F461565

General Info

Members Datasets Scaffolds Average Seq Length
542 338 496 452

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904434214|2904438564
Length 507
Sequence VTSVIGFFVAIDILVVFHELGHYSVARWCGVKVLRFSIGFGKPLLQRQGRDGTLWTIGWLPLGGYVRMLDERDPTQVRSDAVEDADGTVRVTAVSGSGTAAADTADAVTYRIAPADLPHAFNRQSVGKRFAIVAAGPIANFLLAILLFAGLSWYGQPEPEAILGTPTQDSMAQRAGIASGERVVAVRVTQRDGSDDGDVAYRSVRSWPELRHWLARDVDADASTVILRTQRPDGVATHTLSLAALQGDTPGKRRADMVGAGGGQADIATRLGLVPGGAAPLIASVQPGTPAAKAGLQEGDTVLRVQGETVDDANALVQMMRERPGRDTVLDIQRGNQNVTVHVVPEAVKEAGGGLPYGRIGAALGMRLPLVDVHYGPVESVRMAVGRTWDVASFSVEMFGRMLTGQASLKNLSGPVTIADYAGRSARMGVSAFISFLALVSISLGVLNLLPIPVLDGGHLLYYAVEALTGRAVSDRWQAILQRAGLVCIVALSVVALFNDLTRLAHS

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2519103095 Burkholderia sp. KJ006 Isolate Nodule
4 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
5 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
6 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
7 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
8 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
9 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
10 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
11 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
12 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
13 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
14 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
15 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
16 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
17 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
18 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
19 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
20 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
21 2818991452 Burkholderia cepacia 561 Isolate Unclassified
22 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
25 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
26 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
29 2904564687 Burkholderia sp. 571 Isolate Unclassified
30 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
31 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
32 2928163908 Burkholderia sp. 567 Isolate Unclassified
33 2928170801 Burkholderia sp. 572 Isolate Unclassified
34 2928536128 Burkholderia sola 565 Isolate Unclassified
35 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
38 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
190 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
191 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
192 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
193 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
194 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
195 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 639633007 Azoarcus olearius BH72 Isolate Unclassified
329 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
330 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
331 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
332 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
333 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
334 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
335 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
336 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
337 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
338 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.18
Isolates 8.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.37
Rhizoplane 5.35
Rhizosphere 78.23
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000873 3300002067 Bacteria 10758
2 JGI24735J21928_10001265 3300002067 Bacteria 8973
3 Ga0055532_1003986 3300003758 Bacteria 2347
4 Ga0055527_1001753 3300003760 Bacteria 4185
5 Ga0055527_1001754 3300003760 Bacteria 4185
6 Ga0055535_1003659 3300003761 Bacteria 4185
7 Ga0055535_1003660 3300003761 Bacteria 4185
8 Ga0055542_1003532 3300003762 Bacteria 4185
9 Ga0055542_1003533 3300003762 Bacteria 4185
10 Ga0055529_1001476 3300003763 Bacteria 7024
11 Ga0055541_1007513 3300003841 Bacteria 1786
12 Ga0065704_10127221 3300005289 Bacteria 1678
13 Ga0070658_10002393 3300005327 Bacteria 15721
14 Ga0070658_10011021 3300005327 Bacteria 7247
15 Ga0070658_10059779 3300005327 Bacteria 3103
16 Ga0070658_10156923 3300005327 Bacteria 1908
17 Ga0070683_100070791 3300005329 Bacteria 3254
18 Ga0070670_100006956 3300005331 Bacteria 9588
19 Ga0070677_10015794 3300005333 Bacteria 2679
20 Ga0068869_100003904 3300005334 Bacteria 9197
21 Ga0068869_100025411 3300005334 Bacteria 4112
22 Ga0070666_10052439 3300005335 Bacteria 2749
23 Ga0068868_100035264 3300005338 Bacteria 3866
24 Ga0070660_100000504 3300005339 Bacteria 26092
25 Ga0070660_100001298 3300005339 Bacteria 17020
26 Ga0070661_100029621 3300005344 Bacteria 3952
27 Ga0070661_100102132 3300005344 Bacteria 2134
28 Ga0070675_100021815 3300005354 Bacteria 5116
29 Ga0070675_100044998 3300005354 Bacteria 3611
30 Ga0070671_100027234 3300005355 Bacteria 4703
31 Ga0070673_100005910 3300005364 Bacteria 7901
32 Ga0070673_100025823 3300005364 Bacteria 4330
33 Ga0070659_100000096 3300005366 Bacteria 66336
34 Ga0070667_100148267 3300005367 Bacteria 2059
35 Ga0070714_100051697 3300005435 Bacteria 3504
36 Ga0070713_100087693 3300005436 Bacteria 2670
37 Ga0070663_100002692 3300005455 Bacteria 10057
38 Ga0070678_100008537 3300005456 Bacteria 6137
39 Ga0070681_10016840 3300005458 Bacteria 7300
40 Ga0070681_10052589 3300005458 Bacteria 4063
41 Ga0068867_100151413 3300005459 Bacteria 1822
42 Ga0070684_100184485 3300005535 Bacteria 1897
43 Ga0068853_100008688 3300005539 Bacteria 8170
44 Ga0068853_100013155 3300005539 Bacteria 6753
45 Ga0068853_100203455 3300005539 Bacteria 1802
46 Ga0070672_100010363 3300005543 Bacteria 6463
47 Ga0070693_100011277 3300005547 Bacteria 4500
48 Ga0070693_100047823 3300005547 Bacteria 2435
49 Ga0070665_100054800 3300005548 Bacteria 3999
50 Ga0070665_100099519 3300005548 Bacteria 2912
51 Ga0068855_100010957 3300005563 Bacteria 10939
52 Ga0068855_100019484 3300005563 Bacteria 8153
53 Ga0068855_100019488 3300005563 Bacteria 8153
54 Ga0068855_100020921 3300005563 Bacteria 7846
55 Ga0068855_100148799 3300005563 Bacteria 2663
56 Ga0070664_100049898 3300005564 Bacteria 3540
57 Ga0068854_100078468 3300005578 Bacteria 2433
58 Ga0068856_100079495 3300005614 Bacteria 3252
59 Ga0068852_100005797 3300005616 Bacteria 8870
60 Ga0068859_100198246 3300005617 Bacteria 2092
61 Ga0068859_100253645 3300005617 Bacteria 1850
62 Ga0068866_10059311 3300005718 Bacteria 1979
63 Ga0068851_10020503 3300005834 Bacteria 3202
64 Ga0068870_10052284 3300005840 Bacteria 2166
65 Ga0068870_10061437 3300005840 Bacteria 2020
66 Ga0068863_100030839 3300005841 Bacteria 5120
67 Ga0068863_100073057 3300005841 Bacteria 3245
68 Ga0068858_100032267 3300005842 Bacteria 4865
69 Ga0068858_100082743 3300005842 Bacteria 2984
70 Ga0068862_100039651 3300005844 Bacteria 4001
71 Ga0070717_10130248 3300006028 Bacteria 2163
72 Ga0075369_10002482 3300006186 Bacteria 6587
73 Ga0075366_10003539 3300006195 Bacteria 8256
74 Ga0097621_100003683 3300006237 Bacteria 10596
75 Ga0097621_100014887 3300006237 Bacteria 5836
76 Ga0068871_100016562 3300006358 Bacteria 5558
77 Ga0068871_100019776 3300006358 Bacteria 5145
78 Ga0068871_100048150 3300006358 Bacteria 3440
79 Ga0068871_100160874 3300006358 Bacteria 1920
80 Ga0075428_100000245 3300006844 Bacteria 53219
81 Ga0075430_100020343 3300006846 Bacteria 5647
82 Ga0075430_100056022 3300006846 Bacteria 3315
83 Ga0075431_100003069 3300006847 Bacteria 16172
84 Ga0075431_100034097 3300006847 Bacteria 5245
85 Ga0075434_100041481 3300006871 Bacteria 4560
86 Ga0075429_100008747 3300006880 Bacteria 8806
87 Ga0075436_100008048 3300006914 Bacteria 7218
88 Ga0097620_100198243 3300006931 Bacteria 2092
89 Ga0097620_100253647 3300006931 Bacteria 1850
90 Ga0099794_10053454 3300007265 Bacteria 1948
91 Ga0105251_10001119 3300009011 Bacteria 23332
92 Ga0105240_10001770 3300009093 Bacteria 36461
93 Ga0105240_10059340 3300009093 Bacteria 4775
94 Ga0111539_10000383 3300009094 Bacteria 54556
95 Ga0111539_10080582 3300009094 Bacteria 3829
96 Ga0105245_10086042 3300009098 Bacteria 2882
97 Ga0105245_10164908 3300009098 Bacteria 2105
98 Ga0105243_10000770 3300009148 Bacteria 30670
99 Ga0105243_10026412 3300009148 Bacteria 4444
100 Ga0105243_10116079 3300009148 Bacteria 2248
101 Ga0105241_10017067 3300009174 Bacteria 5331
102 Ga0105242_10049912 3300009176 Bacteria 3406
103 Ga0105248_10002407 3300009177 Bacteria 20777
104 Ga0105248_10058954 3300009177 Bacteria 4312
105 Ga0105248_10137513 3300009177 Bacteria 2756
106 Ga0105237_10005766 3300009545 Bacteria 13911
107 Ga0105238_10001068 3300009551 Bacteria 27660
108 Ga0105238_10014298 3300009551 Bacteria 8023
109 Ga0105238_10078193 3300009551 Bacteria 3299
110 Ga0105249_10144621 3300009553 Bacteria 2283
111 Ga0105239_10002463 3300010375 Bacteria 23588
112 Ga0105239_10003884 3300010375 Bacteria 18132
113 Ga0105239_10007605 3300010375 Bacteria 12417
114 Ga0105239_10069989 3300010375 Bacteria 3854
115 Ga0157373_10006985 3300013100 Bacteria 8410
116 Ga0157373_10083475 3300013100 Bacteria 2252
117 Ga0157371_10007279 3300013102 Bacteria 8990
118 Ga0157370_10007952 3300013104 Bacteria 11485
119 Ga0157370_10008261 3300013104 Bacteria 11238
120 Ga0157370_10157383 3300013104 Bacteria 2114
121 Ga0157369_10000511 3300013105 Bacteria 51116
122 Ga0157369_10000979 3300013105 Bacteria 36209
123 Ga0157369_10002197 3300013105 Bacteria 23502
124 Ga0157369_10091577 3300013105 Bacteria 3245
125 Ga0157369_10246458 3300013105 Bacteria 1865
126 Ga0157374_10000107 3300013296 Bacteria 75925
127 Ga0157374_10031938 3300013296 Bacteria 4790
128 Ga0157374_10127586 3300013296 Bacteria 2459
129 Ga0157378_10063541 3300013297 Bacteria 3298
130 Ga0157378_10097337 3300013297 Bacteria 2682
131 Ga0157378_10169632 3300013297 Bacteria 2046
132 Ga0163162_10006481 3300013306 Bacteria 11333
133 Ga0157372_10002854 3300013307 Bacteria 18675
134 Ga0157372_10128119 3300013307 Bacteria 2919
135 Ga0157372_10129037 3300013307 Bacteria 2908
136 Ga0157372_10415704 3300013307 Bacteria 1567
137 Ga0157375_10023805 3300013308 Bacteria 5658
138 Ga0157375_10028549 3300013308 Bacteria 5232
139 Ga0157375_10069517 3300013308 Bacteria 3528
140 Ga0157375_10173663 3300013308 Bacteria 2304
141 Ga0157380_10210633 3300014326 Bacteria 1732
142 Ga0157376_10011903 3300014969 Bacteria 6433
143 Ga0157376_10040685 3300014969 Bacteria 3800
144 Ga0157376_10151166 3300014969 Bacteria 2094
145 Ga0182006_1033937 3300015261 Bacteria 2044
146 Ga0182007_10031403 3300015262 Bacteria 1809
147 Ga0182005_1020509 3300015265 Bacteria 1818
148 Ga0213872_10000003 3300021361 Bacteria 366948
149 Ga0209566_100559 3300025225 Bacteria 24573
150 Ga0209672_100014 3300025228 Bacteria 546252
151 Ga0209672_100023 3300025228 Bacteria 371758
152 Ga0209672_100433 3300025228 Bacteria 24114
153 Ga0209147_100094 3300025229 Bacteria 167145
154 Ga0209147_100104 3300025229 Bacteria 158375
155 Ga0209147_101808 3300025229 Bacteria 6696
156 Ga0209258_100040 3300025242 Bacteria 385401
157 Ga0209258_100142 3300025242 Bacteria 165865
158 Ga0209148_1000035 3300025254 Bacteria 548413
159 Ga0209759_1000030 3300025256 Bacteria 285649
160 Ga0209759_1011780 3300025256 Bacteria 2462
161 Ga0209455_1000072 3300025272 Bacteria 293074
162 Ga0209564_1004868 3300025295 Bacteria 7977
163 Ga0209257_1026844 3300025304 Bacteria 1930
164 Ga0207713_1002241 3300025735 Bacteria 14307
165 Ga0207682_10020088 3300025893 Bacteria 2620
166 Ga0207647_10000108 3300025904 Bacteria 63172
167 Ga0207647_10000498 3300025904 Bacteria 31401
168 Ga0207647_10036364 3300025904 Bacteria 3129
169 Ga0207643_10018307 3300025908 Bacteria 3836
170 Ga0207643_10084818 3300025908 Bacteria 1839
171 Ga0207705_10001472 3300025909 Bacteria 18763
172 Ga0207705_10010151 3300025909 Bacteria 6852
173 Ga0207654_10003311 3300025911 Bacteria 8149
174 Ga0207707_10145180 3300025912 Bacteria 2074
175 Ga0207695_10012800 3300025913 Bacteria 10045
176 Ga0207695_10026800 3300025913 Bacteria 6428
177 Ga0207695_10232992 3300025913 Bacteria 1745
178 Ga0207671_10008853 3300025914 Bacteria 8477
179 Ga0207662_10036199 3300025918 Bacteria 2884
180 Ga0207657_10000004 3300025919 Bacteria 247179
181 Ga0207657_10064846 3300025919 Bacteria 3116
182 Ga0207649_10022174 3300025920 Bacteria 3668
183 Ga0207694_10024852 3300025924 Bacteria 4550
184 Ga0207650_10023575 3300025925 Bacteria 4365
185 Ga0207687_10010562 3300025927 Bacteria 6035
186 Ga0207644_10017931 3300025931 Bacteria 4787
187 Ga0207690_10000015 3300025932 Bacteria 257457
188 Ga0207709_10005524 3300025935 Bacteria 7171
189 Ga0207691_10007106 3300025940 Bacteria 10808
190 Ga0207689_10000974 3300025942 Bacteria 27470
191 Ga0207661_10188261 3300025944 Bacteria 1808
192 Ga0207667_10002397 3300025949 Bacteria 23474
193 Ga0207667_10003025 3300025949 Bacteria 20864
194 Ga0207667_10005390 3300025949 Bacteria 15598
195 Ga0207667_10007177 3300025949 Bacteria 13441
196 Ga0207667_10097788 3300025949 Bacteria 3029
197 Ga0207651_10019003 3300025960 Bacteria 4107
198 Ga0207651_10040384 3300025960 Bacteria 3086
199 Ga0207640_10064246 3300025981 Bacteria 2443
200 Ga0207658_10066305 3300025986 Bacteria 2715
201 Ga0207677_10036089 3300026023 Bacteria 3218
202 Ga0207703_10030879 3300026035 Bacteria 4236
203 Ga0207703_10057411 3300026035 Bacteria 3174
204 Ga0207639_10048486 3300026041 Bacteria 3215
205 Ga0207639_10064507 3300026041 Bacteria 2840
206 Ga0207678_10001691 3300026067 Bacteria 20214
207 Ga0207678_10002079 3300026067 Bacteria 18154
208 Ga0207702_10031798 3300026078 Bacteria 4401
209 Ga0207702_10100141 3300026078 Bacteria 2556
210 Ga0207641_10068358 3300026088 Bacteria 3046
211 Ga0207648_10000142 3300026089 Bacteria 71593
212 Ga0207676_10104768 3300026095 Bacteria 2353
213 Ga0207683_10003576 3300026121 Bacteria 13558
214 Ga0207683_10187256 3300026121 Bacteria 1878
215 Ga0207698_10049953 3300026142 Bacteria 3187
216 Ga0209371_1000079 3300027312 Bacteria 187621
217 Ga0209981_1002317 3300027378 Bacteria 2418
218 Ga0209974_10006559 3300027876 Bacteria 4058
219 Ga0207428_10005311 3300027907 Bacteria 12021
220 Ga0268266_10020285 3300028379 Bacteria 5668
221 Ga0268266_10035234 3300028379 Bacteria 4258
222 Ga0268266_10185285 3300028379 Bacteria 1898
223 Ga0265336_10002632 3300028666 Bacteria 7290
224 Ga0265338_10000028 3300028800 Bacteria 279132
225 Ga0265338_10000741 3300028800 Bacteria 55680
226 Ga0265324_10000005 3300029957 Bacteria 347038
227 Ga0265324_10000205 3300029957 Bacteria 45035
228 Ga0265324_10014450 3300029957 Bacteria 2922
229 Ga0268256_1000090 3300030500 Bacteria 153976
230 Ga0265325_10000314 3300031241 Bacteria 34098
231 Ga0265331_10013109 3300031250 Bacteria 4466
232 Ga0265331_10017844 3300031250 Bacteria 3693
233 Ga0265327_10001032 3300031251 Bacteria 39265
234 Ga0265316_10108626 3300031344 Bacteria 2103
235 Ga0307408_100131321 3300031548 Bacteria 1954
236 Ga0307408_100167561 3300031548 Bacteria 1751
237 Ga0265314_10000740 3300031711 Bacteria 39277
238 Ga0316583_10013376 3300032133 Bacteria 2961
239 Ga0316593_10000190 3300032168 Bacteria 9414
240 Ga0373955_0042294 3300035172 Bacteria 2446
241 Ga0373937_0011712 3300036401 Bacteria 7692
242 Ga0373937_0090607 3300036401 Bacteria 2832
243 Ga0395899_0000007 3300037312 Bacteria 629129
244 Ga0395900_0000026 3300037418 Bacteria 313470
245 Ga0395900_0027856 3300037418 Bacteria 5788
246 Ga0395900_0044477 3300037418 Bacteria 4575
247 Ga0395898_0000497 3300037466 Bacteria 76853
248 Ga0395898_0001748 3300037466 Bacteria 28615
249 Ga0395905_0028009 3300037471 Bacteria 5311
250 Ga0395901_0000077 3300038443 Bacteria 135073
251 Ga0395901_0000296 3300038443 Bacteria 61806
252 Ga0395901_0000923 3300038443 Bacteria 31994
253 Ga0395901_0019691 3300038443 Bacteria 6899
254 Ga0400484_29948 3300038725 Bacteria 10111
255 Ga0400484_43627 3300038725 Bacteria 12060
256 Ga0400490_17851 3300038726 Bacteria 80099
257 Ga0400485_07894 3300038735 Bacteria 3828
258 Ga0400488_31176 3300038741 Bacteria 4202
259 Ga0400488_33004 3300038741 Bacteria 10792
260 Ga0400488_38891 3300038741 Bacteria 20773
261 Ga0400486_00233 3300038742 Bacteria 7497
262 Ga0400486_14851 3300038742 Bacteria 63108
263 Ga0400483_108358 3300039062 Bacteria 8062
264 Ga0400483_121666 3300039062 Bacteria 18159
265 Ga0400483_145565 3300039062 Bacteria 12981
266 Ga0400483_179405 3300039062 Bacteria 2925
267 Ga0400483_192031 3300039062 Bacteria 23073
268 Ga0400483_241642 3300039062 Bacteria 19322
269 Ga0400483_268051 3300039062 Bacteria 17073
270 Ga0400487_01458 3300039110 Bacteria 5704
271 Ga0400487_19502 3300039110 Bacteria 1877
272 Ga0400487_24806 3300039110 Bacteria 35141
273 Ga0436365_1054781 3300039437 Bacteria 2190
274 Ga0436361_0007468 3300039447 Bacteria 5122
275 Ga0436361_0746584 3300039447 Bacteria 9390
276 Ga0436361_1124174 3300039447 Bacteria 21478
277 Ga0439448_0004190 3300042005 Bacteria 4060
278 Ga0451577_0000002 3300042876 Bacteria 1731375
279 Ga0451577_0000319 3300042876 Bacteria 90564
280 Ga0451577_0023500 3300042876 Bacteria 5621
281 Ga0451577_0045119 3300042876 Bacteria 3946
282 Ga0451577_0117675 3300042876 Bacteria 2380
283 Ga0466969_0000297 3300044656 Bacteria 27202
284 Ga0466969_0014342 3300044656 Bacteria 4165
285 Ga0466969_0029521 3300044656 Bacteria 2799
286 Ga0466977_0001674 3300044666 Bacteria 9434
287 Ga0453683_0000003 3300044673 Bacteria 942572
288 Ga0453683_0021694 3300044673 Bacteria 4098
289 Ga0466965_0001551 3300044683 Bacteria 9348
290 Ga0466966_0000084 3300044684 Bacteria 58535
291 Ga0466966_0007478 3300044684 Bacteria 7239
292 Ga0466966_0009017 3300044684 Bacteria 6610
293 Ga0466966_0024377 3300044684 Bacteria 3958
294 Ga0466966_0069537 3300044684 Bacteria 2208
295 Ga0466961_0000567 3300044693 Bacteria 23500
296 Ga0466961_0009347 3300044693 Bacteria 6244
297 Ga0466961_0031147 3300044693 Bacteria 3428
298 Ga0466961_0076667 3300044693 Bacteria 2118
299 Ga0466963_0001538 3300044694 Bacteria 12494
300 Ga0466963_0018644 3300044694 Bacteria 4343
301 Ga0466964_0001157 3300044706 Bacteria 8921
302 Ga0453684_0000002 3300044712 Bacteria 1731375
303 Ga0453684_0000075 3300044712 Bacteria 437715
304 Ga0453684_0012407 3300044712 Bacteria 14056
305 Ga0453684_0018401 3300044712 Bacteria 10724
306 Ga0453684_0053791 3300044712 Bacteria 5252
307 Ga0466971_0001519 3300044719 Bacteria 9782
308 Ga0466968_0059491 3300044735 Bacteria 1646
309 Ga0466970_0019669 3300044765 Bacteria 3502
310 Ga0466970_0064372 3300044765 Bacteria 1966
311 Ga0466957_0002457 3300044842 Bacteria 9948
312 Ga0466957_0005149 3300044842 Bacteria 7309
313 Ga0466957_0032769 3300044842 Bacteria 3113
314 Ga0466957_0071889 3300044842 Bacteria 2140
315 Ga0466960_0024840 3300044901 Bacteria 2707
316 Ga0466959_0000802 3300045049 Bacteria 18513
317 Ga0466959_0003739 3300045049 Bacteria 10061
318 Ga0466959_0008983 3300045049 Bacteria 7087
319 Ga0466959_0021302 3300045049 Bacteria 4779
320 Ga0451576_0000004 3300045051 Bacteria 1312238
321 Ga0451576_0000029 3300045051 Bacteria 404449
322 Ga0451576_0000250 3300045051 Bacteria 132101
323 Ga0451576_0001615 3300045051 Bacteria 37836
324 Ga0451576_0005294 3300045051 Bacteria 16219
325 Ga0451576_0011555 3300045051 Bacteria 10017
326 Ga0451576_0012005 3300045051 Bacteria 9782
327 Ga0451576_0012462 3300045051 Bacteria 9546
328 Ga0451576_0038365 3300045051 Bacteria 5070
329 Ga0466958_0000254 3300045836 Bacteria 20704
330 Ga0466958_0000731 3300045836 Bacteria 14358
331 Ga0466967_0186318 3300045976 Bacteria 1960
332 Ga0495592_0017875 3300046454 Bacteria 5390
333 Ga0495603_0004961 3300046455 Bacteria 7963
334 Ga0495590_0009596 3300046457 Bacteria 3671
335 Ga0495629_0024830 3300046459 Bacteria 4264
336 Ga0495638_0002053 3300046460 Bacteria 17098
337 Ga0495638_0054738 3300046460 Bacteria 2479
338 Ga0495651_0034283 3300046462 Bacteria 3957
339 Ga0495651_0091675 3300046462 Bacteria 2278
340 Ga0495653_0094116 3300046463 Bacteria 2184
341 Ga0495650_0000224 3300046471 Bacteria 118058
342 Ga0495650_0003457 3300046471 Bacteria 11513
343 Ga0495650_0034042 3300046471 Bacteria 2260
344 Ga0495650_0037541 3300046471 Bacteria 2107
345 Ga0495650_0039439 3300046471 Bacteria 2038
346 Ga0495580_0016071 3300046472 Bacteria 5625
347 Ga0495605_0039456 3300046474 Bacteria 2365
348 Ga0495664_0060004 3300046477 Bacteria 2264
349 Ga0495664_0099369 3300046477 Bacteria 1752
350 Ga0495584_0053090 3300046491 Bacteria 2040
351 Ga0495607_0031805 3300046501 Bacteria 3228
352 Ga0495583_0012474 3300046506 Bacteria 4804
353 Ga0495606_0015445 3300046507 Bacteria 5881
354 Ga0495606_0145331 3300046507 Bacteria 1397
355 Ga0495628_0095529 3300046516 Bacteria 2296
356 Ga0495630_0302180 3300046517 Bacteria 1223
357 Ga0495652_0080614 3300046529 Bacteria 2688
358 Ga0495654_0000428 3300046530 Bacteria 35538
359 Ga0495654_0030825 3300046530 Bacteria 2726
360 Ga0495665_0050918 3300046531 Bacteria 2194
361 Ga0495586_0056560 3300046535 Bacteria 2128
362 Ga0495586_0111805 3300046535 Bacteria 1521
363 Ga0495587_0006632 3300046536 Bacteria 7540
364 Ga0495609_0019834 3300046538 Bacteria 3109
365 Ga0495621_0003224 3300046539 Bacteria 4481
366 Ga0495621_0010869 3300046539 Bacteria 2799
367 Ga0495597_0004490 3300046542 Bacteria 7649
368 Ga0495645_0004194 3300046543 Bacteria 9855
369 Ga0495645_0013820 3300046543 Bacteria 5720
370 Ga0495645_0020676 3300046543 Bacteria 4752
371 Ga0495645_0081925 3300046543 Bacteria 2314
372 Ga0495645_0089437 3300046543 Bacteria 2202
373 Ga0495622_0001676 3300046557 Bacteria 10959
374 Ga0495667_0008494 3300046559 Bacteria 6971
375 Ga0495611_0019128 3300046648 Bacteria 2941
376 Ga0495625_0099965 3300046660 Bacteria 1994
377 Ga0495635_0118106 3300046663 Bacteria 1810
378 Ga0495657_0060592 3300046675 Bacteria 2507
379 Ga0495599_0044046 3300046678 Bacteria 2799
380 Ga0495623_0080470 3300046679 Bacteria 2016
381 Ga0495669_0006587 3300046684 Bacteria 4856
382 Ga0495669_0032792 3300046684 Bacteria 2284
383 Ga0495624_0040024 3300046690 Bacteria 3003
384 Ga0495624_0080393 3300046690 Bacteria 2019
385 Ga0495670_0003239 3300046691 Bacteria 8016
386 Ga0495671_0005413 3300046692 Bacteria 7472
387 Ga0495671_0020374 3300046692 Bacteria 3495
388 Ga0495649_0035118 3300046694 Bacteria 2757
389 Ga0495589_0006457 3300046794 Bacteria 6182
390 Ga0495600_0080517 3300046809 Bacteria 2126
391 Ga0495660_0042286 3300046810 Bacteria 2519
392 Ga0495581_0036259 3300047315 Bacteria 2853
393 Ga0495604_0025792 3300047317 Bacteria 4681
394 Ga0495674_0058466 3300047319 Bacteria 3370
395 Ga0495674_0142085 3300047319 Bacteria 2017
396 Ga0495680_0033291 3300047322 Bacteria 4174
397 Ga0495680_0095292 3300047322 Bacteria 2225
398 Ga0495683_0005181 3300047323 Bacteria 7261
399 Ga0495687_001154 3300047443 Bacteria 25585
400 Ga0495675_0038381 3300047444 Bacteria 3049
401 Ga0495675_0090023 3300047444 Bacteria 1926
402 Ga0495679_000102 3300047446 Bacteria 76337
403 Ga0495684_0081603 3300047471 Bacteria 2454
404 Ga0495686_0000002 3300047472 Bacteria 1050777
405 Ga0495686_0068900 3300047472 Bacteria 2182
406 Ga0495593_0030003 3300047673 Bacteria 2978
407 Ga0495593_0038870 3300047673 Bacteria 2568
408 Ga0495593_0046238 3300047673 Bacteria 2320
409 Ga0495614_0037940 3300048089 Bacteria 2068
410 Ga0495614_0067220 3300048089 Bacteria 1543
411 Ga0495626_0013534 3300048091 Bacteria 4237
412 Ga0496100_0003455 3300048903 Bacteria 8240
413 Ga0496100_0058050 3300048903 Bacteria 2538
414 Ga0496101_0003813 3300048904 Bacteria 9419
415 Ga0496101_0201261 3300048904 Bacteria 1540
416 Ga0496102_0003091 3300048905 Bacteria 14107
417 Ga0496102_0263983 3300048905 Bacteria 1623
418 Ga0496103_0001420 3300048906 Bacteria 16051
419 Ga0496104_0187250 3300048907 Bacteria 1981
420 Ga0496105_0138088 3300048908 Bacteria 2007
421 Ga0496106_0001077 3300048909 Bacteria 20151
422 Ga0496106_0027324 3300048909 Bacteria 4250
423 Ga0496106_0059256 3300048909 Bacteria 2900
424 Ga0496107_0116147 3300048910 Bacteria 1970
425 Ga0496109_0126523 3300048912 Bacteria 2383
426 Ga0496109_0214428 3300048912 Bacteria 1810
427 Ga0496110_0000457 3300048913 Bacteria 27743
428 Ga0496110_0032191 3300048913 Bacteria 4527
429 Ga0496111_0009434 3300048914 Bacteria 6513
430 Ga0496111_0082443 3300048914 Bacteria 2349
431 Ga0496111_0082732 3300048914 Bacteria 2345
432 Ga0496112_0010133 3300048915 Bacteria 8537
433 Ga0496113_0001720 3300048916 Bacteria 12380
434 Ga0496114_0009017 3300048917 Bacteria 7906
435 Ga0496114_0290531 3300048917 Bacteria 1442
436 Ga0496115_0034553 3300048918 Bacteria 3996
437 Ga0496116_0039696 3300048919 Bacteria 3250
438 Ga0496117_0005730 3300048920 Bacteria 12910
439 Ga0496117_0012388 3300048920 Bacteria 7524
440 Ga0496117_0070837 3300048920 Bacteria 2339
441 Ga0496118_0001989 3300048921 Bacteria 29022
442 Ga0496118_0005512 3300048921 Bacteria 14361
443 Ga0496118_0063179 3300048921 Bacteria 2725
444 Ga0496121_0003420 3300048924 Bacteria 22697
445 Ga0496121_0074975 3300048924 Bacteria 2704
446 Ga0496121_0099771 3300048924 Bacteria 2243
447 Ga0496122_0004586 3300048925 Bacteria 17012
448 Ga0496123_0015693 3300048926 Bacteria 6197
449 Ga0496124_0001916 3300048927 Bacteria 28536
450 Ga0496126_0002042 3300048929 Bacteria 28406
451 Ga0466983_0196272 3300048986 Bacteria 1612
452 Ga0495678_026175 3300049459 Bacteria 2494
453 Ga0501039_0030275 3300049575 Bacteria 4173
454 Ga0501039_0068019 3300049575 Bacteria 2766
455 Ga0501039_0158298 3300049575 Bacteria 1780
456 Ga0501042_0198529 3300049578 Bacteria 1447
457 Ga0501043_0000141 3300049579 Bacteria 67326
458 Ga0501046_0000047 3300049580 Bacteria 140344
459 Ga0501047_0000058 3300049581 Bacteria 139202
460 Ga0501048_0000475 3300049582 Bacteria 28030
461 Ga0501067_0043438 3300049583 Bacteria 2496
462 Ga0501070_0000612 3300049586 Bacteria 32731
463 Ga0501070_0003856 3300049586 Bacteria 12935
464 Ga0501070_0175917 3300049586 Bacteria 1762
465 Ga0501071_0056146 3300049587 Bacteria 2843
466 Ga0501073_0001654 3300049589 Bacteria 16525
467 Ga0501074_0000811 3300049590 Bacteria 19770
468 Ga0501074_0001507 3300049590 Bacteria 15711
469 Ga0501076_0026193 3300049592 Bacteria 4514
470 Ga0501079_0030446 3300049741 Bacteria 4146
471 Ga0501080_0008750 3300049742 Bacteria 9193
472 Ga0501080_0024443 3300049742 Bacteria 5599
473 Ga0501080_0032837 3300049742 Bacteria 4842
474 Ga0501080_0114349 3300049742 Bacteria 2502
475 Ga0501083_0002111 3300049744 Bacteria 13636
476 Ga0501280_000375 3300049776 Bacteria 10946
477 Ga0501045_0015906 3300049824 Bacteria 5337
478 nmdc:mga0k408_24582_c1 3300050493 Bacteria 3406
479 nmdc:mga0k408_380_c2 3300050493 Bacteria 20523
480 nmdc:mga09592_1274_c1 3300050508 Bacteria 13551
481 nmdc:mga0qj67_81220_c1 3300050509 Bacteria 2599
482 nmdc:mga06r32_18433_c1 3300050510 Bacteria 6390
483 nmdc:mga06r32_28961_c1 3300050510 Bacteria 5185
484 nmdc:mga08y16_65551_c1 3300050511 Bacteria 3791
485 nmdc:mga0n895_126170_c1 3300050512 Bacteria 2583
486 nmdc:mga08x19_5866_c1 3300050514 Bacteria 7268
487 Ga0500618_000976 3300053125 Bacteria 14500
488 Ga0500636_0000185 3300053177 Bacteria 33554
489 Ga0500625_002765 3300053729 Bacteria 6694
490 Ga0501084_0023535 3300054114 Bacteria 5139
491 Ga0501084_0229158 3300054114 Bacteria 1568
492 Ga0501082_0017124 3300060353 Bacteria 6244
493 Ga0466962_0000537 3300061719 Bacteria 16663
494 Ga0466962_0000675 3300061719 Bacteria 15172
495 Ga0466962_0022586 3300061719 Bacteria 3023
496 Ga0466962_0032196 3300061719 Bacteria 2510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0302180 Ga0495630_0302180_11_1141 359
2 3300046530 Ga0495654_0030825 Ga0495654_0030825_15_1175 385
3 3300025304 Ga0209257_1026844 Ga0209257_10268442 410
4 3300047319 Ga0495674_0142085 Ga0495674_0142085_54_1448 410
5 3300044901 Ga0466960_0024840 Ga0466960_0024840_511_1761 413
6 3300005344 Ga0070661_100102132 Ga0070661_1001021322 414
7 3300005435 Ga0070714_100051697 Ga0070714_1000516973 414
8 3300005436 Ga0070713_100087693 Ga0070713_1000876932 414
9 3300005535 Ga0070684_100184485 Ga0070684_1001844851 414
10 3300005539 Ga0068853_100013155 Ga0068853_1000131554 414
11 3300005563 Ga0068855_100019488 Ga0068855_1000194882 414
12 3300005614 Ga0068856_100079495 Ga0068856_1000794952 414
13 3300006028 Ga0070717_10130248 Ga0070717_101302482 414
14 3300009093 Ga0105240_10059340 Ga0105240_100593402 414
15 3300009174 Ga0105241_10017067 Ga0105241_100170674 414
16 3300009551 Ga0105238_10014298 Ga0105238_100142982 414
17 3300013105 Ga0157369_10246458 Ga0157369_102464581 414
18 3300013307 Ga0157372_10129037 Ga0157372_101290372 414
19 3300025911 Ga0207654_10003311 Ga0207654_100033114 414
20 3300025913 Ga0207695_10012800 Ga0207695_1001280011 414
21 3300025924 Ga0207694_10024852 Ga0207694_100248522 414
22 3300025944 Ga0207661_10188261 Ga0207661_101882612 414
23 3300025949 Ga0207667_10007177 Ga0207667_100071778 414
24 3300026041 Ga0207639_10048486 Ga0207639_100484862 414
25 3300026078 Ga0207702_10031798 Ga0207702_100317982 414
26 3300039447 Ga0436361_0746584 Ga0436361_0746584_3271_4617 416
27 3300038741 Ga0400488_31176 Ga0400488_31176_1549_2919 418
28 3300039110 Ga0400487_19502 Ga0400487_19502_318_1688 418
29 3300046810 Ga0495660_0042286 Ga0495660_0042286_627_2024 420
30 3300047472 Ga0495686_0068900 Ga0495686_0068900_717_2114 420
31 3300005458 Ga0070681_10052589 Ga0070681_100525893 422
32 3300005539 Ga0068853_100008688 Ga0068853_1000086882 422
33 3300009551 Ga0105238_10078193 Ga0105238_100781932 422
34 3300010375 Ga0105239_10007605 Ga0105239_1000760511 422
35 3300026041 Ga0207639_10064507 Ga0207639_100645071 422
36 3300039447 Ga0436361_0007468 Ga0436361_0007468_789_2138 422
37 3300005617 Ga0068859_100198246 Ga0068859_1001982462 423
38 3300006931 Ga0097620_100198243 Ga0097620_1001982432 423
39 3300025256 Ga0209759_1000030 Ga0209759_1000030124 423
40 3300026023 Ga0207677_10036089 Ga0207677_100360892 423
41 3300026078 Ga0207702_10100141 Ga0207702_101001412 423
42 3300044684 Ga0466966_0007478 Ga0466966_0007478_5593_6996 423
43 3300044706 Ga0466964_0001157 Ga0466964_0001157_3929_5332 423
44 3300044842 Ga0466957_0002457 Ga0466957_0002457_986_2389 423
45 3300045049 Ga0466959_0008983 Ga0466959_0008983_5212_6615 423
46 3300046459 Ga0495629_0024830 Ga0495629_0024830_2040_3515 423
47 3300046516 Ga0495628_0095529 Ga0495628_0095529_784_2259 423
48 3300046679 Ga0495623_0080470 Ga0495623_0080470_482_1957 423
49 3300046690 Ga0495624_0080393 Ga0495624_0080393_266_1741 423
50 3300047317 Ga0495604_0025792 Ga0495604_0025792_137_1612 423
51 3300047319 Ga0495674_0058466 Ga0495674_0058466_1145_2620 423
52 3300047444 Ga0495675_0038381 Ga0495675_0038381_789_2264 423
53 3300047673 Ga0495593_0038870 Ga0495593_0038870_525_1910 423
54 3300046472 Ga0495580_0016071 Ga0495580_0016071_3845_5320 424
55 3300046457 Ga0495590_0009596 Ga0495590_0009596_1724_3199 425
56 3300046460 Ga0495638_0054738 Ga0495638_0054738_763_2238 425
57 3300046471 Ga0495650_0039439 Ga0495650_0039439_149_1534 425
58 3300046506 Ga0495583_0012474 Ga0495583_0012474_951_2426 425
59 3300046538 Ga0495609_0019834 Ga0495609_0019834_534_2009 425
60 3300046648 Ga0495611_0019128 Ga0495611_0019128_807_2192 425
61 3300046660 Ga0495625_0099965 Ga0495625_0099965_241_1716 425
62 3300046692 Ga0495671_0005413 Ga0495671_0005413_848_2323 425
63 3300047446 Ga0495679_000102 Ga0495679_000102_6238_7713 425
64 3300048091 Ga0495626_0013534 Ga0495626_0013534_538_2013 425
65 3300048905 Ga0496102_0263983 Ga0496102_0263983_211_1596 425
66 3300048920 Ga0496117_0070837 Ga0496117_0070837_518_1903 425
67 3300048921 Ga0496118_0063179 Ga0496118_0063179_773_2248 425
68 3300048924 Ga0496121_0074975 Ga0496121_0074975_478_1863 425
69 3300049459 Ga0495678_026175 Ga0495678_026175_374_1849 425
70 3300028379 Ga0268266_10035234 Ga0268266_100352342 426
71 3300046531 Ga0495665_0050918 Ga0495665_0050918_884_2167 427
72 3300048089 Ga0495614_0067220 Ga0495614_0067220_37_1320 427
73 3300021361 Ga0213872_10000003 Ga0213872_10000003100 428
74 3300038443 Ga0395901_0000077 Ga0395901_0000077_106533_107906 428
75 3300039447 Ga0436361_1124174 Ga0436361_1124174_14070_15416 428
76 3300005327 Ga0070658_10156923 Ga0070658_101569232 429
77 3300005563 Ga0068855_100020921 Ga0068855_1000209218 429
78 3300006871 Ga0075434_100041481 Ga0075434_1000414813 429
79 3300006914 Ga0075436_100008048 Ga0075436_1000080482 429
80 3300013104 Ga0157370_10008261 Ga0157370_100082612 429
81 3300025949 Ga0207667_10097788 Ga0207667_100977882 429
82 3300038726 Ga0400490_17851 Ga0400490_17851_4227_5591 429
83 3300050512 nmdc:mga0n895_126170_c1 nmdc:mga0n895_126170_c1_494_1864 429
84 3300050514 nmdc:mga08x19_5866_c1 nmdc:mga08x19_5866_c1_439_1809 429
85 3300046471 Ga0495650_0000224 Ga0495650_0000224_17232_18578 430
86 3300050493 nmdc:mga0k408_24582_c1 nmdc:mga0k408_24582_c1_430_1815 431
87 3300038735 Ga0400485_07894 Ga0400485_07894_1636_3000 433
88 3300038742 Ga0400486_14851 Ga0400486_14851_8328_9692 433
89 3300039110 Ga0400487_01458 Ga0400487_01458_47_1411 433
90 3300044656 Ga0466969_0029521 Ga0466969_0029521_329_1702 434
91 3300044684 Ga0466966_0000084 Ga0466966_0000084_36576_37949 434
92 3300044693 Ga0466961_0009347 Ga0466961_0009347_143_1516 434
93 3300044693 Ga0466961_0031147 Ga0466961_0031147_1997_3400 434
94 3300044694 Ga0466963_0018644 Ga0466963_0018644_2217_3590 434
95 3300045836 Ga0466958_0000254 Ga0466958_0000254_2275_3648 434
96 3300061719 Ga0466962_0022586 Ga0466962_0022586_244_1647 434
97 3300005563 Ga0068855_100019484 Ga0068855_1000194842 435
98 3300013307 Ga0157372_10128119 Ga0157372_101281192 435
99 3300025913 Ga0207695_10232992 Ga0207695_102329922 435
100 3300031548 Ga0307408_100131321 Ga0307408_1001313212 435
101 3300049575 Ga0501039_0068019 Ga0501039_0068019_258_1610 435
102 3300049583 Ga0501067_0043438 Ga0501067_0043438_828_2195 435
103 3300049586 Ga0501070_0000612 Ga0501070_0000612_27810_29177 435
104 3300049586 Ga0501070_0175917 Ga0501070_0175917_317_1684 435
105 3300049589 Ga0501073_0001654 Ga0501073_0001654_3556_4923 435
106 3300049590 Ga0501074_0000811 Ga0501074_0000811_14805_16172 435
107 3300049741 Ga0501079_0030446 Ga0501079_0030446_2235_3602 435
108 3300049742 Ga0501080_0008750 Ga0501080_0008750_3481_4848 435
109 3300049742 Ga0501080_0024443 Ga0501080_0024443_774_2141 435
110 3300049744 Ga0501083_0002111 Ga0501083_0002111_3880_5247 435
111 3300054114 Ga0501084_0023535 Ga0501084_0023535_2458_3825 435
112 3300060353 Ga0501082_0017124 Ga0501082_0017124_1345_2712 435
113 3300005327 Ga0070658_10002393 Ga0070658_1000239312 436
114 3300005547 Ga0070693_100011277 Ga0070693_1000112772 436
115 3300009098 Ga0105245_10086042 Ga0105245_100860422 436
116 3300013297 Ga0157378_10097337 Ga0157378_100973372 436
117 3300025909 Ga0207705_10010151 Ga0207705_100101511 436
118 3300039062 Ga0400483_145565 Ga0400483_145565_8344_9708 436
119 3300039062 Ga0400483_268051 Ga0400483_268051_10067_11431 436
120 3300005617 Ga0068859_100253645 Ga0068859_1002536452 437
121 3300005842 Ga0068858_100082743 Ga0068858_1000827432 437
122 3300006237 Ga0097621_100014887 Ga0097621_1000148872 437
123 3300006358 Ga0068871_100160874 Ga0068871_1001608742 437
124 3300006931 Ga0097620_100253647 Ga0097620_1002536472 437
125 3300009098 Ga0105245_10164908 Ga0105245_101649082 437
126 3300009148 Ga0105243_10116079 Ga0105243_101160792 437
127 3300009176 Ga0105242_10049912 Ga0105242_100499123 437
128 3300009177 Ga0105248_10058954 Ga0105248_100589542 437
129 3300013308 Ga0157375_10023805 Ga0157375_100238056 437
130 3300025927 Ga0207687_10010562 Ga0207687_100105622 437
131 3300036401 Ga0373937_0011712 Ga0373937_0011712_4092_5459 437
132 3300038742 Ga0400486_00233 Ga0400486_00233_5287_6651 437
133 3300046454 Ga0495592_0017875 Ga0495592_0017875_3309_4676 437
134 3300046462 Ga0495651_0034283 Ga0495651_0034283_953_2320 437
135 3300046463 Ga0495653_0094116 Ga0495653_0094116_481_1848 437
136 3300046529 Ga0495652_0080614 Ga0495652_0080614_783_2150 437
137 3300046536 Ga0495587_0006632 Ga0495587_0006632_748_2115 437
138 3300046543 Ga0495645_0020676 Ga0495645_0020676_448_1815 437
139 3300046559 Ga0495667_0008494 Ga0495667_0008494_1055_2422 437
140 3300046678 Ga0495599_0044046 Ga0495599_0044046_1078_2445 437
141 3300045051 Ga0451576_0011555 Ga0451576_0011555_4545_5894 438
142 3300009148 Ga0105243_10026412 Ga0105243_100264123 439
143 3300010375 Ga0105239_10069989 Ga0105239_100699892 439
144 3300013308 Ga0157375_10069517 Ga0157375_100695172 439
145 3300045051 Ga0451576_0001615 Ga0451576_0001615_19666_21036 439
146 iso_pu_bacteria 2891633521 2891634585 439
147 3300042876 Ga0451577_0000319 Ga0451577_0000319_21322_22674 440
148 3300042876 Ga0451577_0023500 Ga0451577_0023500_784_2136 440
149 3300044673 Ga0453683_0021694 Ga0453683_0021694_1515_2867 440
150 3300044712 Ga0453684_0018401 Ga0453684_0018401_3098_4450 440
151 3300045051 Ga0451576_0005294 Ga0451576_0005294_5157_6509 440
152 3300045051 Ga0451576_0012005 Ga0451576_0012005_4202_5554 440
153 3300045051 Ga0451576_0012462 Ga0451576_0012462_3963_5315 440
154 iso_pu_bacteria 2574179768 2574432049 440
155 iso_pu_bacteria 639633007 639787050 440
156 3300002067 JGI24735J21928_10001265 JGI24735J21928_100012652 441
157 3300005327 Ga0070658_10011021 Ga0070658_100110216 441
158 3300005339 Ga0070660_100001298 Ga0070660_10000129811 441
159 3300005539 Ga0068853_100203455 Ga0068853_1002034552 441
160 3300005563 Ga0068855_100010957 Ga0068855_10001095710 441
161 3300009093 Ga0105240_10001770 Ga0105240_1000177018 441
162 3300009545 Ga0105237_10005766 Ga0105237_1000576610 441
163 3300010375 Ga0105239_10003884 Ga0105239_1000388417 441
164 3300013100 Ga0157373_10006985 Ga0157373_100069854 441
165 3300013105 Ga0157369_10000979 Ga0157369_1000097921 441
166 3300013296 Ga0157374_10000107 Ga0157374_1000010724 441
167 3300013307 Ga0157372_10002854 Ga0157372_100028542 441
168 3300025256 Ga0209759_1011780 Ga0209759_10117802 441
169 3300025904 Ga0207647_10000108 Ga0207647_1000010811 441
170 3300025914 Ga0207671_10008853 Ga0207671_100088533 441
171 3300025919 Ga0207657_10064846 Ga0207657_100648462 441
172 3300025949 Ga0207667_10003025 Ga0207667_1000302510 441
173 3300026067 Ga0207678_10001691 Ga0207678_100016915 441
174 3300028666 Ga0265336_10002632 Ga0265336_100026327 441
175 3300029957 Ga0265324_10000005 Ga0265324_10000005187 441
176 3300029957 Ga0265324_10000205 Ga0265324_1000020520 441
177 3300029957 Ga0265324_10014450 Ga0265324_100144502 441
178 3300031241 Ga0265325_10000314 Ga0265325_100003149 441
179 3300031250 Ga0265331_10013109 Ga0265331_100131094 441
180 3300031250 Ga0265331_10017844 Ga0265331_100178442 441
181 3300031251 Ga0265327_10001032 Ga0265327_1000103211 441
182 3300031344 Ga0265316_10108626 Ga0265316_101086262 441
183 3300031711 Ga0265314_10000740 Ga0265314_1000074029 441
184 3300032133 Ga0316583_10013376 Ga0316583_100133762 441
185 3300035172 Ga0373955_0042294 Ga0373955_0042294_165_1532 441
186 3300036401 Ga0373937_0090607 Ga0373937_0090607_809_2176 441
187 3300042005 Ga0439448_0004190 Ga0439448_0004190_949_2325 441
188 3300042876 Ga0451577_0000002 Ga0451577_0000002_311073_312428 441
189 3300042876 Ga0451577_0117675 Ga0451577_0117675_723_2111 441
190 3300044673 Ga0453683_0000003 Ga0453683_0000003_311073_312428 441
191 3300044712 Ga0453684_0000002 Ga0453684_0000002_1418948_1420303 441
192 3300044712 Ga0453684_0000075 Ga0453684_0000075_206606_207961 441
193 3300044712 Ga0453684_0053791 Ga0453684_0053791_2999_4387 441
194 3300045051 Ga0451576_0000004 Ga0451576_0000004_1045588_1046943 441
195 3300045051 Ga0451576_0000029 Ga0451576_0000029_287246_288601 441
196 3300046507 Ga0495606_0145331 Ga0495606_0145331_53_1381 441
197 3300046535 Ga0495586_0056560 Ga0495586_0056560_591_1958 441
198 3300047471 Ga0495684_0081603 Ga0495684_0081603_248_1615 441
199 3300049579 Ga0501043_0000141 Ga0501043_0000141_9701_11068 441
200 3300049580 Ga0501046_0000047 Ga0501046_0000047_49704_51071 441
201 3300049581 Ga0501047_0000058 Ga0501047_0000058_89676_91043 441
202 3300049582 Ga0501048_0000475 Ga0501048_0000475_21518_22885 441
203 3300049776 Ga0501280_000375 Ga0501280_000375_8795_10153 441
204 3300049824 Ga0501045_0015906 Ga0501045_0015906_191_1558 441
205 3300050493 nmdc:mga0k408_380_c2 nmdc:mga0k408_380_c2_10165_11532 441
206 iso_pu_bacteria 2526164512 2526213521 441
207 3300005334 Ga0068869_100025411 Ga0068869_1000254113 442
208 3300006195 Ga0075366_10003539 Ga0075366_100035392 442
209 3300013297 Ga0157378_10063541 Ga0157378_100635412 442
210 3300014969 Ga0157376_10151166 Ga0157376_101511662 442
211 3300026035 Ga0207703_10030879 Ga0207703_100308792 442
212 3300031548 Ga0307408_100167561 Ga0307408_1001675612 442
213 3300046530 Ga0495654_0000428 Ga0495654_0000428_17052_18434 442
214 3300046539 Ga0495621_0003224 Ga0495621_0003224_2535_3893 442
215 3300046539 Ga0495621_0010869 Ga0495621_0010869_763_2127 442
216 3300046543 Ga0495645_0089437 Ga0495645_0089437_44_1414 442
217 iso_pu_bacteria 2734482258 2735818237 442
218 3300006186 Ga0075369_10002482 Ga0075369_100024823 443
219 3300006358 Ga0068871_100048150 Ga0068871_1000481502 443
220 3300025228 Ga0209672_100433 Ga0209672_10043310 443
221 3300032168 Ga0316593_10000190 Ga0316593_100001908 443
222 3300038725 Ga0400484_29948 Ga0400484_29948_294_1658 443
223 3300038725 Ga0400484_43627 Ga0400484_43627_4439_5803 443
224 3300038741 Ga0400488_33004 Ga0400488_33004_4817_6181 443
225 3300038741 Ga0400488_38891 Ga0400488_38891_13229_14593 443
226 3300039062 Ga0400483_108358 Ga0400483_108358_5385_6749 443
227 3300039062 Ga0400483_121666 Ga0400483_121666_12693_14057 443
228 3300039062 Ga0400483_192031 Ga0400483_192031_1244_2608 443
229 3300039062 Ga0400483_241642 Ga0400483_241642_9505_10869 443
230 3300039110 Ga0400487_24806 Ga0400487_24806_23884_25248 443
231 3300045051 Ga0451576_0000250 Ga0451576_0000250_73986_75347 443
232 3300005289 Ga0065704_10127221 Ga0065704_101272212 444
233 3300005327 Ga0070658_10059779 Ga0070658_100597792 444
234 3300005329 Ga0070683_100070791 Ga0070683_1000707913 444
235 3300005331 Ga0070670_100006956 Ga0070670_1000069564 444
236 3300005333 Ga0070677_10015794 Ga0070677_100157942 444
237 3300005334 Ga0068869_100003904 Ga0068869_1000039047 444
238 3300005335 Ga0070666_10052439 Ga0070666_100524391 444
239 3300005338 Ga0068868_100035264 Ga0068868_1000352642 444
240 3300005344 Ga0070661_100029621 Ga0070661_1000296212 444
241 3300005354 Ga0070675_100021815 Ga0070675_1000218152 444
242 3300005354 Ga0070675_100044998 Ga0070675_1000449983 444
243 3300005355 Ga0070671_100027234 Ga0070671_1000272342 444
244 3300005364 Ga0070673_100005910 Ga0070673_1000059102 444
245 3300005364 Ga0070673_100025823 Ga0070673_1000258232 444
246 3300005367 Ga0070667_100148267 Ga0070667_1001482672 444
247 3300005456 Ga0070678_100008537 Ga0070678_1000085374 444
248 3300005459 Ga0068867_100151413 Ga0068867_1001514132 444
249 3300005543 Ga0070672_100010363 Ga0070672_1000103635 444
250 3300005547 Ga0070693_100047823 Ga0070693_1000478231 444
251 3300005548 Ga0070665_100054800 Ga0070665_1000548002 444
252 3300005548 Ga0070665_100099519 Ga0070665_1000995192 444
253 3300005564 Ga0070664_100049898 Ga0070664_1000498982 444
254 3300005578 Ga0068854_100078468 Ga0068854_1000784682 444
255 3300005616 Ga0068852_100005797 Ga0068852_1000057973 444
256 3300005718 Ga0068866_10059311 Ga0068866_100593112 444
257 3300005834 Ga0068851_10020503 Ga0068851_100205032 444
258 3300005840 Ga0068870_10052284 Ga0068870_100522842 444
259 3300005840 Ga0068870_10061437 Ga0068870_100614372 444
260 3300005841 Ga0068863_100030839 Ga0068863_1000308393 444
261 3300005841 Ga0068863_100073057 Ga0068863_1000730572 444
262 3300005842 Ga0068858_100032267 Ga0068858_1000322672 444
263 3300005844 Ga0068862_100039651 Ga0068862_1000396512 444
264 3300006237 Ga0097621_100003683 Ga0097621_1000036838 444
265 3300006358 Ga0068871_100016562 Ga0068871_1000165622 444
266 3300006358 Ga0068871_100019776 Ga0068871_1000197762 444
267 3300006844 Ga0075428_100000245 Ga0075428_10000024521 444
268 3300006846 Ga0075430_100020343 Ga0075430_1000203436 444
269 3300006846 Ga0075430_100056022 Ga0075430_1000560222 444
270 3300006847 Ga0075431_100003069 Ga0075431_10000306910 444
271 3300006847 Ga0075431_100034097 Ga0075431_1000340972 444
272 3300006880 Ga0075429_100008747 Ga0075429_1000087474 444
273 3300007265 Ga0099794_10053454 Ga0099794_100534541 444
274 3300009094 Ga0111539_10000383 Ga0111539_100003839 444
275 3300009094 Ga0111539_10080582 Ga0111539_100805822 444
276 3300009148 Ga0105243_10000770 Ga0105243_100007706 444
277 3300009177 Ga0105248_10002407 Ga0105248_1000240714 444
278 3300009177 Ga0105248_10137513 Ga0105248_101375132 444
279 3300009553 Ga0105249_10144621 Ga0105249_101446212 444
280 3300013296 Ga0157374_10127586 Ga0157374_101275862 444
281 3300013297 Ga0157378_10169632 Ga0157378_101696322 444
282 3300013308 Ga0157375_10173663 Ga0157375_101736632 444
283 3300014326 Ga0157380_10210633 Ga0157380_102106331 444
284 3300014969 Ga0157376_10011903 Ga0157376_100119032 444
285 3300014969 Ga0157376_10040685 Ga0157376_100406852 444
286 3300025893 Ga0207682_10020088 Ga0207682_100200882 444
287 3300025908 Ga0207643_10018307 Ga0207643_100183072 444
288 3300025908 Ga0207643_10084818 Ga0207643_100848182 444
289 3300025918 Ga0207662_10036199 Ga0207662_100361992 444
290 3300025920 Ga0207649_10022174 Ga0207649_100221742 444
291 3300025925 Ga0207650_10023575 Ga0207650_100235753 444
292 3300025931 Ga0207644_10017931 Ga0207644_100179314 444
293 3300025935 Ga0207709_10005524 Ga0207709_100055242 444
294 3300025940 Ga0207691_10007106 Ga0207691_100071068 444
295 3300025942 Ga0207689_10000974 Ga0207689_1000097422 444
296 3300025960 Ga0207651_10019003 Ga0207651_100190032 444
297 3300025960 Ga0207651_10040384 Ga0207651_100403842 444
298 3300025981 Ga0207640_10064246 Ga0207640_100642462 444
299 3300026035 Ga0207703_10057411 Ga0207703_100574112 444
300 3300026088 Ga0207641_10068358 Ga0207641_100683582 444
301 3300026089 Ga0207648_10000142 Ga0207648_1000014227 444
302 3300026095 Ga0207676_10104768 Ga0207676_101047682 444
303 3300026121 Ga0207683_10003576 Ga0207683_100035769 444
304 3300026121 Ga0207683_10187256 Ga0207683_101872562 444
305 3300026142 Ga0207698_10049953 Ga0207698_100499532 444
306 3300027378 Ga0209981_1002317 Ga0209981_10023172 444
307 3300027876 Ga0209974_10006559 Ga0209974_100065593 444
308 3300027907 Ga0207428_10005311 Ga0207428_1000531111 444
309 3300028379 Ga0268266_10020285 Ga0268266_100202855 444
310 3300028379 Ga0268266_10185285 Ga0268266_101852852 444
311 3300037471 Ga0395905_0028009 Ga0395905_0028009_2814_4199 444
312 3300039062 Ga0400483_179405 Ga0400483_179405_473_1843 444
313 3300042876 Ga0451577_0045119 Ga0451577_0045119_2206_3570 444
314 3300044712 Ga0453684_0012407 Ga0453684_0012407_4069_5433 444
315 3300045051 Ga0451576_0038365 Ga0451576_0038365_3070_4446 444
316 3300046675 Ga0495657_0060592 Ga0495657_0060592_746_2110 444
317 3300048907 Ga0496104_0187250 Ga0496104_0187250_272_1636 444
318 3300048909 Ga0496106_0059256 Ga0496106_0059256_342_1706 444
319 3300048910 Ga0496107_0116147 Ga0496107_0116147_331_1695 444
320 3300048912 Ga0496109_0214428 Ga0496109_0214428_185_1549 444
321 3300048913 Ga0496110_0032191 Ga0496110_0032191_1965_3329 444
322 3300048914 Ga0496111_0082732 Ga0496111_0082732_431_1795 444
323 3300048917 Ga0496114_0290531 Ga0496114_0290531_29_1393 444
324 3300049575 Ga0501039_0030275 Ga0501039_0030275_1717_3081 444
325 3300049575 Ga0501039_0158298 Ga0501039_0158298_115_1464 444
326 3300049578 Ga0501042_0198529 Ga0501042_0198529_70_1434 444
327 3300049587 Ga0501071_0056146 Ga0501071_0056146_1235_2599 444
328 3300049592 Ga0501076_0026193 Ga0501076_0026193_1162_2526 444
329 3300049742 Ga0501080_0032837 Ga0501080_0032837_2967_4331 444
330 3300050508 nmdc:mga09592_1274_c1 nmdc:mga09592_1274_c1_8680_10050 444
331 3300050509 nmdc:mga0qj67_81220_c1 nmdc:mga0qj67_81220_c1_647_2011 444
332 3300050510 nmdc:mga06r32_18433_c1 nmdc:mga06r32_18433_c1_2840_4204 444
333 3300050510 nmdc:mga06r32_28961_c1 nmdc:mga06r32_28961_c1_1503_2867 444
334 3300050511 nmdc:mga08y16_65551_c1 nmdc:mga08y16_65551_c1_1993_3357 444
335 3300053177 Ga0500636_0000185 Ga0500636_0000185_564_1928 444
336 3300053729 Ga0500625_002765 Ga0500625_002765_906_2270 444
337 3300054114 Ga0501084_0229158 Ga0501084_0229158_61_1425 444
338 iso_pu_bacteria 2721755763 2723877468 444
339 3300005458 Ga0070681_10016840 Ga0070681_100168402 445
340 3300025912 Ga0207707_10145180 Ga0207707_101451802 445
341 3300037418 Ga0395900_0027856 Ga0395900_0027856_3025_4398 445
342 3300038443 Ga0395901_0000923 Ga0395901_0000923_20117_21490 445
343 3300046557 Ga0495622_0001676 Ga0495622_0001676_806_2200 445
344 3300049586 Ga0501070_0003856 Ga0501070_0003856_7270_8643 445
345 3300049590 Ga0501074_0001507 Ga0501074_0001507_11168_12541 445
346 3300049742 Ga0501080_0114349 Ga0501080_0114349_353_1726 445
347 iso_pu_bacteria 2501025501 2501070247 451
348 iso_pu_bacteria 2515154123 2515689942 451
349 iso_pu_bacteria 2883087390 2883092935 451
350 iso_pu_bacteria 8020938398 8020945032 451
351 iso_pu_bacteria 8020953355 8020956931 451
352 iso_pu_bacteria 2519103095 2519459056 452
353 iso_pu_bacteria 2582581311 2585291426 452
354 iso_pu_bacteria 2599185239 2599736660 452
355 iso_pu_bacteria 2599185240 2599744714 452
356 iso_pu_bacteria 2599185355 2600205925 452
357 iso_pu_bacteria 2675903129 2676742841 452
358 iso_pu_bacteria 2791355137 2792835945 452
359 iso_pu_bacteria 2816332253 2817261346 452
360 iso_pu_bacteria 2816332256 2817279023 452
361 iso_pu_bacteria 2816332286 2817451253 452
362 iso_pu_bacteria 2818991452 2819631144 452
363 iso_pu_bacteria 2856287931 2856290452 452
364 iso_pu_bacteria 2857357740 2857363329 452
365 iso_pu_bacteria 2863421361 2863424754 452
366 iso_pu_bacteria 2870068957 2870070990 452
367 iso_pu_bacteria 2904564687 2904570983 452
368 iso_pu_bacteria 2904571731 2904575967 452
369 iso_pu_bacteria 2928157003 2928160055 452
370 iso_pu_bacteria 2928163908 2928168494 452
371 iso_pu_bacteria 2928170801 2928171738 452
372 iso_pu_bacteria 2928536128 2928539894 452
373 iso_pu_bacteria 2981990288 2981994791 452
374 iso_pu_bacteria 641736154 642416875 452
375 iso_pu_bacteria 8018845410 8018851378 452
376 iso_pu_bacteria 8020807995 8020810190 452
377 iso_pu_bacteria 8020945358 8020951710 452
378 iso_pu_bacteria 8021120328 8021122215 452
379 iso_pu_bacteria 8039098773 8039102540 452
380 iso_pu_bacteria 8040167225 8040168805 452
381 iso_pu_bacteria 8040173305 8040174731 452
382 iso_pu_bacteria 2808606384 2808972397 453
383 iso_pu_bacteria 2808606390 2809007226 453
384 iso_pu_bacteria 2808606391 2809014364 453
385 3300013102 Ga0157371_10007279 Ga0157371_100072797 454
386 3300013104 Ga0157370_10007952 Ga0157370_100079521 454
387 3300013105 Ga0157369_10000511 Ga0157369_1000051117 454
388 3300013105 Ga0157369_10002197 Ga0157369_100021973 454
389 3300025909 Ga0207705_10001472 Ga0207705_1000147218 454
390 3300025949 Ga0207667_10002397 Ga0207667_1000239713 454
391 3300028800 Ga0265338_10000741 Ga0265338_1000074122 454
392 3300037312 Ga0395899_0000007 Ga0395899_0000007_357872_359356 454
393 3300037418 Ga0395900_0000026 Ga0395900_0000026_42213_43697 454
394 3300037418 Ga0395900_0044477 Ga0395900_0044477_613_1986 454
395 3300037466 Ga0395898_0000497 Ga0395898_0000497_47680_49164 454
396 3300037466 Ga0395898_0001748 Ga0395898_0001748_17289_18662 454
397 3300038443 Ga0395901_0000296 Ga0395901_0000296_56206_57579 454
398 3300038443 Ga0395901_0019691 Ga0395901_0019691_1989_3362 454
399 3300044656 Ga0466969_0000297 Ga0466969_0000297_15413_16894 454
400 3300044666 Ga0466977_0001674 Ga0466977_0001674_720_2120 454
401 3300044683 Ga0466965_0001551 Ga0466965_0001551_740_2113 454
402 3300044684 Ga0466966_0024377 Ga0466966_0024377_738_2111 454
403 3300044693 Ga0466961_0000567 Ga0466961_0000567_20370_21743 454
404 3300044694 Ga0466963_0001538 Ga0466963_0001538_7392_8765 454
405 3300044719 Ga0466971_0001519 Ga0466971_0001519_5184_6557 454
406 3300044842 Ga0466957_0005149 Ga0466957_0005149_5567_6940 454
407 3300044842 Ga0466957_0032769 Ga0466957_0032769_1456_2829 454
408 3300045049 Ga0466959_0003739 Ga0466959_0003739_7381_8862 454
409 3300045049 Ga0466959_0021302 Ga0466959_0021302_1152_2525 454
410 3300045836 Ga0466958_0000731 Ga0466958_0000731_2036_3517 454
411 3300061719 Ga0466962_0000537 Ga0466962_0000537_1831_3204 454
412 3300061719 Ga0466962_0000675 Ga0466962_0000675_2505_3878 454
413 3300039437 Ga0436365_1054781 Ga0436365_1054781_271_1641 455
414 3300044656 Ga0466969_0014342 Ga0466969_0014342_596_1972 455
415 3300044684 Ga0466966_0009017 Ga0466966_0009017_2194_3570 455
416 3300044693 Ga0466961_0076667 Ga0466961_0076667_622_1992 455
417 3300044735 Ga0466968_0059491 Ga0466968_0059491_136_1506 455
418 3300044765 Ga0466970_0019669 Ga0466970_0019669_1390_2766 455
419 3300044765 Ga0466970_0064372 Ga0466970_0064372_445_1815 455
420 3300045049 Ga0466959_0000802 Ga0466959_0000802_1978_3354 455
421 iso_pu_bacteria 2600255067 2600809460 455
422 3300003758 Ga0055532_1003986 Ga0055532_10039862 456
423 3300003760 Ga0055527_1001753 Ga0055527_10017531 456
424 3300003760 Ga0055527_1001754 Ga0055527_10017541 456
425 3300003761 Ga0055535_1003659 Ga0055535_10036591 456
426 3300003761 Ga0055535_1003660 Ga0055535_10036601 456
427 3300003762 Ga0055542_1003532 Ga0055542_10035321 456
428 3300003762 Ga0055542_1003533 Ga0055542_10035331 456
429 3300003763 Ga0055529_1001476 Ga0055529_10014767 456
430 3300003841 Ga0055541_1007513 Ga0055541_10075132 456
431 3300005339 Ga0070660_100000504 Ga0070660_10000050413 456
432 3300005366 Ga0070659_100000096 Ga0070659_10000009656 456
433 3300005455 Ga0070663_100002692 Ga0070663_1000026923 456
434 3300005563 Ga0068855_100148799 Ga0068855_1001487992 456
435 3300009551 Ga0105238_10001068 Ga0105238_100010686 456
436 3300010375 Ga0105239_10002463 Ga0105239_1000246317 456
437 3300013100 Ga0157373_10083475 Ga0157373_100834751 456
438 3300013104 Ga0157370_10157383 Ga0157370_101573832 456
439 3300013306 Ga0163162_10006481 Ga0163162_1000648110 456
440 3300013307 Ga0157372_10415704 Ga0157372_104157041 456
441 3300013308 Ga0157375_10028549 Ga0157375_100285495 456
442 3300015261 Ga0182006_1033937 Ga0182006_10339372 456
443 3300015262 Ga0182007_10031403 Ga0182007_100314032 456
444 3300015265 Ga0182005_1020509 Ga0182005_10205092 456
445 3300025225 Ga0209566_100559 Ga0209566_10055911 456
446 3300025228 Ga0209672_100014 Ga0209672_100014186 456
447 3300025228 Ga0209672_100023 Ga0209672_100023221 456
448 3300025229 Ga0209147_100094 Ga0209147_100094121 456
449 3300025229 Ga0209147_100104 Ga0209147_10010495 456
450 3300025229 Ga0209147_101808 Ga0209147_1018082 456
451 3300025242 Ga0209258_100040 Ga0209258_100040319 456
452 3300025242 Ga0209258_100142 Ga0209258_100142110 456
453 3300025254 Ga0209148_1000035 Ga0209148_1000035319 456
454 3300025272 Ga0209455_1000072 Ga0209455_1000072133 456
455 3300025295 Ga0209564_1004868 Ga0209564_10048686 456
456 3300025904 Ga0207647_10000498 Ga0207647_1000049821 456
457 3300025913 Ga0207695_10026800 Ga0207695_100268002 456
458 3300025919 Ga0207657_10000004 Ga0207657_1000000472 456
459 3300025932 Ga0207690_10000015 Ga0207690_10000015221 456
460 3300025949 Ga0207667_10005390 Ga0207667_100053902 456
461 3300025986 Ga0207658_10066305 Ga0207658_100663052 456
462 3300026067 Ga0207678_10002079 Ga0207678_1000207911 456
463 3300027312 Ga0209371_1000079 Ga0209371_100007968 456
464 3300028800 Ga0265338_10000028 Ga0265338_10000028110 456
465 3300030500 Ga0268256_1000090 Ga0268256_100009071 456
466 3300044684 Ga0466966_0069537 Ga0466966_0069537_247_1617 456
467 3300044842 Ga0466957_0071889 Ga0466957_0071889_616_1989 456
468 3300046455 Ga0495603_0004961 Ga0495603_0004961_5430_6803 456
469 3300046460 Ga0495638_0002053 Ga0495638_0002053_6272_7645 456
470 3300046471 Ga0495650_0003457 Ga0495650_0003457_4512_5885 456
471 3300046471 Ga0495650_0034042 Ga0495650_0034042_86_1459 456
472 3300046474 Ga0495605_0039456 Ga0495605_0039456_416_1789 456
473 3300046477 Ga0495664_0099369 Ga0495664_0099369_171_1544 456
474 3300046491 Ga0495584_0053090 Ga0495584_0053090_478_1851 456
475 3300046501 Ga0495607_0031805 Ga0495607_0031805_26_1399 456
476 3300046507 Ga0495606_0015445 Ga0495606_0015445_314_1687 456
477 3300046535 Ga0495586_0111805 Ga0495586_0111805_54_1427 456
478 3300046543 Ga0495645_0004194 Ga0495645_0004194_2595_3968 456
479 3300046543 Ga0495645_0013820 Ga0495645_0013820_1060_2433 456
480 3300046684 Ga0495669_0006587 Ga0495669_0006587_746_2119 456
481 3300046691 Ga0495670_0003239 Ga0495670_0003239_187_1560 456
482 3300046692 Ga0495671_0020374 Ga0495671_0020374_250_1623 456
483 3300046694 Ga0495649_0035118 Ga0495649_0035118_490_1863 456
484 3300046794 Ga0495589_0006457 Ga0495589_0006457_24_1397 456
485 3300046809 Ga0495600_0080517 Ga0495600_0080517_586_1959 456
486 3300047315 Ga0495581_0036259 Ga0495581_0036259_977_2350 456
487 3300047443 Ga0495687_001154 Ga0495687_001154_5433_6815 456
488 3300047472 Ga0495686_0000002 Ga0495686_0000002_784463_785848 456
489 3300047673 Ga0495593_0030003 Ga0495593_0030003_1510_2883 456
490 3300048089 Ga0495614_0037940 Ga0495614_0037940_248_1621 456
491 3300048903 Ga0496100_0058050 Ga0496100_0058050_476_1849 456
492 3300048904 Ga0496101_0201261 Ga0496101_0201261_62_1435 456
493 3300048908 Ga0496105_0138088 Ga0496105_0138088_481_1854 456
494 3300048909 Ga0496106_0027324 Ga0496106_0027324_2371_3744 456
495 3300048914 Ga0496111_0082443 Ga0496111_0082443_88_1461 456
496 3300048917 Ga0496114_0009017 Ga0496114_0009017_2463_3836 456
497 3300048918 Ga0496115_0034553 Ga0496115_0034553_757_2130 456
498 3300048920 Ga0496117_0005730 Ga0496117_0005730_11095_12483 456
499 3300048921 Ga0496118_0001989 Ga0496118_0001989_11796_13241 456
500 3300048924 Ga0496121_0099771 Ga0496121_0099771_698_2086 456
501 3300048929 Ga0496126_0002042 Ga0496126_0002042_15927_17372 456
502 3300048986 Ga0466983_0196272 Ga0466983_0196272_129_1499 456
503 3300061719 Ga0466962_0032196 Ga0466962_0032196_322_1692 456
504 iso_pu_bacteria 2904434214 2904438564 456
505 3300013105 Ga0157369_10091577 Ga0157369_100915773 457
506 3300046462 Ga0495651_0091675 Ga0495651_0091675_770_2245 457
507 3300046471 Ga0495650_0037541 Ga0495650_0037541_316_1701 457
508 3300053125 Ga0500618_000976 Ga0500618_000976_5257_6648 457
509 3300002067 JGI24735J21928_10000873 JGI24735J21928_100008736 460
510 3300009011 Ga0105251_10001119 Ga0105251_1000111912 460
511 3300013296 Ga0157374_10031938 Ga0157374_100319383 460
512 3300025735 Ga0207713_1002241 Ga0207713_100224110 460
513 3300025904 Ga0207647_10036364 Ga0207647_100363642 460
514 3300045976 Ga0466967_0186318 Ga0466967_0186318_359_1741 460
515 3300046477 Ga0495664_0060004 Ga0495664_0060004_456_1838 460
516 3300046542 Ga0495597_0004490 Ga0495597_0004490_5931_7313 460
517 3300046543 Ga0495645_0081925 Ga0495645_0081925_456_1838 460
518 3300046663 Ga0495635_0118106 Ga0495635_0118106_170_1552 460
519 3300046684 Ga0495669_0032792 Ga0495669_0032792_128_1510 460
520 3300046690 Ga0495624_0040024 Ga0495624_0040024_698_2080 460
521 3300047322 Ga0495680_0033291 Ga0495680_0033291_87_1469 460
522 3300047322 Ga0495680_0095292 Ga0495680_0095292_68_1450 460
523 3300047323 Ga0495683_0005181 Ga0495683_0005181_4014_5396 460
524 3300047444 Ga0495675_0090023 Ga0495675_0090023_486_1868 460
525 3300047673 Ga0495593_0046238 Ga0495593_0046238_854_2236 460
526 3300048903 Ga0496100_0003455 Ga0496100_0003455_155_1537 460
527 3300048904 Ga0496101_0003813 Ga0496101_0003813_155_1537 460
528 3300048905 Ga0496102_0003091 Ga0496102_0003091_4411_5793 460
529 3300048906 Ga0496103_0001420 Ga0496103_0001420_4270_5652 460
530 3300048909 Ga0496106_0001077 Ga0496106_0001077_9129_10511 460
531 3300048912 Ga0496109_0126523 Ga0496109_0126523_526_1908 460
532 3300048913 Ga0496110_0000457 Ga0496110_0000457_4808_6190 460
533 3300048914 Ga0496111_0009434 Ga0496111_0009434_2048_3430 460
534 3300048915 Ga0496112_0010133 Ga0496112_0010133_3310_4692 460
535 3300048916 Ga0496113_0001720 Ga0496113_0001720_485_1867 460
536 3300048919 Ga0496116_0039696 Ga0496116_0039696_582_1964 460
537 3300048920 Ga0496117_0012388 Ga0496117_0012388_2227_3609 460
538 3300048921 Ga0496118_0005512 Ga0496118_0005512_9346_10728 460
539 3300048924 Ga0496121_0003420 Ga0496121_0003420_10569_11951 460
540 3300048925 Ga0496122_0004586 Ga0496122_0004586_241_1623 460
541 3300048926 Ga0496123_0015693 Ga0496123_0015693_334_1716 460
542 3300048927 Ga0496124_0001916 Ga0496124_0001916_9328_10710 460

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

6

492

0.98

PF17820

PDZ_6

PDZ domain

281

334

0.98

PF13180

PDZ_2

PDZ domain

266

344

0.91

PF00595

PDZ

PDZ domain

263

333

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xft-assembly1.cif.gz_A-2 mucp pdz2 domain 0.9501 234 316
5tnz-assembly1.cif.gz_A htra2 s142d mutant 0.9495 234 299
2zpm-assembly1.cif.gz_A crystal structure analysis of pdz domain b 0.9488 234 316
3id2-assembly1.cif.gz_B crystal structure of rsep pdz2 domain 0.9458 234 316
5fht-assembly1.cif.gz_A htra2 protease mutant v226k 0.9458 234 301
ID Description Score Start End Superfamily
af_A0A1D8PCD2_285_377_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9598 232 297 2.30.42.10
af_A0A0P0VNU6_285_398_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9583 234 296 2.30.42.10
af_A0A0R0HTR5_280_372_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9547 231 297 2.30.42.10
af_Q4E3N9_28_113_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9544 234 272 2.30.42.10
af_Q9P7S1_280_374_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9502 234 297 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A0B2C669-F1-model_v4 deleted 0.9668 327 457
AF-F0GIN3-F1-model_v4 Membrane-associated zinc metalloprotease 0.9568 1 132 GO:0004222
GO:0006508
GO:0016020
AF-A0A3C1TND1-F1-model_v4 RIP metalloprotease RseP 0.9553 326 458 GO:0004222
GO:0006508
GO:0016020
AF-A0A836P347-F1-model_v4 Zinc metalloprotease 0.955 334 457 GO:0004222
GO:0006508
GO:0016020
AF-F0GIN3-F1-model_v4 Membrane-associated zinc metalloprotease 0.9496 1 132 GO:0004222
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
83.12 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map