F461565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 338 | 496 | 452 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2904434214|2904438564 |
| Length | 507 |
| Sequence | VTSVIGFFVAIDILVVFHELGHYSVARWCGVKVLRFSIGFGKPLLQRQGRDGTLWTIGWLPLGGYVRMLDERDPTQVRSDAVEDADGTVRVTAVSGSGTAAADTADAVTYRIAPADLPHAFNRQSVGKRFAIVAAGPIANFLLAILLFAGLSWYGQPEPEAILGTPTQDSMAQRAGIASGERVVAVRVTQRDGSDDGDVAYRSVRSWPELRHWLARDVDADASTVILRTQRPDGVATHTLSLAALQGDTPGKRRADMVGAGGGQADIATRLGLVPGGAAPLIASVQPGTPAAKAGLQEGDTVLRVQGETVDDANALVQMMRERPGRDTVLDIQRGNQNVTVHVVPEAVKEAGGGLPYGRIGAALGMRLPLVDVHYGPVESVRMAVGRTWDVASFSVEMFGRMLTGQASLKNLSGPVTIADYAGRSARMGVSAFISFLALVSISLGVLNLLPIPVLDGGHLLYYAVEALTGRAVSDRWQAILQRAGLVCIVALSVVALFNDLTRLAHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 3 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 4 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 5 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 6 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 7 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 8 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 9 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 10 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 11 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 12 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 13 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 14 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 15 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 16 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 17 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 18 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 19 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 20 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 21 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 22 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 23 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 24 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 25 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 26 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 27 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 28 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 29 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 30 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 31 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 32 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 33 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 34 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 35 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 36 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 37 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 181 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 190 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 191 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 192 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 193 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 194 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 195 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 289 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 290 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 297 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 329 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 330 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 331 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 332 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 333 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 334 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 335 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 336 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 337 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 338 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.33 |
| Metatranscriptomes | 0.18 |
| Isolates | 8.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0.37 |
| Rhizoplane | 5.35 |
| Rhizosphere | 78.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000873 | 3300002067 | Bacteria | 10758 |
| 2 | JGI24735J21928_10001265 | 3300002067 | Bacteria | 8973 |
| 3 | Ga0055532_1003986 | 3300003758 | Bacteria | 2347 |
| 4 | Ga0055527_1001753 | 3300003760 | Bacteria | 4185 |
| 5 | Ga0055527_1001754 | 3300003760 | Bacteria | 4185 |
| 6 | Ga0055535_1003659 | 3300003761 | Bacteria | 4185 |
| 7 | Ga0055535_1003660 | 3300003761 | Bacteria | 4185 |
| 8 | Ga0055542_1003532 | 3300003762 | Bacteria | 4185 |
| 9 | Ga0055542_1003533 | 3300003762 | Bacteria | 4185 |
| 10 | Ga0055529_1001476 | 3300003763 | Bacteria | 7024 |
| 11 | Ga0055541_1007513 | 3300003841 | Bacteria | 1786 |
| 12 | Ga0065704_10127221 | 3300005289 | Bacteria | 1678 |
| 13 | Ga0070658_10002393 | 3300005327 | Bacteria | 15721 |
| 14 | Ga0070658_10011021 | 3300005327 | Bacteria | 7247 |
| 15 | Ga0070658_10059779 | 3300005327 | Bacteria | 3103 |
| 16 | Ga0070658_10156923 | 3300005327 | Bacteria | 1908 |
| 17 | Ga0070683_100070791 | 3300005329 | Bacteria | 3254 |
| 18 | Ga0070670_100006956 | 3300005331 | Bacteria | 9588 |
| 19 | Ga0070677_10015794 | 3300005333 | Bacteria | 2679 |
| 20 | Ga0068869_100003904 | 3300005334 | Bacteria | 9197 |
| 21 | Ga0068869_100025411 | 3300005334 | Bacteria | 4112 |
| 22 | Ga0070666_10052439 | 3300005335 | Bacteria | 2749 |
| 23 | Ga0068868_100035264 | 3300005338 | Bacteria | 3866 |
| 24 | Ga0070660_100000504 | 3300005339 | Bacteria | 26092 |
| 25 | Ga0070660_100001298 | 3300005339 | Bacteria | 17020 |
| 26 | Ga0070661_100029621 | 3300005344 | Bacteria | 3952 |
| 27 | Ga0070661_100102132 | 3300005344 | Bacteria | 2134 |
| 28 | Ga0070675_100021815 | 3300005354 | Bacteria | 5116 |
| 29 | Ga0070675_100044998 | 3300005354 | Bacteria | 3611 |
| 30 | Ga0070671_100027234 | 3300005355 | Bacteria | 4703 |
| 31 | Ga0070673_100005910 | 3300005364 | Bacteria | 7901 |
| 32 | Ga0070673_100025823 | 3300005364 | Bacteria | 4330 |
| 33 | Ga0070659_100000096 | 3300005366 | Bacteria | 66336 |
| 34 | Ga0070667_100148267 | 3300005367 | Bacteria | 2059 |
| 35 | Ga0070714_100051697 | 3300005435 | Bacteria | 3504 |
| 36 | Ga0070713_100087693 | 3300005436 | Bacteria | 2670 |
| 37 | Ga0070663_100002692 | 3300005455 | Bacteria | 10057 |
| 38 | Ga0070678_100008537 | 3300005456 | Bacteria | 6137 |
| 39 | Ga0070681_10016840 | 3300005458 | Bacteria | 7300 |
| 40 | Ga0070681_10052589 | 3300005458 | Bacteria | 4063 |
| 41 | Ga0068867_100151413 | 3300005459 | Bacteria | 1822 |
| 42 | Ga0070684_100184485 | 3300005535 | Bacteria | 1897 |
| 43 | Ga0068853_100008688 | 3300005539 | Bacteria | 8170 |
| 44 | Ga0068853_100013155 | 3300005539 | Bacteria | 6753 |
| 45 | Ga0068853_100203455 | 3300005539 | Bacteria | 1802 |
| 46 | Ga0070672_100010363 | 3300005543 | Bacteria | 6463 |
| 47 | Ga0070693_100011277 | 3300005547 | Bacteria | 4500 |
| 48 | Ga0070693_100047823 | 3300005547 | Bacteria | 2435 |
| 49 | Ga0070665_100054800 | 3300005548 | Bacteria | 3999 |
| 50 | Ga0070665_100099519 | 3300005548 | Bacteria | 2912 |
| 51 | Ga0068855_100010957 | 3300005563 | Bacteria | 10939 |
| 52 | Ga0068855_100019484 | 3300005563 | Bacteria | 8153 |
| 53 | Ga0068855_100019488 | 3300005563 | Bacteria | 8153 |
| 54 | Ga0068855_100020921 | 3300005563 | Bacteria | 7846 |
| 55 | Ga0068855_100148799 | 3300005563 | Bacteria | 2663 |
| 56 | Ga0070664_100049898 | 3300005564 | Bacteria | 3540 |
| 57 | Ga0068854_100078468 | 3300005578 | Bacteria | 2433 |
| 58 | Ga0068856_100079495 | 3300005614 | Bacteria | 3252 |
| 59 | Ga0068852_100005797 | 3300005616 | Bacteria | 8870 |
| 60 | Ga0068859_100198246 | 3300005617 | Bacteria | 2092 |
| 61 | Ga0068859_100253645 | 3300005617 | Bacteria | 1850 |
| 62 | Ga0068866_10059311 | 3300005718 | Bacteria | 1979 |
| 63 | Ga0068851_10020503 | 3300005834 | Bacteria | 3202 |
| 64 | Ga0068870_10052284 | 3300005840 | Bacteria | 2166 |
| 65 | Ga0068870_10061437 | 3300005840 | Bacteria | 2020 |
| 66 | Ga0068863_100030839 | 3300005841 | Bacteria | 5120 |
| 67 | Ga0068863_100073057 | 3300005841 | Bacteria | 3245 |
| 68 | Ga0068858_100032267 | 3300005842 | Bacteria | 4865 |
| 69 | Ga0068858_100082743 | 3300005842 | Bacteria | 2984 |
| 70 | Ga0068862_100039651 | 3300005844 | Bacteria | 4001 |
| 71 | Ga0070717_10130248 | 3300006028 | Bacteria | 2163 |
| 72 | Ga0075369_10002482 | 3300006186 | Bacteria | 6587 |
| 73 | Ga0075366_10003539 | 3300006195 | Bacteria | 8256 |
| 74 | Ga0097621_100003683 | 3300006237 | Bacteria | 10596 |
| 75 | Ga0097621_100014887 | 3300006237 | Bacteria | 5836 |
| 76 | Ga0068871_100016562 | 3300006358 | Bacteria | 5558 |
| 77 | Ga0068871_100019776 | 3300006358 | Bacteria | 5145 |
| 78 | Ga0068871_100048150 | 3300006358 | Bacteria | 3440 |
| 79 | Ga0068871_100160874 | 3300006358 | Bacteria | 1920 |
| 80 | Ga0075428_100000245 | 3300006844 | Bacteria | 53219 |
| 81 | Ga0075430_100020343 | 3300006846 | Bacteria | 5647 |
| 82 | Ga0075430_100056022 | 3300006846 | Bacteria | 3315 |
| 83 | Ga0075431_100003069 | 3300006847 | Bacteria | 16172 |
| 84 | Ga0075431_100034097 | 3300006847 | Bacteria | 5245 |
| 85 | Ga0075434_100041481 | 3300006871 | Bacteria | 4560 |
| 86 | Ga0075429_100008747 | 3300006880 | Bacteria | 8806 |
| 87 | Ga0075436_100008048 | 3300006914 | Bacteria | 7218 |
| 88 | Ga0097620_100198243 | 3300006931 | Bacteria | 2092 |
| 89 | Ga0097620_100253647 | 3300006931 | Bacteria | 1850 |
| 90 | Ga0099794_10053454 | 3300007265 | Bacteria | 1948 |
| 91 | Ga0105251_10001119 | 3300009011 | Bacteria | 23332 |
| 92 | Ga0105240_10001770 | 3300009093 | Bacteria | 36461 |
| 93 | Ga0105240_10059340 | 3300009093 | Bacteria | 4775 |
| 94 | Ga0111539_10000383 | 3300009094 | Bacteria | 54556 |
| 95 | Ga0111539_10080582 | 3300009094 | Bacteria | 3829 |
| 96 | Ga0105245_10086042 | 3300009098 | Bacteria | 2882 |
| 97 | Ga0105245_10164908 | 3300009098 | Bacteria | 2105 |
| 98 | Ga0105243_10000770 | 3300009148 | Bacteria | 30670 |
| 99 | Ga0105243_10026412 | 3300009148 | Bacteria | 4444 |
| 100 | Ga0105243_10116079 | 3300009148 | Bacteria | 2248 |
| 101 | Ga0105241_10017067 | 3300009174 | Bacteria | 5331 |
| 102 | Ga0105242_10049912 | 3300009176 | Bacteria | 3406 |
| 103 | Ga0105248_10002407 | 3300009177 | Bacteria | 20777 |
| 104 | Ga0105248_10058954 | 3300009177 | Bacteria | 4312 |
| 105 | Ga0105248_10137513 | 3300009177 | Bacteria | 2756 |
| 106 | Ga0105237_10005766 | 3300009545 | Bacteria | 13911 |
| 107 | Ga0105238_10001068 | 3300009551 | Bacteria | 27660 |
| 108 | Ga0105238_10014298 | 3300009551 | Bacteria | 8023 |
| 109 | Ga0105238_10078193 | 3300009551 | Bacteria | 3299 |
| 110 | Ga0105249_10144621 | 3300009553 | Bacteria | 2283 |
| 111 | Ga0105239_10002463 | 3300010375 | Bacteria | 23588 |
| 112 | Ga0105239_10003884 | 3300010375 | Bacteria | 18132 |
| 113 | Ga0105239_10007605 | 3300010375 | Bacteria | 12417 |
| 114 | Ga0105239_10069989 | 3300010375 | Bacteria | 3854 |
| 115 | Ga0157373_10006985 | 3300013100 | Bacteria | 8410 |
| 116 | Ga0157373_10083475 | 3300013100 | Bacteria | 2252 |
| 117 | Ga0157371_10007279 | 3300013102 | Bacteria | 8990 |
| 118 | Ga0157370_10007952 | 3300013104 | Bacteria | 11485 |
| 119 | Ga0157370_10008261 | 3300013104 | Bacteria | 11238 |
| 120 | Ga0157370_10157383 | 3300013104 | Bacteria | 2114 |
| 121 | Ga0157369_10000511 | 3300013105 | Bacteria | 51116 |
| 122 | Ga0157369_10000979 | 3300013105 | Bacteria | 36209 |
| 123 | Ga0157369_10002197 | 3300013105 | Bacteria | 23502 |
| 124 | Ga0157369_10091577 | 3300013105 | Bacteria | 3245 |
| 125 | Ga0157369_10246458 | 3300013105 | Bacteria | 1865 |
| 126 | Ga0157374_10000107 | 3300013296 | Bacteria | 75925 |
| 127 | Ga0157374_10031938 | 3300013296 | Bacteria | 4790 |
| 128 | Ga0157374_10127586 | 3300013296 | Bacteria | 2459 |
| 129 | Ga0157378_10063541 | 3300013297 | Bacteria | 3298 |
| 130 | Ga0157378_10097337 | 3300013297 | Bacteria | 2682 |
| 131 | Ga0157378_10169632 | 3300013297 | Bacteria | 2046 |
| 132 | Ga0163162_10006481 | 3300013306 | Bacteria | 11333 |
| 133 | Ga0157372_10002854 | 3300013307 | Bacteria | 18675 |
| 134 | Ga0157372_10128119 | 3300013307 | Bacteria | 2919 |
| 135 | Ga0157372_10129037 | 3300013307 | Bacteria | 2908 |
| 136 | Ga0157372_10415704 | 3300013307 | Bacteria | 1567 |
| 137 | Ga0157375_10023805 | 3300013308 | Bacteria | 5658 |
| 138 | Ga0157375_10028549 | 3300013308 | Bacteria | 5232 |
| 139 | Ga0157375_10069517 | 3300013308 | Bacteria | 3528 |
| 140 | Ga0157375_10173663 | 3300013308 | Bacteria | 2304 |
| 141 | Ga0157380_10210633 | 3300014326 | Bacteria | 1732 |
| 142 | Ga0157376_10011903 | 3300014969 | Bacteria | 6433 |
| 143 | Ga0157376_10040685 | 3300014969 | Bacteria | 3800 |
| 144 | Ga0157376_10151166 | 3300014969 | Bacteria | 2094 |
| 145 | Ga0182006_1033937 | 3300015261 | Bacteria | 2044 |
| 146 | Ga0182007_10031403 | 3300015262 | Bacteria | 1809 |
| 147 | Ga0182005_1020509 | 3300015265 | Bacteria | 1818 |
| 148 | Ga0213872_10000003 | 3300021361 | Bacteria | 366948 |
| 149 | Ga0209566_100559 | 3300025225 | Bacteria | 24573 |
| 150 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 151 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 152 | Ga0209672_100433 | 3300025228 | Bacteria | 24114 |
| 153 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 154 | Ga0209147_100104 | 3300025229 | Bacteria | 158375 |
| 155 | Ga0209147_101808 | 3300025229 | Bacteria | 6696 |
| 156 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 157 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 158 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 159 | Ga0209759_1000030 | 3300025256 | Bacteria | 285649 |
| 160 | Ga0209759_1011780 | 3300025256 | Bacteria | 2462 |
| 161 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 162 | Ga0209564_1004868 | 3300025295 | Bacteria | 7977 |
| 163 | Ga0209257_1026844 | 3300025304 | Bacteria | 1930 |
| 164 | Ga0207713_1002241 | 3300025735 | Bacteria | 14307 |
| 165 | Ga0207682_10020088 | 3300025893 | Bacteria | 2620 |
| 166 | Ga0207647_10000108 | 3300025904 | Bacteria | 63172 |
| 167 | Ga0207647_10000498 | 3300025904 | Bacteria | 31401 |
| 168 | Ga0207647_10036364 | 3300025904 | Bacteria | 3129 |
| 169 | Ga0207643_10018307 | 3300025908 | Bacteria | 3836 |
| 170 | Ga0207643_10084818 | 3300025908 | Bacteria | 1839 |
| 171 | Ga0207705_10001472 | 3300025909 | Bacteria | 18763 |
| 172 | Ga0207705_10010151 | 3300025909 | Bacteria | 6852 |
| 173 | Ga0207654_10003311 | 3300025911 | Bacteria | 8149 |
| 174 | Ga0207707_10145180 | 3300025912 | Bacteria | 2074 |
| 175 | Ga0207695_10012800 | 3300025913 | Bacteria | 10045 |
| 176 | Ga0207695_10026800 | 3300025913 | Bacteria | 6428 |
| 177 | Ga0207695_10232992 | 3300025913 | Bacteria | 1745 |
| 178 | Ga0207671_10008853 | 3300025914 | Bacteria | 8477 |
| 179 | Ga0207662_10036199 | 3300025918 | Bacteria | 2884 |
| 180 | Ga0207657_10000004 | 3300025919 | Bacteria | 247179 |
| 181 | Ga0207657_10064846 | 3300025919 | Bacteria | 3116 |
| 182 | Ga0207649_10022174 | 3300025920 | Bacteria | 3668 |
| 183 | Ga0207694_10024852 | 3300025924 | Bacteria | 4550 |
| 184 | Ga0207650_10023575 | 3300025925 | Bacteria | 4365 |
| 185 | Ga0207687_10010562 | 3300025927 | Bacteria | 6035 |
| 186 | Ga0207644_10017931 | 3300025931 | Bacteria | 4787 |
| 187 | Ga0207690_10000015 | 3300025932 | Bacteria | 257457 |
| 188 | Ga0207709_10005524 | 3300025935 | Bacteria | 7171 |
| 189 | Ga0207691_10007106 | 3300025940 | Bacteria | 10808 |
| 190 | Ga0207689_10000974 | 3300025942 | Bacteria | 27470 |
| 191 | Ga0207661_10188261 | 3300025944 | Bacteria | 1808 |
| 192 | Ga0207667_10002397 | 3300025949 | Bacteria | 23474 |
| 193 | Ga0207667_10003025 | 3300025949 | Bacteria | 20864 |
| 194 | Ga0207667_10005390 | 3300025949 | Bacteria | 15598 |
| 195 | Ga0207667_10007177 | 3300025949 | Bacteria | 13441 |
| 196 | Ga0207667_10097788 | 3300025949 | Bacteria | 3029 |
| 197 | Ga0207651_10019003 | 3300025960 | Bacteria | 4107 |
| 198 | Ga0207651_10040384 | 3300025960 | Bacteria | 3086 |
| 199 | Ga0207640_10064246 | 3300025981 | Bacteria | 2443 |
| 200 | Ga0207658_10066305 | 3300025986 | Bacteria | 2715 |
| 201 | Ga0207677_10036089 | 3300026023 | Bacteria | 3218 |
| 202 | Ga0207703_10030879 | 3300026035 | Bacteria | 4236 |
| 203 | Ga0207703_10057411 | 3300026035 | Bacteria | 3174 |
| 204 | Ga0207639_10048486 | 3300026041 | Bacteria | 3215 |
| 205 | Ga0207639_10064507 | 3300026041 | Bacteria | 2840 |
| 206 | Ga0207678_10001691 | 3300026067 | Bacteria | 20214 |
| 207 | Ga0207678_10002079 | 3300026067 | Bacteria | 18154 |
| 208 | Ga0207702_10031798 | 3300026078 | Bacteria | 4401 |
| 209 | Ga0207702_10100141 | 3300026078 | Bacteria | 2556 |
| 210 | Ga0207641_10068358 | 3300026088 | Bacteria | 3046 |
| 211 | Ga0207648_10000142 | 3300026089 | Bacteria | 71593 |
| 212 | Ga0207676_10104768 | 3300026095 | Bacteria | 2353 |
| 213 | Ga0207683_10003576 | 3300026121 | Bacteria | 13558 |
| 214 | Ga0207683_10187256 | 3300026121 | Bacteria | 1878 |
| 215 | Ga0207698_10049953 | 3300026142 | Bacteria | 3187 |
| 216 | Ga0209371_1000079 | 3300027312 | Bacteria | 187621 |
| 217 | Ga0209981_1002317 | 3300027378 | Bacteria | 2418 |
| 218 | Ga0209974_10006559 | 3300027876 | Bacteria | 4058 |
| 219 | Ga0207428_10005311 | 3300027907 | Bacteria | 12021 |
| 220 | Ga0268266_10020285 | 3300028379 | Bacteria | 5668 |
| 221 | Ga0268266_10035234 | 3300028379 | Bacteria | 4258 |
| 222 | Ga0268266_10185285 | 3300028379 | Bacteria | 1898 |
| 223 | Ga0265336_10002632 | 3300028666 | Bacteria | 7290 |
| 224 | Ga0265338_10000028 | 3300028800 | Bacteria | 279132 |
| 225 | Ga0265338_10000741 | 3300028800 | Bacteria | 55680 |
| 226 | Ga0265324_10000005 | 3300029957 | Bacteria | 347038 |
| 227 | Ga0265324_10000205 | 3300029957 | Bacteria | 45035 |
| 228 | Ga0265324_10014450 | 3300029957 | Bacteria | 2922 |
| 229 | Ga0268256_1000090 | 3300030500 | Bacteria | 153976 |
| 230 | Ga0265325_10000314 | 3300031241 | Bacteria | 34098 |
| 231 | Ga0265331_10013109 | 3300031250 | Bacteria | 4466 |
| 232 | Ga0265331_10017844 | 3300031250 | Bacteria | 3693 |
| 233 | Ga0265327_10001032 | 3300031251 | Bacteria | 39265 |
| 234 | Ga0265316_10108626 | 3300031344 | Bacteria | 2103 |
| 235 | Ga0307408_100131321 | 3300031548 | Bacteria | 1954 |
| 236 | Ga0307408_100167561 | 3300031548 | Bacteria | 1751 |
| 237 | Ga0265314_10000740 | 3300031711 | Bacteria | 39277 |
| 238 | Ga0316583_10013376 | 3300032133 | Bacteria | 2961 |
| 239 | Ga0316593_10000190 | 3300032168 | Bacteria | 9414 |
| 240 | Ga0373955_0042294 | 3300035172 | Bacteria | 2446 |
| 241 | Ga0373937_0011712 | 3300036401 | Bacteria | 7692 |
| 242 | Ga0373937_0090607 | 3300036401 | Bacteria | 2832 |
| 243 | Ga0395899_0000007 | 3300037312 | Bacteria | 629129 |
| 244 | Ga0395900_0000026 | 3300037418 | Bacteria | 313470 |
| 245 | Ga0395900_0027856 | 3300037418 | Bacteria | 5788 |
| 246 | Ga0395900_0044477 | 3300037418 | Bacteria | 4575 |
| 247 | Ga0395898_0000497 | 3300037466 | Bacteria | 76853 |
| 248 | Ga0395898_0001748 | 3300037466 | Bacteria | 28615 |
| 249 | Ga0395905_0028009 | 3300037471 | Bacteria | 5311 |
| 250 | Ga0395901_0000077 | 3300038443 | Bacteria | 135073 |
| 251 | Ga0395901_0000296 | 3300038443 | Bacteria | 61806 |
| 252 | Ga0395901_0000923 | 3300038443 | Bacteria | 31994 |
| 253 | Ga0395901_0019691 | 3300038443 | Bacteria | 6899 |
| 254 | Ga0400484_29948 | 3300038725 | Bacteria | 10111 |
| 255 | Ga0400484_43627 | 3300038725 | Bacteria | 12060 |
| 256 | Ga0400490_17851 | 3300038726 | Bacteria | 80099 |
| 257 | Ga0400485_07894 | 3300038735 | Bacteria | 3828 |
| 258 | Ga0400488_31176 | 3300038741 | Bacteria | 4202 |
| 259 | Ga0400488_33004 | 3300038741 | Bacteria | 10792 |
| 260 | Ga0400488_38891 | 3300038741 | Bacteria | 20773 |
| 261 | Ga0400486_00233 | 3300038742 | Bacteria | 7497 |
| 262 | Ga0400486_14851 | 3300038742 | Bacteria | 63108 |
| 263 | Ga0400483_108358 | 3300039062 | Bacteria | 8062 |
| 264 | Ga0400483_121666 | 3300039062 | Bacteria | 18159 |
| 265 | Ga0400483_145565 | 3300039062 | Bacteria | 12981 |
| 266 | Ga0400483_179405 | 3300039062 | Bacteria | 2925 |
| 267 | Ga0400483_192031 | 3300039062 | Bacteria | 23073 |
| 268 | Ga0400483_241642 | 3300039062 | Bacteria | 19322 |
| 269 | Ga0400483_268051 | 3300039062 | Bacteria | 17073 |
| 270 | Ga0400487_01458 | 3300039110 | Bacteria | 5704 |
| 271 | Ga0400487_19502 | 3300039110 | Bacteria | 1877 |
| 272 | Ga0400487_24806 | 3300039110 | Bacteria | 35141 |
| 273 | Ga0436365_1054781 | 3300039437 | Bacteria | 2190 |
| 274 | Ga0436361_0007468 | 3300039447 | Bacteria | 5122 |
| 275 | Ga0436361_0746584 | 3300039447 | Bacteria | 9390 |
| 276 | Ga0436361_1124174 | 3300039447 | Bacteria | 21478 |
| 277 | Ga0439448_0004190 | 3300042005 | Bacteria | 4060 |
| 278 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 279 | Ga0451577_0000319 | 3300042876 | Bacteria | 90564 |
| 280 | Ga0451577_0023500 | 3300042876 | Bacteria | 5621 |
| 281 | Ga0451577_0045119 | 3300042876 | Bacteria | 3946 |
| 282 | Ga0451577_0117675 | 3300042876 | Bacteria | 2380 |
| 283 | Ga0466969_0000297 | 3300044656 | Bacteria | 27202 |
| 284 | Ga0466969_0014342 | 3300044656 | Bacteria | 4165 |
| 285 | Ga0466969_0029521 | 3300044656 | Bacteria | 2799 |
| 286 | Ga0466977_0001674 | 3300044666 | Bacteria | 9434 |
| 287 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 288 | Ga0453683_0021694 | 3300044673 | Bacteria | 4098 |
| 289 | Ga0466965_0001551 | 3300044683 | Bacteria | 9348 |
| 290 | Ga0466966_0000084 | 3300044684 | Bacteria | 58535 |
| 291 | Ga0466966_0007478 | 3300044684 | Bacteria | 7239 |
| 292 | Ga0466966_0009017 | 3300044684 | Bacteria | 6610 |
| 293 | Ga0466966_0024377 | 3300044684 | Bacteria | 3958 |
| 294 | Ga0466966_0069537 | 3300044684 | Bacteria | 2208 |
| 295 | Ga0466961_0000567 | 3300044693 | Bacteria | 23500 |
| 296 | Ga0466961_0009347 | 3300044693 | Bacteria | 6244 |
| 297 | Ga0466961_0031147 | 3300044693 | Bacteria | 3428 |
| 298 | Ga0466961_0076667 | 3300044693 | Bacteria | 2118 |
| 299 | Ga0466963_0001538 | 3300044694 | Bacteria | 12494 |
| 300 | Ga0466963_0018644 | 3300044694 | Bacteria | 4343 |
| 301 | Ga0466964_0001157 | 3300044706 | Bacteria | 8921 |
| 302 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 303 | Ga0453684_0000075 | 3300044712 | Bacteria | 437715 |
| 304 | Ga0453684_0012407 | 3300044712 | Bacteria | 14056 |
| 305 | Ga0453684_0018401 | 3300044712 | Bacteria | 10724 |
| 306 | Ga0453684_0053791 | 3300044712 | Bacteria | 5252 |
| 307 | Ga0466971_0001519 | 3300044719 | Bacteria | 9782 |
| 308 | Ga0466968_0059491 | 3300044735 | Bacteria | 1646 |
| 309 | Ga0466970_0019669 | 3300044765 | Bacteria | 3502 |
| 310 | Ga0466970_0064372 | 3300044765 | Bacteria | 1966 |
| 311 | Ga0466957_0002457 | 3300044842 | Bacteria | 9948 |
| 312 | Ga0466957_0005149 | 3300044842 | Bacteria | 7309 |
| 313 | Ga0466957_0032769 | 3300044842 | Bacteria | 3113 |
| 314 | Ga0466957_0071889 | 3300044842 | Bacteria | 2140 |
| 315 | Ga0466960_0024840 | 3300044901 | Bacteria | 2707 |
| 316 | Ga0466959_0000802 | 3300045049 | Bacteria | 18513 |
| 317 | Ga0466959_0003739 | 3300045049 | Bacteria | 10061 |
| 318 | Ga0466959_0008983 | 3300045049 | Bacteria | 7087 |
| 319 | Ga0466959_0021302 | 3300045049 | Bacteria | 4779 |
| 320 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 321 | Ga0451576_0000029 | 3300045051 | Bacteria | 404449 |
| 322 | Ga0451576_0000250 | 3300045051 | Bacteria | 132101 |
| 323 | Ga0451576_0001615 | 3300045051 | Bacteria | 37836 |
| 324 | Ga0451576_0005294 | 3300045051 | Bacteria | 16219 |
| 325 | Ga0451576_0011555 | 3300045051 | Bacteria | 10017 |
| 326 | Ga0451576_0012005 | 3300045051 | Bacteria | 9782 |
| 327 | Ga0451576_0012462 | 3300045051 | Bacteria | 9546 |
| 328 | Ga0451576_0038365 | 3300045051 | Bacteria | 5070 |
| 329 | Ga0466958_0000254 | 3300045836 | Bacteria | 20704 |
| 330 | Ga0466958_0000731 | 3300045836 | Bacteria | 14358 |
| 331 | Ga0466967_0186318 | 3300045976 | Bacteria | 1960 |
| 332 | Ga0495592_0017875 | 3300046454 | Bacteria | 5390 |
| 333 | Ga0495603_0004961 | 3300046455 | Bacteria | 7963 |
| 334 | Ga0495590_0009596 | 3300046457 | Bacteria | 3671 |
| 335 | Ga0495629_0024830 | 3300046459 | Bacteria | 4264 |
| 336 | Ga0495638_0002053 | 3300046460 | Bacteria | 17098 |
| 337 | Ga0495638_0054738 | 3300046460 | Bacteria | 2479 |
| 338 | Ga0495651_0034283 | 3300046462 | Bacteria | 3957 |
| 339 | Ga0495651_0091675 | 3300046462 | Bacteria | 2278 |
| 340 | Ga0495653_0094116 | 3300046463 | Bacteria | 2184 |
| 341 | Ga0495650_0000224 | 3300046471 | Bacteria | 118058 |
| 342 | Ga0495650_0003457 | 3300046471 | Bacteria | 11513 |
| 343 | Ga0495650_0034042 | 3300046471 | Bacteria | 2260 |
| 344 | Ga0495650_0037541 | 3300046471 | Bacteria | 2107 |
| 345 | Ga0495650_0039439 | 3300046471 | Bacteria | 2038 |
| 346 | Ga0495580_0016071 | 3300046472 | Bacteria | 5625 |
| 347 | Ga0495605_0039456 | 3300046474 | Bacteria | 2365 |
| 348 | Ga0495664_0060004 | 3300046477 | Bacteria | 2264 |
| 349 | Ga0495664_0099369 | 3300046477 | Bacteria | 1752 |
| 350 | Ga0495584_0053090 | 3300046491 | Bacteria | 2040 |
| 351 | Ga0495607_0031805 | 3300046501 | Bacteria | 3228 |
| 352 | Ga0495583_0012474 | 3300046506 | Bacteria | 4804 |
| 353 | Ga0495606_0015445 | 3300046507 | Bacteria | 5881 |
| 354 | Ga0495606_0145331 | 3300046507 | Bacteria | 1397 |
| 355 | Ga0495628_0095529 | 3300046516 | Bacteria | 2296 |
| 356 | Ga0495630_0302180 | 3300046517 | Bacteria | 1223 |
| 357 | Ga0495652_0080614 | 3300046529 | Bacteria | 2688 |
| 358 | Ga0495654_0000428 | 3300046530 | Bacteria | 35538 |
| 359 | Ga0495654_0030825 | 3300046530 | Bacteria | 2726 |
| 360 | Ga0495665_0050918 | 3300046531 | Bacteria | 2194 |
| 361 | Ga0495586_0056560 | 3300046535 | Bacteria | 2128 |
| 362 | Ga0495586_0111805 | 3300046535 | Bacteria | 1521 |
| 363 | Ga0495587_0006632 | 3300046536 | Bacteria | 7540 |
| 364 | Ga0495609_0019834 | 3300046538 | Bacteria | 3109 |
| 365 | Ga0495621_0003224 | 3300046539 | Bacteria | 4481 |
| 366 | Ga0495621_0010869 | 3300046539 | Bacteria | 2799 |
| 367 | Ga0495597_0004490 | 3300046542 | Bacteria | 7649 |
| 368 | Ga0495645_0004194 | 3300046543 | Bacteria | 9855 |
| 369 | Ga0495645_0013820 | 3300046543 | Bacteria | 5720 |
| 370 | Ga0495645_0020676 | 3300046543 | Bacteria | 4752 |
| 371 | Ga0495645_0081925 | 3300046543 | Bacteria | 2314 |
| 372 | Ga0495645_0089437 | 3300046543 | Bacteria | 2202 |
| 373 | Ga0495622_0001676 | 3300046557 | Bacteria | 10959 |
| 374 | Ga0495667_0008494 | 3300046559 | Bacteria | 6971 |
| 375 | Ga0495611_0019128 | 3300046648 | Bacteria | 2941 |
| 376 | Ga0495625_0099965 | 3300046660 | Bacteria | 1994 |
| 377 | Ga0495635_0118106 | 3300046663 | Bacteria | 1810 |
| 378 | Ga0495657_0060592 | 3300046675 | Bacteria | 2507 |
| 379 | Ga0495599_0044046 | 3300046678 | Bacteria | 2799 |
| 380 | Ga0495623_0080470 | 3300046679 | Bacteria | 2016 |
| 381 | Ga0495669_0006587 | 3300046684 | Bacteria | 4856 |
| 382 | Ga0495669_0032792 | 3300046684 | Bacteria | 2284 |
| 383 | Ga0495624_0040024 | 3300046690 | Bacteria | 3003 |
| 384 | Ga0495624_0080393 | 3300046690 | Bacteria | 2019 |
| 385 | Ga0495670_0003239 | 3300046691 | Bacteria | 8016 |
| 386 | Ga0495671_0005413 | 3300046692 | Bacteria | 7472 |
| 387 | Ga0495671_0020374 | 3300046692 | Bacteria | 3495 |
| 388 | Ga0495649_0035118 | 3300046694 | Bacteria | 2757 |
| 389 | Ga0495589_0006457 | 3300046794 | Bacteria | 6182 |
| 390 | Ga0495600_0080517 | 3300046809 | Bacteria | 2126 |
| 391 | Ga0495660_0042286 | 3300046810 | Bacteria | 2519 |
| 392 | Ga0495581_0036259 | 3300047315 | Bacteria | 2853 |
| 393 | Ga0495604_0025792 | 3300047317 | Bacteria | 4681 |
| 394 | Ga0495674_0058466 | 3300047319 | Bacteria | 3370 |
| 395 | Ga0495674_0142085 | 3300047319 | Bacteria | 2017 |
| 396 | Ga0495680_0033291 | 3300047322 | Bacteria | 4174 |
| 397 | Ga0495680_0095292 | 3300047322 | Bacteria | 2225 |
| 398 | Ga0495683_0005181 | 3300047323 | Bacteria | 7261 |
| 399 | Ga0495687_001154 | 3300047443 | Bacteria | 25585 |
| 400 | Ga0495675_0038381 | 3300047444 | Bacteria | 3049 |
| 401 | Ga0495675_0090023 | 3300047444 | Bacteria | 1926 |
| 402 | Ga0495679_000102 | 3300047446 | Bacteria | 76337 |
| 403 | Ga0495684_0081603 | 3300047471 | Bacteria | 2454 |
| 404 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 405 | Ga0495686_0068900 | 3300047472 | Bacteria | 2182 |
| 406 | Ga0495593_0030003 | 3300047673 | Bacteria | 2978 |
| 407 | Ga0495593_0038870 | 3300047673 | Bacteria | 2568 |
| 408 | Ga0495593_0046238 | 3300047673 | Bacteria | 2320 |
| 409 | Ga0495614_0037940 | 3300048089 | Bacteria | 2068 |
| 410 | Ga0495614_0067220 | 3300048089 | Bacteria | 1543 |
| 411 | Ga0495626_0013534 | 3300048091 | Bacteria | 4237 |
| 412 | Ga0496100_0003455 | 3300048903 | Bacteria | 8240 |
| 413 | Ga0496100_0058050 | 3300048903 | Bacteria | 2538 |
| 414 | Ga0496101_0003813 | 3300048904 | Bacteria | 9419 |
| 415 | Ga0496101_0201261 | 3300048904 | Bacteria | 1540 |
| 416 | Ga0496102_0003091 | 3300048905 | Bacteria | 14107 |
| 417 | Ga0496102_0263983 | 3300048905 | Bacteria | 1623 |
| 418 | Ga0496103_0001420 | 3300048906 | Bacteria | 16051 |
| 419 | Ga0496104_0187250 | 3300048907 | Bacteria | 1981 |
| 420 | Ga0496105_0138088 | 3300048908 | Bacteria | 2007 |
| 421 | Ga0496106_0001077 | 3300048909 | Bacteria | 20151 |
| 422 | Ga0496106_0027324 | 3300048909 | Bacteria | 4250 |
| 423 | Ga0496106_0059256 | 3300048909 | Bacteria | 2900 |
| 424 | Ga0496107_0116147 | 3300048910 | Bacteria | 1970 |
| 425 | Ga0496109_0126523 | 3300048912 | Bacteria | 2383 |
| 426 | Ga0496109_0214428 | 3300048912 | Bacteria | 1810 |
| 427 | Ga0496110_0000457 | 3300048913 | Bacteria | 27743 |
| 428 | Ga0496110_0032191 | 3300048913 | Bacteria | 4527 |
| 429 | Ga0496111_0009434 | 3300048914 | Bacteria | 6513 |
| 430 | Ga0496111_0082443 | 3300048914 | Bacteria | 2349 |
| 431 | Ga0496111_0082732 | 3300048914 | Bacteria | 2345 |
| 432 | Ga0496112_0010133 | 3300048915 | Bacteria | 8537 |
| 433 | Ga0496113_0001720 | 3300048916 | Bacteria | 12380 |
| 434 | Ga0496114_0009017 | 3300048917 | Bacteria | 7906 |
| 435 | Ga0496114_0290531 | 3300048917 | Bacteria | 1442 |
| 436 | Ga0496115_0034553 | 3300048918 | Bacteria | 3996 |
| 437 | Ga0496116_0039696 | 3300048919 | Bacteria | 3250 |
| 438 | Ga0496117_0005730 | 3300048920 | Bacteria | 12910 |
| 439 | Ga0496117_0012388 | 3300048920 | Bacteria | 7524 |
| 440 | Ga0496117_0070837 | 3300048920 | Bacteria | 2339 |
| 441 | Ga0496118_0001989 | 3300048921 | Bacteria | 29022 |
| 442 | Ga0496118_0005512 | 3300048921 | Bacteria | 14361 |
| 443 | Ga0496118_0063179 | 3300048921 | Bacteria | 2725 |
| 444 | Ga0496121_0003420 | 3300048924 | Bacteria | 22697 |
| 445 | Ga0496121_0074975 | 3300048924 | Bacteria | 2704 |
| 446 | Ga0496121_0099771 | 3300048924 | Bacteria | 2243 |
| 447 | Ga0496122_0004586 | 3300048925 | Bacteria | 17012 |
| 448 | Ga0496123_0015693 | 3300048926 | Bacteria | 6197 |
| 449 | Ga0496124_0001916 | 3300048927 | Bacteria | 28536 |
| 450 | Ga0496126_0002042 | 3300048929 | Bacteria | 28406 |
| 451 | Ga0466983_0196272 | 3300048986 | Bacteria | 1612 |
| 452 | Ga0495678_026175 | 3300049459 | Bacteria | 2494 |
| 453 | Ga0501039_0030275 | 3300049575 | Bacteria | 4173 |
| 454 | Ga0501039_0068019 | 3300049575 | Bacteria | 2766 |
| 455 | Ga0501039_0158298 | 3300049575 | Bacteria | 1780 |
| 456 | Ga0501042_0198529 | 3300049578 | Bacteria | 1447 |
| 457 | Ga0501043_0000141 | 3300049579 | Bacteria | 67326 |
| 458 | Ga0501046_0000047 | 3300049580 | Bacteria | 140344 |
| 459 | Ga0501047_0000058 | 3300049581 | Bacteria | 139202 |
| 460 | Ga0501048_0000475 | 3300049582 | Bacteria | 28030 |
| 461 | Ga0501067_0043438 | 3300049583 | Bacteria | 2496 |
| 462 | Ga0501070_0000612 | 3300049586 | Bacteria | 32731 |
| 463 | Ga0501070_0003856 | 3300049586 | Bacteria | 12935 |
| 464 | Ga0501070_0175917 | 3300049586 | Bacteria | 1762 |
| 465 | Ga0501071_0056146 | 3300049587 | Bacteria | 2843 |
| 466 | Ga0501073_0001654 | 3300049589 | Bacteria | 16525 |
| 467 | Ga0501074_0000811 | 3300049590 | Bacteria | 19770 |
| 468 | Ga0501074_0001507 | 3300049590 | Bacteria | 15711 |
| 469 | Ga0501076_0026193 | 3300049592 | Bacteria | 4514 |
| 470 | Ga0501079_0030446 | 3300049741 | Bacteria | 4146 |
| 471 | Ga0501080_0008750 | 3300049742 | Bacteria | 9193 |
| 472 | Ga0501080_0024443 | 3300049742 | Bacteria | 5599 |
| 473 | Ga0501080_0032837 | 3300049742 | Bacteria | 4842 |
| 474 | Ga0501080_0114349 | 3300049742 | Bacteria | 2502 |
| 475 | Ga0501083_0002111 | 3300049744 | Bacteria | 13636 |
| 476 | Ga0501280_000375 | 3300049776 | Bacteria | 10946 |
| 477 | Ga0501045_0015906 | 3300049824 | Bacteria | 5337 |
| 478 | nmdc:mga0k408_24582_c1 | 3300050493 | Bacteria | 3406 |
| 479 | nmdc:mga0k408_380_c2 | 3300050493 | Bacteria | 20523 |
| 480 | nmdc:mga09592_1274_c1 | 3300050508 | Bacteria | 13551 |
| 481 | nmdc:mga0qj67_81220_c1 | 3300050509 | Bacteria | 2599 |
| 482 | nmdc:mga06r32_18433_c1 | 3300050510 | Bacteria | 6390 |
| 483 | nmdc:mga06r32_28961_c1 | 3300050510 | Bacteria | 5185 |
| 484 | nmdc:mga08y16_65551_c1 | 3300050511 | Bacteria | 3791 |
| 485 | nmdc:mga0n895_126170_c1 | 3300050512 | Bacteria | 2583 |
| 486 | nmdc:mga08x19_5866_c1 | 3300050514 | Bacteria | 7268 |
| 487 | Ga0500618_000976 | 3300053125 | Bacteria | 14500 |
| 488 | Ga0500636_0000185 | 3300053177 | Bacteria | 33554 |
| 489 | Ga0500625_002765 | 3300053729 | Bacteria | 6694 |
| 490 | Ga0501084_0023535 | 3300054114 | Bacteria | 5139 |
| 491 | Ga0501084_0229158 | 3300054114 | Bacteria | 1568 |
| 492 | Ga0501082_0017124 | 3300060353 | Bacteria | 6244 |
| 493 | Ga0466962_0000537 | 3300061719 | Bacteria | 16663 |
| 494 | Ga0466962_0000675 | 3300061719 | Bacteria | 15172 |
| 495 | Ga0466962_0022586 | 3300061719 | Bacteria | 3023 |
| 496 | Ga0466962_0032196 | 3300061719 | Bacteria | 2510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0302180 | Ga0495630_0302180_11_1141 | 359 |
| 2 | 3300046530 | Ga0495654_0030825 | Ga0495654_0030825_15_1175 | 385 |
| 3 | 3300025304 | Ga0209257_1026844 | Ga0209257_10268442 | 410 |
| 4 | 3300047319 | Ga0495674_0142085 | Ga0495674_0142085_54_1448 | 410 |
| 5 | 3300044901 | Ga0466960_0024840 | Ga0466960_0024840_511_1761 | 413 |
| 6 | 3300005344 | Ga0070661_100102132 | Ga0070661_1001021322 | 414 |
| 7 | 3300005435 | Ga0070714_100051697 | Ga0070714_1000516973 | 414 |
| 8 | 3300005436 | Ga0070713_100087693 | Ga0070713_1000876932 | 414 |
| 9 | 3300005535 | Ga0070684_100184485 | Ga0070684_1001844851 | 414 |
| 10 | 3300005539 | Ga0068853_100013155 | Ga0068853_1000131554 | 414 |
| 11 | 3300005563 | Ga0068855_100019488 | Ga0068855_1000194882 | 414 |
| 12 | 3300005614 | Ga0068856_100079495 | Ga0068856_1000794952 | 414 |
| 13 | 3300006028 | Ga0070717_10130248 | Ga0070717_101302482 | 414 |
| 14 | 3300009093 | Ga0105240_10059340 | Ga0105240_100593402 | 414 |
| 15 | 3300009174 | Ga0105241_10017067 | Ga0105241_100170674 | 414 |
| 16 | 3300009551 | Ga0105238_10014298 | Ga0105238_100142982 | 414 |
| 17 | 3300013105 | Ga0157369_10246458 | Ga0157369_102464581 | 414 |
| 18 | 3300013307 | Ga0157372_10129037 | Ga0157372_101290372 | 414 |
| 19 | 3300025911 | Ga0207654_10003311 | Ga0207654_100033114 | 414 |
| 20 | 3300025913 | Ga0207695_10012800 | Ga0207695_1001280011 | 414 |
| 21 | 3300025924 | Ga0207694_10024852 | Ga0207694_100248522 | 414 |
| 22 | 3300025944 | Ga0207661_10188261 | Ga0207661_101882612 | 414 |
| 23 | 3300025949 | Ga0207667_10007177 | Ga0207667_100071778 | 414 |
| 24 | 3300026041 | Ga0207639_10048486 | Ga0207639_100484862 | 414 |
| 25 | 3300026078 | Ga0207702_10031798 | Ga0207702_100317982 | 414 |
| 26 | 3300039447 | Ga0436361_0746584 | Ga0436361_0746584_3271_4617 | 416 |
| 27 | 3300038741 | Ga0400488_31176 | Ga0400488_31176_1549_2919 | 418 |
| 28 | 3300039110 | Ga0400487_19502 | Ga0400487_19502_318_1688 | 418 |
| 29 | 3300046810 | Ga0495660_0042286 | Ga0495660_0042286_627_2024 | 420 |
| 30 | 3300047472 | Ga0495686_0068900 | Ga0495686_0068900_717_2114 | 420 |
| 31 | 3300005458 | Ga0070681_10052589 | Ga0070681_100525893 | 422 |
| 32 | 3300005539 | Ga0068853_100008688 | Ga0068853_1000086882 | 422 |
| 33 | 3300009551 | Ga0105238_10078193 | Ga0105238_100781932 | 422 |
| 34 | 3300010375 | Ga0105239_10007605 | Ga0105239_1000760511 | 422 |
| 35 | 3300026041 | Ga0207639_10064507 | Ga0207639_100645071 | 422 |
| 36 | 3300039447 | Ga0436361_0007468 | Ga0436361_0007468_789_2138 | 422 |
| 37 | 3300005617 | Ga0068859_100198246 | Ga0068859_1001982462 | 423 |
| 38 | 3300006931 | Ga0097620_100198243 | Ga0097620_1001982432 | 423 |
| 39 | 3300025256 | Ga0209759_1000030 | Ga0209759_1000030124 | 423 |
| 40 | 3300026023 | Ga0207677_10036089 | Ga0207677_100360892 | 423 |
| 41 | 3300026078 | Ga0207702_10100141 | Ga0207702_101001412 | 423 |
| 42 | 3300044684 | Ga0466966_0007478 | Ga0466966_0007478_5593_6996 | 423 |
| 43 | 3300044706 | Ga0466964_0001157 | Ga0466964_0001157_3929_5332 | 423 |
| 44 | 3300044842 | Ga0466957_0002457 | Ga0466957_0002457_986_2389 | 423 |
| 45 | 3300045049 | Ga0466959_0008983 | Ga0466959_0008983_5212_6615 | 423 |
| 46 | 3300046459 | Ga0495629_0024830 | Ga0495629_0024830_2040_3515 | 423 |
| 47 | 3300046516 | Ga0495628_0095529 | Ga0495628_0095529_784_2259 | 423 |
| 48 | 3300046679 | Ga0495623_0080470 | Ga0495623_0080470_482_1957 | 423 |
| 49 | 3300046690 | Ga0495624_0080393 | Ga0495624_0080393_266_1741 | 423 |
| 50 | 3300047317 | Ga0495604_0025792 | Ga0495604_0025792_137_1612 | 423 |
| 51 | 3300047319 | Ga0495674_0058466 | Ga0495674_0058466_1145_2620 | 423 |
| 52 | 3300047444 | Ga0495675_0038381 | Ga0495675_0038381_789_2264 | 423 |
| 53 | 3300047673 | Ga0495593_0038870 | Ga0495593_0038870_525_1910 | 423 |
| 54 | 3300046472 | Ga0495580_0016071 | Ga0495580_0016071_3845_5320 | 424 |
| 55 | 3300046457 | Ga0495590_0009596 | Ga0495590_0009596_1724_3199 | 425 |
| 56 | 3300046460 | Ga0495638_0054738 | Ga0495638_0054738_763_2238 | 425 |
| 57 | 3300046471 | Ga0495650_0039439 | Ga0495650_0039439_149_1534 | 425 |
| 58 | 3300046506 | Ga0495583_0012474 | Ga0495583_0012474_951_2426 | 425 |
| 59 | 3300046538 | Ga0495609_0019834 | Ga0495609_0019834_534_2009 | 425 |
| 60 | 3300046648 | Ga0495611_0019128 | Ga0495611_0019128_807_2192 | 425 |
| 61 | 3300046660 | Ga0495625_0099965 | Ga0495625_0099965_241_1716 | 425 |
| 62 | 3300046692 | Ga0495671_0005413 | Ga0495671_0005413_848_2323 | 425 |
| 63 | 3300047446 | Ga0495679_000102 | Ga0495679_000102_6238_7713 | 425 |
| 64 | 3300048091 | Ga0495626_0013534 | Ga0495626_0013534_538_2013 | 425 |
| 65 | 3300048905 | Ga0496102_0263983 | Ga0496102_0263983_211_1596 | 425 |
| 66 | 3300048920 | Ga0496117_0070837 | Ga0496117_0070837_518_1903 | 425 |
| 67 | 3300048921 | Ga0496118_0063179 | Ga0496118_0063179_773_2248 | 425 |
| 68 | 3300048924 | Ga0496121_0074975 | Ga0496121_0074975_478_1863 | 425 |
| 69 | 3300049459 | Ga0495678_026175 | Ga0495678_026175_374_1849 | 425 |
| 70 | 3300028379 | Ga0268266_10035234 | Ga0268266_100352342 | 426 |
| 71 | 3300046531 | Ga0495665_0050918 | Ga0495665_0050918_884_2167 | 427 |
| 72 | 3300048089 | Ga0495614_0067220 | Ga0495614_0067220_37_1320 | 427 |
| 73 | 3300021361 | Ga0213872_10000003 | Ga0213872_10000003100 | 428 |
| 74 | 3300038443 | Ga0395901_0000077 | Ga0395901_0000077_106533_107906 | 428 |
| 75 | 3300039447 | Ga0436361_1124174 | Ga0436361_1124174_14070_15416 | 428 |
| 76 | 3300005327 | Ga0070658_10156923 | Ga0070658_101569232 | 429 |
| 77 | 3300005563 | Ga0068855_100020921 | Ga0068855_1000209218 | 429 |
| 78 | 3300006871 | Ga0075434_100041481 | Ga0075434_1000414813 | 429 |
| 79 | 3300006914 | Ga0075436_100008048 | Ga0075436_1000080482 | 429 |
| 80 | 3300013104 | Ga0157370_10008261 | Ga0157370_100082612 | 429 |
| 81 | 3300025949 | Ga0207667_10097788 | Ga0207667_100977882 | 429 |
| 82 | 3300038726 | Ga0400490_17851 | Ga0400490_17851_4227_5591 | 429 |
| 83 | 3300050512 | nmdc:mga0n895_126170_c1 | nmdc:mga0n895_126170_c1_494_1864 | 429 |
| 84 | 3300050514 | nmdc:mga08x19_5866_c1 | nmdc:mga08x19_5866_c1_439_1809 | 429 |
| 85 | 3300046471 | Ga0495650_0000224 | Ga0495650_0000224_17232_18578 | 430 |
| 86 | 3300050493 | nmdc:mga0k408_24582_c1 | nmdc:mga0k408_24582_c1_430_1815 | 431 |
| 87 | 3300038735 | Ga0400485_07894 | Ga0400485_07894_1636_3000 | 433 |
| 88 | 3300038742 | Ga0400486_14851 | Ga0400486_14851_8328_9692 | 433 |
| 89 | 3300039110 | Ga0400487_01458 | Ga0400487_01458_47_1411 | 433 |
| 90 | 3300044656 | Ga0466969_0029521 | Ga0466969_0029521_329_1702 | 434 |
| 91 | 3300044684 | Ga0466966_0000084 | Ga0466966_0000084_36576_37949 | 434 |
| 92 | 3300044693 | Ga0466961_0009347 | Ga0466961_0009347_143_1516 | 434 |
| 93 | 3300044693 | Ga0466961_0031147 | Ga0466961_0031147_1997_3400 | 434 |
| 94 | 3300044694 | Ga0466963_0018644 | Ga0466963_0018644_2217_3590 | 434 |
| 95 | 3300045836 | Ga0466958_0000254 | Ga0466958_0000254_2275_3648 | 434 |
| 96 | 3300061719 | Ga0466962_0022586 | Ga0466962_0022586_244_1647 | 434 |
| 97 | 3300005563 | Ga0068855_100019484 | Ga0068855_1000194842 | 435 |
| 98 | 3300013307 | Ga0157372_10128119 | Ga0157372_101281192 | 435 |
| 99 | 3300025913 | Ga0207695_10232992 | Ga0207695_102329922 | 435 |
| 100 | 3300031548 | Ga0307408_100131321 | Ga0307408_1001313212 | 435 |
| 101 | 3300049575 | Ga0501039_0068019 | Ga0501039_0068019_258_1610 | 435 |
| 102 | 3300049583 | Ga0501067_0043438 | Ga0501067_0043438_828_2195 | 435 |
| 103 | 3300049586 | Ga0501070_0000612 | Ga0501070_0000612_27810_29177 | 435 |
| 104 | 3300049586 | Ga0501070_0175917 | Ga0501070_0175917_317_1684 | 435 |
| 105 | 3300049589 | Ga0501073_0001654 | Ga0501073_0001654_3556_4923 | 435 |
| 106 | 3300049590 | Ga0501074_0000811 | Ga0501074_0000811_14805_16172 | 435 |
| 107 | 3300049741 | Ga0501079_0030446 | Ga0501079_0030446_2235_3602 | 435 |
| 108 | 3300049742 | Ga0501080_0008750 | Ga0501080_0008750_3481_4848 | 435 |
| 109 | 3300049742 | Ga0501080_0024443 | Ga0501080_0024443_774_2141 | 435 |
| 110 | 3300049744 | Ga0501083_0002111 | Ga0501083_0002111_3880_5247 | 435 |
| 111 | 3300054114 | Ga0501084_0023535 | Ga0501084_0023535_2458_3825 | 435 |
| 112 | 3300060353 | Ga0501082_0017124 | Ga0501082_0017124_1345_2712 | 435 |
| 113 | 3300005327 | Ga0070658_10002393 | Ga0070658_1000239312 | 436 |
| 114 | 3300005547 | Ga0070693_100011277 | Ga0070693_1000112772 | 436 |
| 115 | 3300009098 | Ga0105245_10086042 | Ga0105245_100860422 | 436 |
| 116 | 3300013297 | Ga0157378_10097337 | Ga0157378_100973372 | 436 |
| 117 | 3300025909 | Ga0207705_10010151 | Ga0207705_100101511 | 436 |
| 118 | 3300039062 | Ga0400483_145565 | Ga0400483_145565_8344_9708 | 436 |
| 119 | 3300039062 | Ga0400483_268051 | Ga0400483_268051_10067_11431 | 436 |
| 120 | 3300005617 | Ga0068859_100253645 | Ga0068859_1002536452 | 437 |
| 121 | 3300005842 | Ga0068858_100082743 | Ga0068858_1000827432 | 437 |
| 122 | 3300006237 | Ga0097621_100014887 | Ga0097621_1000148872 | 437 |
| 123 | 3300006358 | Ga0068871_100160874 | Ga0068871_1001608742 | 437 |
| 124 | 3300006931 | Ga0097620_100253647 | Ga0097620_1002536472 | 437 |
| 125 | 3300009098 | Ga0105245_10164908 | Ga0105245_101649082 | 437 |
| 126 | 3300009148 | Ga0105243_10116079 | Ga0105243_101160792 | 437 |
| 127 | 3300009176 | Ga0105242_10049912 | Ga0105242_100499123 | 437 |
| 128 | 3300009177 | Ga0105248_10058954 | Ga0105248_100589542 | 437 |
| 129 | 3300013308 | Ga0157375_10023805 | Ga0157375_100238056 | 437 |
| 130 | 3300025927 | Ga0207687_10010562 | Ga0207687_100105622 | 437 |
| 131 | 3300036401 | Ga0373937_0011712 | Ga0373937_0011712_4092_5459 | 437 |
| 132 | 3300038742 | Ga0400486_00233 | Ga0400486_00233_5287_6651 | 437 |
| 133 | 3300046454 | Ga0495592_0017875 | Ga0495592_0017875_3309_4676 | 437 |
| 134 | 3300046462 | Ga0495651_0034283 | Ga0495651_0034283_953_2320 | 437 |
| 135 | 3300046463 | Ga0495653_0094116 | Ga0495653_0094116_481_1848 | 437 |
| 136 | 3300046529 | Ga0495652_0080614 | Ga0495652_0080614_783_2150 | 437 |
| 137 | 3300046536 | Ga0495587_0006632 | Ga0495587_0006632_748_2115 | 437 |
| 138 | 3300046543 | Ga0495645_0020676 | Ga0495645_0020676_448_1815 | 437 |
| 139 | 3300046559 | Ga0495667_0008494 | Ga0495667_0008494_1055_2422 | 437 |
| 140 | 3300046678 | Ga0495599_0044046 | Ga0495599_0044046_1078_2445 | 437 |
| 141 | 3300045051 | Ga0451576_0011555 | Ga0451576_0011555_4545_5894 | 438 |
| 142 | 3300009148 | Ga0105243_10026412 | Ga0105243_100264123 | 439 |
| 143 | 3300010375 | Ga0105239_10069989 | Ga0105239_100699892 | 439 |
| 144 | 3300013308 | Ga0157375_10069517 | Ga0157375_100695172 | 439 |
| 145 | 3300045051 | Ga0451576_0001615 | Ga0451576_0001615_19666_21036 | 439 |
| 146 | iso_pu_bacteria | 2891633521 | 2891634585 | 439 |
| 147 | 3300042876 | Ga0451577_0000319 | Ga0451577_0000319_21322_22674 | 440 |
| 148 | 3300042876 | Ga0451577_0023500 | Ga0451577_0023500_784_2136 | 440 |
| 149 | 3300044673 | Ga0453683_0021694 | Ga0453683_0021694_1515_2867 | 440 |
| 150 | 3300044712 | Ga0453684_0018401 | Ga0453684_0018401_3098_4450 | 440 |
| 151 | 3300045051 | Ga0451576_0005294 | Ga0451576_0005294_5157_6509 | 440 |
| 152 | 3300045051 | Ga0451576_0012005 | Ga0451576_0012005_4202_5554 | 440 |
| 153 | 3300045051 | Ga0451576_0012462 | Ga0451576_0012462_3963_5315 | 440 |
| 154 | iso_pu_bacteria | 2574179768 | 2574432049 | 440 |
| 155 | iso_pu_bacteria | 639633007 | 639787050 | 440 |
| 156 | 3300002067 | JGI24735J21928_10001265 | JGI24735J21928_100012652 | 441 |
| 157 | 3300005327 | Ga0070658_10011021 | Ga0070658_100110216 | 441 |
| 158 | 3300005339 | Ga0070660_100001298 | Ga0070660_10000129811 | 441 |
| 159 | 3300005539 | Ga0068853_100203455 | Ga0068853_1002034552 | 441 |
| 160 | 3300005563 | Ga0068855_100010957 | Ga0068855_10001095710 | 441 |
| 161 | 3300009093 | Ga0105240_10001770 | Ga0105240_1000177018 | 441 |
| 162 | 3300009545 | Ga0105237_10005766 | Ga0105237_1000576610 | 441 |
| 163 | 3300010375 | Ga0105239_10003884 | Ga0105239_1000388417 | 441 |
| 164 | 3300013100 | Ga0157373_10006985 | Ga0157373_100069854 | 441 |
| 165 | 3300013105 | Ga0157369_10000979 | Ga0157369_1000097921 | 441 |
| 166 | 3300013296 | Ga0157374_10000107 | Ga0157374_1000010724 | 441 |
| 167 | 3300013307 | Ga0157372_10002854 | Ga0157372_100028542 | 441 |
| 168 | 3300025256 | Ga0209759_1011780 | Ga0209759_10117802 | 441 |
| 169 | 3300025904 | Ga0207647_10000108 | Ga0207647_1000010811 | 441 |
| 170 | 3300025914 | Ga0207671_10008853 | Ga0207671_100088533 | 441 |
| 171 | 3300025919 | Ga0207657_10064846 | Ga0207657_100648462 | 441 |
| 172 | 3300025949 | Ga0207667_10003025 | Ga0207667_1000302510 | 441 |
| 173 | 3300026067 | Ga0207678_10001691 | Ga0207678_100016915 | 441 |
| 174 | 3300028666 | Ga0265336_10002632 | Ga0265336_100026327 | 441 |
| 175 | 3300029957 | Ga0265324_10000005 | Ga0265324_10000005187 | 441 |
| 176 | 3300029957 | Ga0265324_10000205 | Ga0265324_1000020520 | 441 |
| 177 | 3300029957 | Ga0265324_10014450 | Ga0265324_100144502 | 441 |
| 178 | 3300031241 | Ga0265325_10000314 | Ga0265325_100003149 | 441 |
| 179 | 3300031250 | Ga0265331_10013109 | Ga0265331_100131094 | 441 |
| 180 | 3300031250 | Ga0265331_10017844 | Ga0265331_100178442 | 441 |
| 181 | 3300031251 | Ga0265327_10001032 | Ga0265327_1000103211 | 441 |
| 182 | 3300031344 | Ga0265316_10108626 | Ga0265316_101086262 | 441 |
| 183 | 3300031711 | Ga0265314_10000740 | Ga0265314_1000074029 | 441 |
| 184 | 3300032133 | Ga0316583_10013376 | Ga0316583_100133762 | 441 |
| 185 | 3300035172 | Ga0373955_0042294 | Ga0373955_0042294_165_1532 | 441 |
| 186 | 3300036401 | Ga0373937_0090607 | Ga0373937_0090607_809_2176 | 441 |
| 187 | 3300042005 | Ga0439448_0004190 | Ga0439448_0004190_949_2325 | 441 |
| 188 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_311073_312428 | 441 |
| 189 | 3300042876 | Ga0451577_0117675 | Ga0451577_0117675_723_2111 | 441 |
| 190 | 3300044673 | Ga0453683_0000003 | Ga0453683_0000003_311073_312428 | 441 |
| 191 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_1418948_1420303 | 441 |
| 192 | 3300044712 | Ga0453684_0000075 | Ga0453684_0000075_206606_207961 | 441 |
| 193 | 3300044712 | Ga0453684_0053791 | Ga0453684_0053791_2999_4387 | 441 |
| 194 | 3300045051 | Ga0451576_0000004 | Ga0451576_0000004_1045588_1046943 | 441 |
| 195 | 3300045051 | Ga0451576_0000029 | Ga0451576_0000029_287246_288601 | 441 |
| 196 | 3300046507 | Ga0495606_0145331 | Ga0495606_0145331_53_1381 | 441 |
| 197 | 3300046535 | Ga0495586_0056560 | Ga0495586_0056560_591_1958 | 441 |
| 198 | 3300047471 | Ga0495684_0081603 | Ga0495684_0081603_248_1615 | 441 |
| 199 | 3300049579 | Ga0501043_0000141 | Ga0501043_0000141_9701_11068 | 441 |
| 200 | 3300049580 | Ga0501046_0000047 | Ga0501046_0000047_49704_51071 | 441 |
| 201 | 3300049581 | Ga0501047_0000058 | Ga0501047_0000058_89676_91043 | 441 |
| 202 | 3300049582 | Ga0501048_0000475 | Ga0501048_0000475_21518_22885 | 441 |
| 203 | 3300049776 | Ga0501280_000375 | Ga0501280_000375_8795_10153 | 441 |
| 204 | 3300049824 | Ga0501045_0015906 | Ga0501045_0015906_191_1558 | 441 |
| 205 | 3300050493 | nmdc:mga0k408_380_c2 | nmdc:mga0k408_380_c2_10165_11532 | 441 |
| 206 | iso_pu_bacteria | 2526164512 | 2526213521 | 441 |
| 207 | 3300005334 | Ga0068869_100025411 | Ga0068869_1000254113 | 442 |
| 208 | 3300006195 | Ga0075366_10003539 | Ga0075366_100035392 | 442 |
| 209 | 3300013297 | Ga0157378_10063541 | Ga0157378_100635412 | 442 |
| 210 | 3300014969 | Ga0157376_10151166 | Ga0157376_101511662 | 442 |
| 211 | 3300026035 | Ga0207703_10030879 | Ga0207703_100308792 | 442 |
| 212 | 3300031548 | Ga0307408_100167561 | Ga0307408_1001675612 | 442 |
| 213 | 3300046530 | Ga0495654_0000428 | Ga0495654_0000428_17052_18434 | 442 |
| 214 | 3300046539 | Ga0495621_0003224 | Ga0495621_0003224_2535_3893 | 442 |
| 215 | 3300046539 | Ga0495621_0010869 | Ga0495621_0010869_763_2127 | 442 |
| 216 | 3300046543 | Ga0495645_0089437 | Ga0495645_0089437_44_1414 | 442 |
| 217 | iso_pu_bacteria | 2734482258 | 2735818237 | 442 |
| 218 | 3300006186 | Ga0075369_10002482 | Ga0075369_100024823 | 443 |
| 219 | 3300006358 | Ga0068871_100048150 | Ga0068871_1000481502 | 443 |
| 220 | 3300025228 | Ga0209672_100433 | Ga0209672_10043310 | 443 |
| 221 | 3300032168 | Ga0316593_10000190 | Ga0316593_100001908 | 443 |
| 222 | 3300038725 | Ga0400484_29948 | Ga0400484_29948_294_1658 | 443 |
| 223 | 3300038725 | Ga0400484_43627 | Ga0400484_43627_4439_5803 | 443 |
| 224 | 3300038741 | Ga0400488_33004 | Ga0400488_33004_4817_6181 | 443 |
| 225 | 3300038741 | Ga0400488_38891 | Ga0400488_38891_13229_14593 | 443 |
| 226 | 3300039062 | Ga0400483_108358 | Ga0400483_108358_5385_6749 | 443 |
| 227 | 3300039062 | Ga0400483_121666 | Ga0400483_121666_12693_14057 | 443 |
| 228 | 3300039062 | Ga0400483_192031 | Ga0400483_192031_1244_2608 | 443 |
| 229 | 3300039062 | Ga0400483_241642 | Ga0400483_241642_9505_10869 | 443 |
| 230 | 3300039110 | Ga0400487_24806 | Ga0400487_24806_23884_25248 | 443 |
| 231 | 3300045051 | Ga0451576_0000250 | Ga0451576_0000250_73986_75347 | 443 |
| 232 | 3300005289 | Ga0065704_10127221 | Ga0065704_101272212 | 444 |
| 233 | 3300005327 | Ga0070658_10059779 | Ga0070658_100597792 | 444 |
| 234 | 3300005329 | Ga0070683_100070791 | Ga0070683_1000707913 | 444 |
| 235 | 3300005331 | Ga0070670_100006956 | Ga0070670_1000069564 | 444 |
| 236 | 3300005333 | Ga0070677_10015794 | Ga0070677_100157942 | 444 |
| 237 | 3300005334 | Ga0068869_100003904 | Ga0068869_1000039047 | 444 |
| 238 | 3300005335 | Ga0070666_10052439 | Ga0070666_100524391 | 444 |
| 239 | 3300005338 | Ga0068868_100035264 | Ga0068868_1000352642 | 444 |
| 240 | 3300005344 | Ga0070661_100029621 | Ga0070661_1000296212 | 444 |
| 241 | 3300005354 | Ga0070675_100021815 | Ga0070675_1000218152 | 444 |
| 242 | 3300005354 | Ga0070675_100044998 | Ga0070675_1000449983 | 444 |
| 243 | 3300005355 | Ga0070671_100027234 | Ga0070671_1000272342 | 444 |
| 244 | 3300005364 | Ga0070673_100005910 | Ga0070673_1000059102 | 444 |
| 245 | 3300005364 | Ga0070673_100025823 | Ga0070673_1000258232 | 444 |
| 246 | 3300005367 | Ga0070667_100148267 | Ga0070667_1001482672 | 444 |
| 247 | 3300005456 | Ga0070678_100008537 | Ga0070678_1000085374 | 444 |
| 248 | 3300005459 | Ga0068867_100151413 | Ga0068867_1001514132 | 444 |
| 249 | 3300005543 | Ga0070672_100010363 | Ga0070672_1000103635 | 444 |
| 250 | 3300005547 | Ga0070693_100047823 | Ga0070693_1000478231 | 444 |
| 251 | 3300005548 | Ga0070665_100054800 | Ga0070665_1000548002 | 444 |
| 252 | 3300005548 | Ga0070665_100099519 | Ga0070665_1000995192 | 444 |
| 253 | 3300005564 | Ga0070664_100049898 | Ga0070664_1000498982 | 444 |
| 254 | 3300005578 | Ga0068854_100078468 | Ga0068854_1000784682 | 444 |
| 255 | 3300005616 | Ga0068852_100005797 | Ga0068852_1000057973 | 444 |
| 256 | 3300005718 | Ga0068866_10059311 | Ga0068866_100593112 | 444 |
| 257 | 3300005834 | Ga0068851_10020503 | Ga0068851_100205032 | 444 |
| 258 | 3300005840 | Ga0068870_10052284 | Ga0068870_100522842 | 444 |
| 259 | 3300005840 | Ga0068870_10061437 | Ga0068870_100614372 | 444 |
| 260 | 3300005841 | Ga0068863_100030839 | Ga0068863_1000308393 | 444 |
| 261 | 3300005841 | Ga0068863_100073057 | Ga0068863_1000730572 | 444 |
| 262 | 3300005842 | Ga0068858_100032267 | Ga0068858_1000322672 | 444 |
| 263 | 3300005844 | Ga0068862_100039651 | Ga0068862_1000396512 | 444 |
| 264 | 3300006237 | Ga0097621_100003683 | Ga0097621_1000036838 | 444 |
| 265 | 3300006358 | Ga0068871_100016562 | Ga0068871_1000165622 | 444 |
| 266 | 3300006358 | Ga0068871_100019776 | Ga0068871_1000197762 | 444 |
| 267 | 3300006844 | Ga0075428_100000245 | Ga0075428_10000024521 | 444 |
| 268 | 3300006846 | Ga0075430_100020343 | Ga0075430_1000203436 | 444 |
| 269 | 3300006846 | Ga0075430_100056022 | Ga0075430_1000560222 | 444 |
| 270 | 3300006847 | Ga0075431_100003069 | Ga0075431_10000306910 | 444 |
| 271 | 3300006847 | Ga0075431_100034097 | Ga0075431_1000340972 | 444 |
| 272 | 3300006880 | Ga0075429_100008747 | Ga0075429_1000087474 | 444 |
| 273 | 3300007265 | Ga0099794_10053454 | Ga0099794_100534541 | 444 |
| 274 | 3300009094 | Ga0111539_10000383 | Ga0111539_100003839 | 444 |
| 275 | 3300009094 | Ga0111539_10080582 | Ga0111539_100805822 | 444 |
| 276 | 3300009148 | Ga0105243_10000770 | Ga0105243_100007706 | 444 |
| 277 | 3300009177 | Ga0105248_10002407 | Ga0105248_1000240714 | 444 |
| 278 | 3300009177 | Ga0105248_10137513 | Ga0105248_101375132 | 444 |
| 279 | 3300009553 | Ga0105249_10144621 | Ga0105249_101446212 | 444 |
| 280 | 3300013296 | Ga0157374_10127586 | Ga0157374_101275862 | 444 |
| 281 | 3300013297 | Ga0157378_10169632 | Ga0157378_101696322 | 444 |
| 282 | 3300013308 | Ga0157375_10173663 | Ga0157375_101736632 | 444 |
| 283 | 3300014326 | Ga0157380_10210633 | Ga0157380_102106331 | 444 |
| 284 | 3300014969 | Ga0157376_10011903 | Ga0157376_100119032 | 444 |
| 285 | 3300014969 | Ga0157376_10040685 | Ga0157376_100406852 | 444 |
| 286 | 3300025893 | Ga0207682_10020088 | Ga0207682_100200882 | 444 |
| 287 | 3300025908 | Ga0207643_10018307 | Ga0207643_100183072 | 444 |
| 288 | 3300025908 | Ga0207643_10084818 | Ga0207643_100848182 | 444 |
| 289 | 3300025918 | Ga0207662_10036199 | Ga0207662_100361992 | 444 |
| 290 | 3300025920 | Ga0207649_10022174 | Ga0207649_100221742 | 444 |
| 291 | 3300025925 | Ga0207650_10023575 | Ga0207650_100235753 | 444 |
| 292 | 3300025931 | Ga0207644_10017931 | Ga0207644_100179314 | 444 |
| 293 | 3300025935 | Ga0207709_10005524 | Ga0207709_100055242 | 444 |
| 294 | 3300025940 | Ga0207691_10007106 | Ga0207691_100071068 | 444 |
| 295 | 3300025942 | Ga0207689_10000974 | Ga0207689_1000097422 | 444 |
| 296 | 3300025960 | Ga0207651_10019003 | Ga0207651_100190032 | 444 |
| 297 | 3300025960 | Ga0207651_10040384 | Ga0207651_100403842 | 444 |
| 298 | 3300025981 | Ga0207640_10064246 | Ga0207640_100642462 | 444 |
| 299 | 3300026035 | Ga0207703_10057411 | Ga0207703_100574112 | 444 |
| 300 | 3300026088 | Ga0207641_10068358 | Ga0207641_100683582 | 444 |
| 301 | 3300026089 | Ga0207648_10000142 | Ga0207648_1000014227 | 444 |
| 302 | 3300026095 | Ga0207676_10104768 | Ga0207676_101047682 | 444 |
| 303 | 3300026121 | Ga0207683_10003576 | Ga0207683_100035769 | 444 |
| 304 | 3300026121 | Ga0207683_10187256 | Ga0207683_101872562 | 444 |
| 305 | 3300026142 | Ga0207698_10049953 | Ga0207698_100499532 | 444 |
| 306 | 3300027378 | Ga0209981_1002317 | Ga0209981_10023172 | 444 |
| 307 | 3300027876 | Ga0209974_10006559 | Ga0209974_100065593 | 444 |
| 308 | 3300027907 | Ga0207428_10005311 | Ga0207428_1000531111 | 444 |
| 309 | 3300028379 | Ga0268266_10020285 | Ga0268266_100202855 | 444 |
| 310 | 3300028379 | Ga0268266_10185285 | Ga0268266_101852852 | 444 |
| 311 | 3300037471 | Ga0395905_0028009 | Ga0395905_0028009_2814_4199 | 444 |
| 312 | 3300039062 | Ga0400483_179405 | Ga0400483_179405_473_1843 | 444 |
| 313 | 3300042876 | Ga0451577_0045119 | Ga0451577_0045119_2206_3570 | 444 |
| 314 | 3300044712 | Ga0453684_0012407 | Ga0453684_0012407_4069_5433 | 444 |
| 315 | 3300045051 | Ga0451576_0038365 | Ga0451576_0038365_3070_4446 | 444 |
| 316 | 3300046675 | Ga0495657_0060592 | Ga0495657_0060592_746_2110 | 444 |
| 317 | 3300048907 | Ga0496104_0187250 | Ga0496104_0187250_272_1636 | 444 |
| 318 | 3300048909 | Ga0496106_0059256 | Ga0496106_0059256_342_1706 | 444 |
| 319 | 3300048910 | Ga0496107_0116147 | Ga0496107_0116147_331_1695 | 444 |
| 320 | 3300048912 | Ga0496109_0214428 | Ga0496109_0214428_185_1549 | 444 |
| 321 | 3300048913 | Ga0496110_0032191 | Ga0496110_0032191_1965_3329 | 444 |
| 322 | 3300048914 | Ga0496111_0082732 | Ga0496111_0082732_431_1795 | 444 |
| 323 | 3300048917 | Ga0496114_0290531 | Ga0496114_0290531_29_1393 | 444 |
| 324 | 3300049575 | Ga0501039_0030275 | Ga0501039_0030275_1717_3081 | 444 |
| 325 | 3300049575 | Ga0501039_0158298 | Ga0501039_0158298_115_1464 | 444 |
| 326 | 3300049578 | Ga0501042_0198529 | Ga0501042_0198529_70_1434 | 444 |
| 327 | 3300049587 | Ga0501071_0056146 | Ga0501071_0056146_1235_2599 | 444 |
| 328 | 3300049592 | Ga0501076_0026193 | Ga0501076_0026193_1162_2526 | 444 |
| 329 | 3300049742 | Ga0501080_0032837 | Ga0501080_0032837_2967_4331 | 444 |
| 330 | 3300050508 | nmdc:mga09592_1274_c1 | nmdc:mga09592_1274_c1_8680_10050 | 444 |
| 331 | 3300050509 | nmdc:mga0qj67_81220_c1 | nmdc:mga0qj67_81220_c1_647_2011 | 444 |
| 332 | 3300050510 | nmdc:mga06r32_18433_c1 | nmdc:mga06r32_18433_c1_2840_4204 | 444 |
| 333 | 3300050510 | nmdc:mga06r32_28961_c1 | nmdc:mga06r32_28961_c1_1503_2867 | 444 |
| 334 | 3300050511 | nmdc:mga08y16_65551_c1 | nmdc:mga08y16_65551_c1_1993_3357 | 444 |
| 335 | 3300053177 | Ga0500636_0000185 | Ga0500636_0000185_564_1928 | 444 |
| 336 | 3300053729 | Ga0500625_002765 | Ga0500625_002765_906_2270 | 444 |
| 337 | 3300054114 | Ga0501084_0229158 | Ga0501084_0229158_61_1425 | 444 |
| 338 | iso_pu_bacteria | 2721755763 | 2723877468 | 444 |
| 339 | 3300005458 | Ga0070681_10016840 | Ga0070681_100168402 | 445 |
| 340 | 3300025912 | Ga0207707_10145180 | Ga0207707_101451802 | 445 |
| 341 | 3300037418 | Ga0395900_0027856 | Ga0395900_0027856_3025_4398 | 445 |
| 342 | 3300038443 | Ga0395901_0000923 | Ga0395901_0000923_20117_21490 | 445 |
| 343 | 3300046557 | Ga0495622_0001676 | Ga0495622_0001676_806_2200 | 445 |
| 344 | 3300049586 | Ga0501070_0003856 | Ga0501070_0003856_7270_8643 | 445 |
| 345 | 3300049590 | Ga0501074_0001507 | Ga0501074_0001507_11168_12541 | 445 |
| 346 | 3300049742 | Ga0501080_0114349 | Ga0501080_0114349_353_1726 | 445 |
| 347 | iso_pu_bacteria | 2501025501 | 2501070247 | 451 |
| 348 | iso_pu_bacteria | 2515154123 | 2515689942 | 451 |
| 349 | iso_pu_bacteria | 2883087390 | 2883092935 | 451 |
| 350 | iso_pu_bacteria | 8020938398 | 8020945032 | 451 |
| 351 | iso_pu_bacteria | 8020953355 | 8020956931 | 451 |
| 352 | iso_pu_bacteria | 2519103095 | 2519459056 | 452 |
| 353 | iso_pu_bacteria | 2582581311 | 2585291426 | 452 |
| 354 | iso_pu_bacteria | 2599185239 | 2599736660 | 452 |
| 355 | iso_pu_bacteria | 2599185240 | 2599744714 | 452 |
| 356 | iso_pu_bacteria | 2599185355 | 2600205925 | 452 |
| 357 | iso_pu_bacteria | 2675903129 | 2676742841 | 452 |
| 358 | iso_pu_bacteria | 2791355137 | 2792835945 | 452 |
| 359 | iso_pu_bacteria | 2816332253 | 2817261346 | 452 |
| 360 | iso_pu_bacteria | 2816332256 | 2817279023 | 452 |
| 361 | iso_pu_bacteria | 2816332286 | 2817451253 | 452 |
| 362 | iso_pu_bacteria | 2818991452 | 2819631144 | 452 |
| 363 | iso_pu_bacteria | 2856287931 | 2856290452 | 452 |
| 364 | iso_pu_bacteria | 2857357740 | 2857363329 | 452 |
| 365 | iso_pu_bacteria | 2863421361 | 2863424754 | 452 |
| 366 | iso_pu_bacteria | 2870068957 | 2870070990 | 452 |
| 367 | iso_pu_bacteria | 2904564687 | 2904570983 | 452 |
| 368 | iso_pu_bacteria | 2904571731 | 2904575967 | 452 |
| 369 | iso_pu_bacteria | 2928157003 | 2928160055 | 452 |
| 370 | iso_pu_bacteria | 2928163908 | 2928168494 | 452 |
| 371 | iso_pu_bacteria | 2928170801 | 2928171738 | 452 |
| 372 | iso_pu_bacteria | 2928536128 | 2928539894 | 452 |
| 373 | iso_pu_bacteria | 2981990288 | 2981994791 | 452 |
| 374 | iso_pu_bacteria | 641736154 | 642416875 | 452 |
| 375 | iso_pu_bacteria | 8018845410 | 8018851378 | 452 |
| 376 | iso_pu_bacteria | 8020807995 | 8020810190 | 452 |
| 377 | iso_pu_bacteria | 8020945358 | 8020951710 | 452 |
| 378 | iso_pu_bacteria | 8021120328 | 8021122215 | 452 |
| 379 | iso_pu_bacteria | 8039098773 | 8039102540 | 452 |
| 380 | iso_pu_bacteria | 8040167225 | 8040168805 | 452 |
| 381 | iso_pu_bacteria | 8040173305 | 8040174731 | 452 |
| 382 | iso_pu_bacteria | 2808606384 | 2808972397 | 453 |
| 383 | iso_pu_bacteria | 2808606390 | 2809007226 | 453 |
| 384 | iso_pu_bacteria | 2808606391 | 2809014364 | 453 |
| 385 | 3300013102 | Ga0157371_10007279 | Ga0157371_100072797 | 454 |
| 386 | 3300013104 | Ga0157370_10007952 | Ga0157370_100079521 | 454 |
| 387 | 3300013105 | Ga0157369_10000511 | Ga0157369_1000051117 | 454 |
| 388 | 3300013105 | Ga0157369_10002197 | Ga0157369_100021973 | 454 |
| 389 | 3300025909 | Ga0207705_10001472 | Ga0207705_1000147218 | 454 |
| 390 | 3300025949 | Ga0207667_10002397 | Ga0207667_1000239713 | 454 |
| 391 | 3300028800 | Ga0265338_10000741 | Ga0265338_1000074122 | 454 |
| 392 | 3300037312 | Ga0395899_0000007 | Ga0395899_0000007_357872_359356 | 454 |
| 393 | 3300037418 | Ga0395900_0000026 | Ga0395900_0000026_42213_43697 | 454 |
| 394 | 3300037418 | Ga0395900_0044477 | Ga0395900_0044477_613_1986 | 454 |
| 395 | 3300037466 | Ga0395898_0000497 | Ga0395898_0000497_47680_49164 | 454 |
| 396 | 3300037466 | Ga0395898_0001748 | Ga0395898_0001748_17289_18662 | 454 |
| 397 | 3300038443 | Ga0395901_0000296 | Ga0395901_0000296_56206_57579 | 454 |
| 398 | 3300038443 | Ga0395901_0019691 | Ga0395901_0019691_1989_3362 | 454 |
| 399 | 3300044656 | Ga0466969_0000297 | Ga0466969_0000297_15413_16894 | 454 |
| 400 | 3300044666 | Ga0466977_0001674 | Ga0466977_0001674_720_2120 | 454 |
| 401 | 3300044683 | Ga0466965_0001551 | Ga0466965_0001551_740_2113 | 454 |
| 402 | 3300044684 | Ga0466966_0024377 | Ga0466966_0024377_738_2111 | 454 |
| 403 | 3300044693 | Ga0466961_0000567 | Ga0466961_0000567_20370_21743 | 454 |
| 404 | 3300044694 | Ga0466963_0001538 | Ga0466963_0001538_7392_8765 | 454 |
| 405 | 3300044719 | Ga0466971_0001519 | Ga0466971_0001519_5184_6557 | 454 |
| 406 | 3300044842 | Ga0466957_0005149 | Ga0466957_0005149_5567_6940 | 454 |
| 407 | 3300044842 | Ga0466957_0032769 | Ga0466957_0032769_1456_2829 | 454 |
| 408 | 3300045049 | Ga0466959_0003739 | Ga0466959_0003739_7381_8862 | 454 |
| 409 | 3300045049 | Ga0466959_0021302 | Ga0466959_0021302_1152_2525 | 454 |
| 410 | 3300045836 | Ga0466958_0000731 | Ga0466958_0000731_2036_3517 | 454 |
| 411 | 3300061719 | Ga0466962_0000537 | Ga0466962_0000537_1831_3204 | 454 |
| 412 | 3300061719 | Ga0466962_0000675 | Ga0466962_0000675_2505_3878 | 454 |
| 413 | 3300039437 | Ga0436365_1054781 | Ga0436365_1054781_271_1641 | 455 |
| 414 | 3300044656 | Ga0466969_0014342 | Ga0466969_0014342_596_1972 | 455 |
| 415 | 3300044684 | Ga0466966_0009017 | Ga0466966_0009017_2194_3570 | 455 |
| 416 | 3300044693 | Ga0466961_0076667 | Ga0466961_0076667_622_1992 | 455 |
| 417 | 3300044735 | Ga0466968_0059491 | Ga0466968_0059491_136_1506 | 455 |
| 418 | 3300044765 | Ga0466970_0019669 | Ga0466970_0019669_1390_2766 | 455 |
| 419 | 3300044765 | Ga0466970_0064372 | Ga0466970_0064372_445_1815 | 455 |
| 420 | 3300045049 | Ga0466959_0000802 | Ga0466959_0000802_1978_3354 | 455 |
| 421 | iso_pu_bacteria | 2600255067 | 2600809460 | 455 |
| 422 | 3300003758 | Ga0055532_1003986 | Ga0055532_10039862 | 456 |
| 423 | 3300003760 | Ga0055527_1001753 | Ga0055527_10017531 | 456 |
| 424 | 3300003760 | Ga0055527_1001754 | Ga0055527_10017541 | 456 |
| 425 | 3300003761 | Ga0055535_1003659 | Ga0055535_10036591 | 456 |
| 426 | 3300003761 | Ga0055535_1003660 | Ga0055535_10036601 | 456 |
| 427 | 3300003762 | Ga0055542_1003532 | Ga0055542_10035321 | 456 |
| 428 | 3300003762 | Ga0055542_1003533 | Ga0055542_10035331 | 456 |
| 429 | 3300003763 | Ga0055529_1001476 | Ga0055529_10014767 | 456 |
| 430 | 3300003841 | Ga0055541_1007513 | Ga0055541_10075132 | 456 |
| 431 | 3300005339 | Ga0070660_100000504 | Ga0070660_10000050413 | 456 |
| 432 | 3300005366 | Ga0070659_100000096 | Ga0070659_10000009656 | 456 |
| 433 | 3300005455 | Ga0070663_100002692 | Ga0070663_1000026923 | 456 |
| 434 | 3300005563 | Ga0068855_100148799 | Ga0068855_1001487992 | 456 |
| 435 | 3300009551 | Ga0105238_10001068 | Ga0105238_100010686 | 456 |
| 436 | 3300010375 | Ga0105239_10002463 | Ga0105239_1000246317 | 456 |
| 437 | 3300013100 | Ga0157373_10083475 | Ga0157373_100834751 | 456 |
| 438 | 3300013104 | Ga0157370_10157383 | Ga0157370_101573832 | 456 |
| 439 | 3300013306 | Ga0163162_10006481 | Ga0163162_1000648110 | 456 |
| 440 | 3300013307 | Ga0157372_10415704 | Ga0157372_104157041 | 456 |
| 441 | 3300013308 | Ga0157375_10028549 | Ga0157375_100285495 | 456 |
| 442 | 3300015261 | Ga0182006_1033937 | Ga0182006_10339372 | 456 |
| 443 | 3300015262 | Ga0182007_10031403 | Ga0182007_100314032 | 456 |
| 444 | 3300015265 | Ga0182005_1020509 | Ga0182005_10205092 | 456 |
| 445 | 3300025225 | Ga0209566_100559 | Ga0209566_10055911 | 456 |
| 446 | 3300025228 | Ga0209672_100014 | Ga0209672_100014186 | 456 |
| 447 | 3300025228 | Ga0209672_100023 | Ga0209672_100023221 | 456 |
| 448 | 3300025229 | Ga0209147_100094 | Ga0209147_100094121 | 456 |
| 449 | 3300025229 | Ga0209147_100104 | Ga0209147_10010495 | 456 |
| 450 | 3300025229 | Ga0209147_101808 | Ga0209147_1018082 | 456 |
| 451 | 3300025242 | Ga0209258_100040 | Ga0209258_100040319 | 456 |
| 452 | 3300025242 | Ga0209258_100142 | Ga0209258_100142110 | 456 |
| 453 | 3300025254 | Ga0209148_1000035 | Ga0209148_1000035319 | 456 |
| 454 | 3300025272 | Ga0209455_1000072 | Ga0209455_1000072133 | 456 |
| 455 | 3300025295 | Ga0209564_1004868 | Ga0209564_10048686 | 456 |
| 456 | 3300025904 | Ga0207647_10000498 | Ga0207647_1000049821 | 456 |
| 457 | 3300025913 | Ga0207695_10026800 | Ga0207695_100268002 | 456 |
| 458 | 3300025919 | Ga0207657_10000004 | Ga0207657_1000000472 | 456 |
| 459 | 3300025932 | Ga0207690_10000015 | Ga0207690_10000015221 | 456 |
| 460 | 3300025949 | Ga0207667_10005390 | Ga0207667_100053902 | 456 |
| 461 | 3300025986 | Ga0207658_10066305 | Ga0207658_100663052 | 456 |
| 462 | 3300026067 | Ga0207678_10002079 | Ga0207678_1000207911 | 456 |
| 463 | 3300027312 | Ga0209371_1000079 | Ga0209371_100007968 | 456 |
| 464 | 3300028800 | Ga0265338_10000028 | Ga0265338_10000028110 | 456 |
| 465 | 3300030500 | Ga0268256_1000090 | Ga0268256_100009071 | 456 |
| 466 | 3300044684 | Ga0466966_0069537 | Ga0466966_0069537_247_1617 | 456 |
| 467 | 3300044842 | Ga0466957_0071889 | Ga0466957_0071889_616_1989 | 456 |
| 468 | 3300046455 | Ga0495603_0004961 | Ga0495603_0004961_5430_6803 | 456 |
| 469 | 3300046460 | Ga0495638_0002053 | Ga0495638_0002053_6272_7645 | 456 |
| 470 | 3300046471 | Ga0495650_0003457 | Ga0495650_0003457_4512_5885 | 456 |
| 471 | 3300046471 | Ga0495650_0034042 | Ga0495650_0034042_86_1459 | 456 |
| 472 | 3300046474 | Ga0495605_0039456 | Ga0495605_0039456_416_1789 | 456 |
| 473 | 3300046477 | Ga0495664_0099369 | Ga0495664_0099369_171_1544 | 456 |
| 474 | 3300046491 | Ga0495584_0053090 | Ga0495584_0053090_478_1851 | 456 |
| 475 | 3300046501 | Ga0495607_0031805 | Ga0495607_0031805_26_1399 | 456 |
| 476 | 3300046507 | Ga0495606_0015445 | Ga0495606_0015445_314_1687 | 456 |
| 477 | 3300046535 | Ga0495586_0111805 | Ga0495586_0111805_54_1427 | 456 |
| 478 | 3300046543 | Ga0495645_0004194 | Ga0495645_0004194_2595_3968 | 456 |
| 479 | 3300046543 | Ga0495645_0013820 | Ga0495645_0013820_1060_2433 | 456 |
| 480 | 3300046684 | Ga0495669_0006587 | Ga0495669_0006587_746_2119 | 456 |
| 481 | 3300046691 | Ga0495670_0003239 | Ga0495670_0003239_187_1560 | 456 |
| 482 | 3300046692 | Ga0495671_0020374 | Ga0495671_0020374_250_1623 | 456 |
| 483 | 3300046694 | Ga0495649_0035118 | Ga0495649_0035118_490_1863 | 456 |
| 484 | 3300046794 | Ga0495589_0006457 | Ga0495589_0006457_24_1397 | 456 |
| 485 | 3300046809 | Ga0495600_0080517 | Ga0495600_0080517_586_1959 | 456 |
| 486 | 3300047315 | Ga0495581_0036259 | Ga0495581_0036259_977_2350 | 456 |
| 487 | 3300047443 | Ga0495687_001154 | Ga0495687_001154_5433_6815 | 456 |
| 488 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_784463_785848 | 456 |
| 489 | 3300047673 | Ga0495593_0030003 | Ga0495593_0030003_1510_2883 | 456 |
| 490 | 3300048089 | Ga0495614_0037940 | Ga0495614_0037940_248_1621 | 456 |
| 491 | 3300048903 | Ga0496100_0058050 | Ga0496100_0058050_476_1849 | 456 |
| 492 | 3300048904 | Ga0496101_0201261 | Ga0496101_0201261_62_1435 | 456 |
| 493 | 3300048908 | Ga0496105_0138088 | Ga0496105_0138088_481_1854 | 456 |
| 494 | 3300048909 | Ga0496106_0027324 | Ga0496106_0027324_2371_3744 | 456 |
| 495 | 3300048914 | Ga0496111_0082443 | Ga0496111_0082443_88_1461 | 456 |
| 496 | 3300048917 | Ga0496114_0009017 | Ga0496114_0009017_2463_3836 | 456 |
| 497 | 3300048918 | Ga0496115_0034553 | Ga0496115_0034553_757_2130 | 456 |
| 498 | 3300048920 | Ga0496117_0005730 | Ga0496117_0005730_11095_12483 | 456 |
| 499 | 3300048921 | Ga0496118_0001989 | Ga0496118_0001989_11796_13241 | 456 |
| 500 | 3300048924 | Ga0496121_0099771 | Ga0496121_0099771_698_2086 | 456 |
| 501 | 3300048929 | Ga0496126_0002042 | Ga0496126_0002042_15927_17372 | 456 |
| 502 | 3300048986 | Ga0466983_0196272 | Ga0466983_0196272_129_1499 | 456 |
| 503 | 3300061719 | Ga0466962_0032196 | Ga0466962_0032196_322_1692 | 456 |
| 504 | iso_pu_bacteria | 2904434214 | 2904438564 | 456 |
| 505 | 3300013105 | Ga0157369_10091577 | Ga0157369_100915773 | 457 |
| 506 | 3300046462 | Ga0495651_0091675 | Ga0495651_0091675_770_2245 | 457 |
| 507 | 3300046471 | Ga0495650_0037541 | Ga0495650_0037541_316_1701 | 457 |
| 508 | 3300053125 | Ga0500618_000976 | Ga0500618_000976_5257_6648 | 457 |
| 509 | 3300002067 | JGI24735J21928_10000873 | JGI24735J21928_100008736 | 460 |
| 510 | 3300009011 | Ga0105251_10001119 | Ga0105251_1000111912 | 460 |
| 511 | 3300013296 | Ga0157374_10031938 | Ga0157374_100319383 | 460 |
| 512 | 3300025735 | Ga0207713_1002241 | Ga0207713_100224110 | 460 |
| 513 | 3300025904 | Ga0207647_10036364 | Ga0207647_100363642 | 460 |
| 514 | 3300045976 | Ga0466967_0186318 | Ga0466967_0186318_359_1741 | 460 |
| 515 | 3300046477 | Ga0495664_0060004 | Ga0495664_0060004_456_1838 | 460 |
| 516 | 3300046542 | Ga0495597_0004490 | Ga0495597_0004490_5931_7313 | 460 |
| 517 | 3300046543 | Ga0495645_0081925 | Ga0495645_0081925_456_1838 | 460 |
| 518 | 3300046663 | Ga0495635_0118106 | Ga0495635_0118106_170_1552 | 460 |
| 519 | 3300046684 | Ga0495669_0032792 | Ga0495669_0032792_128_1510 | 460 |
| 520 | 3300046690 | Ga0495624_0040024 | Ga0495624_0040024_698_2080 | 460 |
| 521 | 3300047322 | Ga0495680_0033291 | Ga0495680_0033291_87_1469 | 460 |
| 522 | 3300047322 | Ga0495680_0095292 | Ga0495680_0095292_68_1450 | 460 |
| 523 | 3300047323 | Ga0495683_0005181 | Ga0495683_0005181_4014_5396 | 460 |
| 524 | 3300047444 | Ga0495675_0090023 | Ga0495675_0090023_486_1868 | 460 |
| 525 | 3300047673 | Ga0495593_0046238 | Ga0495593_0046238_854_2236 | 460 |
| 526 | 3300048903 | Ga0496100_0003455 | Ga0496100_0003455_155_1537 | 460 |
| 527 | 3300048904 | Ga0496101_0003813 | Ga0496101_0003813_155_1537 | 460 |
| 528 | 3300048905 | Ga0496102_0003091 | Ga0496102_0003091_4411_5793 | 460 |
| 529 | 3300048906 | Ga0496103_0001420 | Ga0496103_0001420_4270_5652 | 460 |
| 530 | 3300048909 | Ga0496106_0001077 | Ga0496106_0001077_9129_10511 | 460 |
| 531 | 3300048912 | Ga0496109_0126523 | Ga0496109_0126523_526_1908 | 460 |
| 532 | 3300048913 | Ga0496110_0000457 | Ga0496110_0000457_4808_6190 | 460 |
| 533 | 3300048914 | Ga0496111_0009434 | Ga0496111_0009434_2048_3430 | 460 |
| 534 | 3300048915 | Ga0496112_0010133 | Ga0496112_0010133_3310_4692 | 460 |
| 535 | 3300048916 | Ga0496113_0001720 | Ga0496113_0001720_485_1867 | 460 |
| 536 | 3300048919 | Ga0496116_0039696 | Ga0496116_0039696_582_1964 | 460 |
| 537 | 3300048920 | Ga0496117_0012388 | Ga0496117_0012388_2227_3609 | 460 |
| 538 | 3300048921 | Ga0496118_0005512 | Ga0496118_0005512_9346_10728 | 460 |
| 539 | 3300048924 | Ga0496121_0003420 | Ga0496121_0003420_10569_11951 | 460 |
| 540 | 3300048925 | Ga0496122_0004586 | Ga0496122_0004586_241_1623 | 460 |
| 541 | 3300048926 | Ga0496123_0015693 | Ga0496123_0015693_334_1716 | 460 |
| 542 | 3300048927 | Ga0496124_0001916 | Ga0496124_0001916_9328_10710 | 460 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xft-assembly1.cif.gz_A-2 | mucp pdz2 domain | 0.9501 | 234 | 316 |
| 5tnz-assembly1.cif.gz_A | htra2 s142d mutant | 0.9495 | 234 | 299 |
| 2zpm-assembly1.cif.gz_A | crystal structure analysis of pdz domain b | 0.9488 | 234 | 316 |
| 3id2-assembly1.cif.gz_B | crystal structure of rsep pdz2 domain | 0.9458 | 234 | 316 |
| 5fht-assembly1.cif.gz_A | htra2 protease mutant v226k | 0.9458 | 234 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PCD2_285_377_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9598 | 232 | 297 | 2.30.42.10 |
| af_A0A0P0VNU6_285_398_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9583 | 234 | 296 | 2.30.42.10 |
| af_A0A0R0HTR5_280_372_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9547 | 231 | 297 | 2.30.42.10 |
| af_Q4E3N9_28_113_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9544 | 234 | 272 | 2.30.42.10 |
| af_Q9P7S1_280_374_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9502 | 234 | 297 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B2C669-F1-model_v4 | deleted | 0.9668 | 327 | 457 |
|
| AF-F0GIN3-F1-model_v4 | Membrane-associated zinc metalloprotease | 0.9568 | 1 | 132 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A3C1TND1-F1-model_v4 | RIP metalloprotease RseP | 0.9553 | 326 | 458 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-A0A836P347-F1-model_v4 | Zinc metalloprotease | 0.955 | 334 | 457 |
GO:0004222
GO:0006508 GO:0016020 |
| AF-F0GIN3-F1-model_v4 | Membrane-associated zinc metalloprotease | 0.9496 | 1 | 132 |
GO:0004222
GO:0006508 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar