631 Ga0068855_100341545
632 Ga0068857_100073157
633 Ga0068857_101447519
634 Ga0068859_100028824
635 Ga0068859_100042430
636 Ga0068859_100052442
637 Ga0068864_100011116
638 Ga0068864_100048361
639 Ga0068864_100303130
640 Ga0068866_10343283
641 Ga0068863_100055451
642 Ga0068863_100702743
643 Ga0068863_101139587
644 Ga0068858_101237365
645 Ga0068860_100487181
646 Ga0068860_101802494
647 Ga0070715_10506757
648 Ga0070712_100611637
649 Ga0097621_101369056
650 Ga0075428_100035916
651 Ga0075428_100436572
652 Ga0075430_100702161
653 Ga0075430_100732538
654 Ga0075431_100331696
655 Ga0075431_100340760
656 Ga0075433_10043552
657 Ga0075433_10103586
658 Ga0075433_10124145
659 Ga0075433_11396192
660 Ga0075434_100026340
661 Ga0075434_100035511
662 Ga0075429_100001638
663 Ga0075429_100211035
664 Ga0075436_100396919
665 Ga0075436_100739900
666 Ga0075436_100855466
667 Ga0097620_100028823
668 Ga0097620_100042428
669 Ga0097620_100052443
670 Ga0075435_100614974
671 Ga0075435_101546849
672 Ga0105240_10005621
673 Ga0111539_10194502
674 Ga0111539_11197951
675 Ga0111539_12322328
676 Ga0114129_10092983
677 Ga0114129_10189391
678 Ga0114129_10331311
679 Ga0114129_10808053
680 Ga0114129_10891629
681 Ga0114129_11951228
682 Ga0105241_11217954
683 Ga0105241_11390820
684 Ga0105242_10668696
685 Ga0105248_11031250
686 Ga0105248_11175761
687 Ga0105237_10170610
688 Ga0105249_10031418
689 Ga0105249_10974546
690 Ga0105239_10038042
691 Ga0105246_10665422
692 Ga0105246_11192775
693 Ga0157373_10040995
694 Ga0157370_10043671
695 Ga0157370_10227137
696 Ga0157369_10342289
697 Ga0157369_10405075
698 Ga0163162_11257779
699 Ga0157375_11561918
700 Ga0163163_10027538
701 Ga0163163_10054825
702 Ga0163163_10086150
703 Ga0163163_11290767
704 Ga0157380_11250920
705 Ga0182008_10131023
706 Ga0157377_10769379
707 Ga0157379_10254510
708 Ga0213876_10258489
709 Ga0207653_10000140
710 Ga0207682_10063553
711 Ga0207692_11034981
712 Ga0207699_10039451
713 Ga0207643_10025789
714 Ga0207643_10329492
715 Ga0207684_10095099
716 Ga0207684_10197964
717 Ga0207684_10199287
718 Ga0207684_10215009
719 Ga0207707_10003040
720 Ga0207707_10023875
721 Ga0207695_10006242
722 Ga0207695_10022707
723 Ga0207671_10205162
724 Ga0207663_10182265
725 Ga0207660_10010955
726 Ga0207660_10025937
727 Ga0207660_10208463
728 Ga0207660_11291526
729 Ga0207657_10193091
730 Ga0207657_11189124
731 Ga0207649_10216046
732 Ga0207652_10005974
733 Ga0207652_10009338
734 Ga0207646_10659113
735 Ga0207646_10852291
736 Ga0207646_11097979
737 Ga0207681_10881858
738 Ga0207650_10724569
739 Ga0207659_10708075
740 Ga0207706_10976125
741 Ga0207686_10595065
742 Ga0207670_10358433
743 Ga0207665_10832485
744 Ga0207689_10238214
745 Ga0207661_10026652
746 Ga0207661_10232963
747 Ga0207661_10442885
748 Ga0207651_10857872
749 Ga0207640_10010020
750 Ga0207658_10040323
751 Ga0207677_10349499
752 Ga0207703_10473579
753 Ga0207703_10743977
754 Ga0207678_10048502
755 Ga0207708_10956601
756 Ga0207641_11625713
757 Ga0207648_10514035
758 Ga0207676_10036856
759 Ga0207676_12382700
760 Ga0207674_10006644
761 Ga0207675_102703974
762 Ga0209968_1014108
763 Ga0209974_10060433
764 Ga0268266_10219761
765 Ga0268265_12181276
766 Ga0268264_10593180
767 Ga0316182_1228756
768 Ga0307408_100018876
769 Ga0307408_100031809
770 Ga0307408_100195766
771 Ga0307408_101839788
772 Ga0307405_10013571
773 Ga0307405_10035240
774 Ga0307405_10110947
775 Ga0307413_10021376
776 Ga0307413_10046921
777 Ga0307413_10047415
778 Ga0307413_10152708
779 Ga0307413_10236923
780 Ga0307413_10380837
781 Ga0307410_10005690
782 Ga0307410_10006322
783 Ga0307410_10032566
784 Ga0307410_10034142
785 Ga0307410_10034382
786 Ga0307410_10131023
787 Ga0307410_10389127
788 Ga0307410_10577608
789 Ga0307410_10744146
790 Ga0307410_11530987
791 Ga0307406_10064832
792 Ga0307406_10121012
793 Ga0307406_10276810
794 Ga0307406_10431460
795 Ga0307406_10757268
796 Ga0307406_10843247
797 Ga0307407_10137010
798 Ga0307407_10166108
799 Ga0307412_10229586
800 Ga0307412_10391299
801 Ga0307412_10450033
802 Ga0307409_100018118
803 Ga0307409_100031338
804 Ga0307409_100032677
805 Ga0307409_100054058
806 Ga0307409_100069820
807 Ga0307409_100209635
808 Ga0307409_100495819
809 Ga0307416_100009837
810 Ga0307416_100018223
811 Ga0307416_100047418
812 Ga0307416_100105611
813 Ga0307416_100167993
814 Ga0307414_10028833
815 Ga0307414_10101080
816 Ga0307414_10146695
817 Ga0307414_10176972
818 Ga0307414_10223255
819 Ga0307414_10290091
820 Ga0307414_10330289
821 Ga0307414_10374727
822 Ga0307414_10618458
823 Ga0307414_11572255
824 Ga0307411_10006951
825 Ga0307411_10030685
826 Ga0307411_10036954
827 Ga0307411_10114693
828 Ga0307411_10733929
829 Ga0307411_11826202
830 Ga0307415_100004520
831 Ga0307415_100049430
832 Ga0307415_100113046
833 Ga0307415_100184543
834 Ga0307415_100238262
835 Ga0307415_100298870
836 Ga0307415_100483840
837 Ga0307415_100565772
838 Ga0307415_100598465
839 Ga0373930_0084732
840 Ga0373959_0102796
841 Ga0373928_0066726
842 Ga0373940_0010014
843 Ga0373940_0138804
844 Ga0373939_0031189
845 Ga0373941_0066320
846 Ga0373941_0246503
847 Ga0373960_0048738
848 Ga0373960_0164752
849 Ga0373942_0060323
850 Ga0373942_0069633
851 Ga0373962_0113805
852 Ga0373931_0013716
853 Ga0373931_0301215
854 Ga0395905_0070520
855 Ga0242419_001430
856 Ga0242420_000877
857 Ga0436365_1670746
858 Ga0439439_0009740
859 Ga0439439_0039920
860 Ga0439453_0014658
861 Ga0451802_0473963
862 Ga0439448_0010155
863 Ga0450914_055329
864 Ga0450898_066556
865 Ga0439446_0026441
866 Ga0439458_0072216
867 Ga0439434_0162605
868 Ga0439434_0174538
869 Ga0451577_0004011
870 Ga0451577_0008578
871 Ga0451577_0026329
872 Ga0451577_0035570
873 Ga0451577_0187498
874 Ga0451577_0526403
875 Ga0453683_0031436
876 Ga0453683_0093299
877 Ga0466964_0226422
878 Ga0453684_0000294
879 Ga0453684_0053339
880 Ga0453684_0086475
881 Ga0453684_0121237
882 Ga0453684_1457199
883 Ga0466960_0198080
884 Ga0451576_0045516
885 Ga0451576_0320787
886 Ga0466967_0825674
887 Ga0466967_1876954
888 Ga0495603_0346029
889 Ga0495594_0177313
890 Ga0495586_0566063
891 Ga0495622_0246941
892 Ga0495588_0277463
893 Ga0495636_0332230
894 Ga0496100_0421845
895 Ga0496101_0015685
896 Ga0496102_0003758
897 Ga0496102_0027574
898 Ga0496102_0082018
899 Ga0496102_0124578
900 Ga0496102_0194193
901 Ga0496103_0571092
902 Ga0496103_0730411
903 Ga0496104_0006968
904 Ga0496104_0008642
905 Ga0496104_0015007
906 Ga0496104_1554723
907 Ga0496105_0053584
908 Ga0496105_0138779
909 Ga0496106_0060819
910 Ga0496106_0113673
911 Ga0496106_0252299
912 Ga0496107_0270113
913 Ga0496107_0423548
914 Ga0496108_0000162
915 Ga0496108_0005235
916 Ga0496108_0019015
917 Ga0496108_0080610
918 Ga0496109_0001612
919 Ga0496109_0021009
920 Ga0496109_0086648
921 Ga0496109_0280177
922 Ga0496110_0010371
923 Ga0496110_0020598
924 Ga0496110_0022407
925 Ga0496110_1434976
926 Ga0496111_0002233
927 Ga0496111_0007826
928 Ga0496111_0012480
929 Ga0496111_0073770
930 Ga0496112_0000435
931 Ga0496112_0028467
932 Ga0496112_0056693
933 Ga0496112_0100023
934 Ga0496112_0288952
935 Ga0496113_0000082
936 Ga0496113_0001831
937 Ga0496113_0198477
938 Ga0496114_0072966
939 Ga0496115_0656106
940 Ga0501292_007240
941 Ga0501298_061157
942 Ga0501031_0133453
943 Ga0501033_0246890
944 Ga0501034_0001315
945 Ga0501034_0735484
946 Ga0501036_0135303
947 Ga0501036_0178185
948 Ga0501036_0507914
949 Ga0501038_0433341
950 Ga0501038_0815186
951 Ga0501040_0065333
952 Ga0501040_0095591
953 Ga0501040_0115412
954 Ga0501040_0231794
955 Ga0501040_0432867
956 Ga0501041_0684921
957 Ga0501042_0005298
958 Ga0501042_0992574
959 Ga0501046_0030291
960 Ga0501046_0081879
961 Ga0501046_0714649
962 Ga0501048_0208457
963 Ga0501048_0214813
964 Ga0501067_0001316
965 Ga0501067_0018941
966 Ga0501067_0727664
967 Ga0501068_0000545
968 Ga0501068_0020807
969 Ga0501069_0001804
970 Ga0501069_0004142
971 Ga0501069_0048675
972 Ga0501069_0637596
973 Ga0501070_0031814
974 Ga0501070_0109079
975 Ga0501071_0073649
976 Ga0501071_0660507
977 Ga0501071_0909175
978 Ga0501072_0010140
979 Ga0501072_0016360
980 Ga0501073_0023640
981 Ga0501074_0012702
982 Ga0501074_0099455
983 Ga0501074_1259154
984 Ga0501075_0007332
985 Ga0501075_0225490
986 Ga0501075_0277607
987 Ga0501076_0009162
988 Ga0501076_0146872
989 Ga0501076_0382415
990 Ga0501076_1250031
991 Ga0501077_0000408
992 Ga0501077_0005423
993 Ga0501077_0323731
994 Ga0501202_011564
995 Ga0501209_144814
996 Ga0501217_004715
997 Ga0501230_005002
998 Ga0501248_006697
999 Ga0501249_009031
1000 Ga0501252_094357
1001 Ga0501256_005618
1002 Ga0501257_175190
1003 Ga0501259_065837
1004 Ga0501261_018942
1005 Ga0501219_002854
1006 Ga0501234_007914
1007 Ga0501079_0010710
1008 Ga0501079_0017629
1009 Ga0501079_0075868
1010 Ga0501079_0667892
1011 Ga0501080_0106179
1012 Ga0501080_0114482
1013 Ga0501081_0010146
1014 Ga0501081_0174614
1015 Ga0501081_0385018
1016 Ga0501081_0640959
1017 Ga0501083_0012133
1018 Ga0501083_0158962
1019 Ga0501263_008812
1020 Ga0501267_003814
1021 Ga0501268_000564
1022 Ga0501271_012179
1023 Ga0501273_001859
1024 Ga0501281_11995
1025 Ga0501283_004318
1026 Ga0501045_0539622
1027 Ga0501045_1372802
1028 Ga0501226_028340
1029 nmdc:mga05p37_132631_c1
1030 nmdc:mga05p37_744246_c1
1031 nmdc:mga05p37_90143_c1
1032 nmdc:mga09592_205971_c1
1033 nmdc:mga09592_64339_c1
1034 nmdc:mga09592_863555_c1
1035 nmdc:mga0qj67_1328466_c1
1036 nmdc:mga0qj67_1582871_c1
1037 nmdc:mga06r32_1112887_c1
1038 nmdc:mga06r32_34439_c1
1039 nmdc:mga06r32_732458_c1
1040 nmdc:mga0n895_1018155_c1
1041 nmdc:mga0n895_1251356_c1
1042 nmdc:mga0n895_1417190_c1
1043 nmdc:mga0n895_1813989_c1
1044 nmdc:mga0n895_47156_c1
1045 nmdc:mga0n895_48422_c1
1046 nmdc:mga0n895_573816_c1
1047 nmdc:mga0rr50_1213738_c1
1048 nmdc:mga0rr50_160439_c1
1049 nmdc:mga0rr50_170066_c1
1050 nmdc:mga0rr50_305197_c1
1051 nmdc:mga0rr50_535518_c1
1052 nmdc:mga08x19_149302_c1
1053 nmdc:mga08x19_173031_c1
1054 nmdc:mga08x19_283687_c1
1055 nmdc:mga0a205_1317982_c1
1056 nmdc:mga0a205_134694_c1
1057 nmdc:mga0a205_1451968_c1
1058 nmdc:mga0a205_283359_c1
1059 nmdc:mga0a205_433593_c1
1060 nmdc:mga0a205_526218_c1
1061 nmdc:mga0a205_76959_c1
1062 Ga0501084_0003779
1063 Ga0501084_0019360
1064 Ga0501084_0056234
1065 Ga0501084_0400773
1066 Ga0501084_0485104
1067 Ga0590071_004205
1068 Ga0590071_079502
1069 Ga0590071_118078
1070 Ga0590074_027924
1071 Ga0590074_063338
1072 Ga0590075_014097
1073 Ga0590077_011116
1074 Ga0590077_015531
1075 Ga0501082_0010659
1076 Ga0501082_0038369
1077 Ga0501082_0051371
1078 Ga0501082_0153170
1079 Ga0501082_0158140
1080 Ga0501082_0328458
1081 Ga0501082_0904072
1082 Ga0501082_1559338
1083 Ga0530510_0029605
1084 Ga0530510_0272358
1085 Ga0530510_0448613
1086 Ga0530510_0636177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

20

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9174 4 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9032 4 137
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9022 6 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9009 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.8948 1 139
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9013 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8952 1 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8924 6 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8743 4 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8731 6 137 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7J4JW67-F1-model_v4 YjbQ family protein 0.9089 1 139
AF-A0A2T0AKK9-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9073 6 138
AF-A0A1Y3Q3M5-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9063 4 138
AF-A0A3S9V2T1-F1-model_v4 YjbQ family protein 0.9057 4 139
AF-A0A7C6LEC2-F1-model_v4 YjbQ family protein 0.9056 5 138

Map