F460975

General Info

Members Datasets Scaffolds Average Seq Length
538 330 504 87

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10245041|rootH2_102450412
Length 99
Sequence LRSGKIDEENAVATGWAGDGAVQDQIDATVHDAVMRAKNNLPTGPSLTHCEECQAEIPEARRVAMPGVHLCVTCQEHHDRETQNFSGYNRRGSKDSQLR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
5 2636415599 Klebsiella variicola DX120E Isolate Unclassified
6 2643221559 Lysobacter sp. Root559 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
12 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
13 2775507074 Klebsiella sp. D5A Isolate Unclassified
14 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
15 2818991457 Xanthomonas translucens 569 Isolate Unclassified
16 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
17 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
18 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
19 2884411467 Dyella sp. AD56 Isolate Rhizosphere
20 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
21 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
22 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
23 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
24 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
25 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
26 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
27 2952252522 Salinicola sp. DM10 Isolate Unclassified
28 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
29 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
30 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
230 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
235 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
239 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
240 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
318 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
319 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
320 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
321 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 640753048 Serratia proteamaculans 568 Isolate Endosphere
326 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
327 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
328 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
329 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
330 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0.93
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 6.13
Nodule 0.37
Rhizoplane 2.42
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_859695 2162886006 Bacteria 1823
2 SwRhRL2b_contig_1363613 2162886007 Bacteria 2227
3 JGI24737J22298_10089389 3300001990 Bacteria 914
4 JGI24735J21928_10003683 3300002067 Bacteria 5194
5 rootH2_10131900 3300003320 Bacteria 1641
6 rootH2_10245041 3300003320 Bacteria 1096
7 Ga0055536_1000970 3300003781 Bacteria 18283
8 Ga0055536_1011213 3300003781 Bacteria 3465
9 Ga0055530_10000993 3300003791 Bacteria 22741
10 Ga0055531_10013615 3300003794 Bacteria 3734
11 Ga0055531_10048434 3300003794 Bacteria 1146
12 Ga0058692_1000055 3300003856 Bacteria 105550
13 Ga0065704_10071085 3300005289 Bacteria 13278
14 Ga0065715_10967946 3300005293 Bacteria 544
15 Ga0065707_10082037 3300005295 Bacteria 23924
16 Ga0065707_10083710 3300005295 Bacteria 8403
17 Ga0070658_11023626 3300005327 Bacteria 718
18 Ga0070670_100004160 3300005331 Bacteria 12104
19 Ga0070670_100202268 3300005331 Bacteria 1726
20 Ga0070670_101595674 3300005331 Bacteria 600
21 Ga0068869_100053188 3300005334 Bacteria 2942
22 Ga0070666_10065753 3300005335 Bacteria 2460
23 Ga0070666_10182935 3300005335 Bacteria 1470
24 Ga0070682_100072394 3300005337 Bacteria 2209
25 Ga0068868_100118245 3300005338 Bacteria 2160
26 Ga0068868_100521948 3300005338 Bacteria 1043
27 Ga0070689_100098231 3300005340 Bacteria 2316
28 Ga0070691_10123409 3300005341 Bacteria 1306
29 Ga0070692_10331493 3300005345 Bacteria 939
30 Ga0070668_100411904 3300005347 Bacteria 1156
31 Ga0070668_101185923 3300005347 Unclassified 691
32 Ga0070668_101533488 3300005347 Bacteria 609
33 Ga0070669_100076573 3300005353 Bacteria 2483
34 Ga0070669_100217975 3300005353 Bacteria 1508
35 Ga0070675_100040018 3300005354 Bacteria 3826
36 Ga0070671_100001380 3300005355 Bacteria 18139
37 Ga0070674_100064798 3300005356 Bacteria 2562
38 Ga0070673_100020751 3300005364 Bacteria 4744
39 Ga0070688_100032930 3300005365 Bacteria 3130
40 Ga0070688_100671076 3300005365 Bacteria 800
41 Ga0070667_100077067 3300005367 Bacteria 2847
42 Ga0070713_101603764 3300005436 Bacteria 632
43 Ga0070700_100232517 3300005441 Bacteria 1313
44 Ga0070678_100073688 3300005456 Bacteria 2563
45 Ga0070662_100290273 3300005457 Bacteria 1326
46 Ga0068867_100041432 3300005459 Bacteria 3366
47 Ga0068867_100055110 3300005459 Bacteria 2939
48 Ga0070685_10252352 3300005466 Bacteria 1169
49 Ga0070679_100017777 3300005530 Bacteria 6884
50 Ga0070679_100045539 3300005530 Bacteria 4371
51 Ga0068853_100726574 3300005539 Bacteria 948
52 Ga0070672_100104839 3300005543 Bacteria 2298
53 Ga0070672_100221160 3300005543 Bacteria 1588
54 Ga0070686_100057119 3300005544 Bacteria 2506
55 Ga0070686_100101699 3300005544 Bacteria 1943
56 Ga0070665_100054361 3300005548 Bacteria 4016
57 Ga0070665_100123241 3300005548 Bacteria 2594
58 Ga0070665_100364906 3300005548 Bacteria 1450
59 Ga0070665_101292238 3300005548 Bacteria 740
60 Ga0070665_101901222 3300005548 Bacteria 601
61 Ga0068855_100074335 3300005563 Bacteria 3948
62 Ga0068855_101698437 3300005563 Bacteria 644
63 Ga0068855_102517679 3300005563 Bacteria 512
64 Ga0070664_101347100 3300005564 Bacteria 674
65 Ga0068857_101698805 3300005577 Bacteria 617
66 Ga0068854_100033542 3300005578 Bacteria 3580
67 Ga0068856_100041848 3300005614 Bacteria 4504
68 Ga0068856_102547393 3300005614 Bacteria 518
69 Ga0068852_100392849 3300005616 Bacteria 1363
70 Ga0068852_101049734 3300005616 Bacteria 834
71 Ga0068859_100001453 3300005617 Bacteria 24054
72 Ga0068859_100713974 3300005617 Bacteria 1093
73 Ga0068859_101670018 3300005617 Bacteria 704
74 Ga0068864_100163574 3300005618 Bacteria 2024
75 Ga0068864_102274242 3300005618 Bacteria 549
76 Ga0068861_100000904 3300005719 Bacteria 18021
77 Ga0068861_100157462 3300005719 Bacteria 1870
78 Ga0068861_100223257 3300005719 Bacteria 1593
79 Ga0068861_100790355 3300005719 Bacteria 890
80 Ga0068870_10181253 3300005840 Bacteria 1264
81 Ga0068863_100005193 3300005841 Bacteria 12847
82 Ga0068863_100094897 3300005841 Bacteria 2831
83 Ga0068863_100229123 3300005841 Bacteria 1792
84 Ga0068863_102005194 3300005841 Bacteria 589
85 Ga0068858_100001329 3300005842 Bacteria 25527
86 Ga0068858_100062404 3300005842 Bacteria 3445
87 Ga0068860_100012186 3300005843 Bacteria 8470
88 Ga0068860_100181873 3300005843 Bacteria 2032
89 Ga0068860_101040997 3300005843 Bacteria 837
90 Ga0068862_100071800 3300005844 Bacteria 2989
91 Ga0068862_100622121 3300005844 Unclassified 1039
92 Ga0081540_1003092 3300005983 Bacteria 13333
93 Ga0070712_100375695 3300006175 Bacteria 1169
94 Ga0070712_101520287 3300006175 Bacteria 585
95 Ga0097621_100107958 3300006237 Bacteria 2349
96 Ga0097621_100351340 3300006237 Bacteria 1311
97 Ga0097621_100541663 3300006237 Bacteria 1058
98 Ga0097621_100745152 3300006237 Bacteria 904
99 Ga0097621_101107441 3300006237 Bacteria 744
100 Ga0068871_100043575 3300006358 Bacteria 3605
101 Ga0068871_100070677 3300006358 Bacteria 2869
102 Ga0068871_100378886 3300006358 Bacteria 1256
103 Ga0068871_101707333 3300006358 Bacteria 597
104 Ga0075430_100016289 3300006846 Bacteria 6332
105 Ga0075429_100001826 3300006880 Bacteria 17622
106 Ga0068865_100088371 3300006881 Bacteria 2242
107 Ga0068865_100108835 3300006881 Bacteria 2041
108 Ga0068865_100557206 3300006881 Bacteria 963
109 Ga0097620_100001453 3300006931 Bacteria 24054
110 Ga0097620_100713989 3300006931 Bacteria 1093
111 Ga0097620_101669980 3300006931 Bacteria 704
112 Ga0079104_1019822 3300006946 Bacteria 1867
113 Ga0105251_10369950 3300009011 Bacteria 656
114 Ga0105250_10134755 3300009092 Unclassified 1021
115 Ga0105240_10020797 3300009093 Bacteria 8741
116 Ga0105240_10130509 3300009093 Bacteria 3015
117 Ga0111539_10780109 3300009094 Bacteria 1112
118 Ga0105245_10040120 3300009098 Bacteria 4169
119 Ga0105247_10000173 3300009101 Bacteria 63815
120 Ga0114129_10001307 3300009147 Bacteria 33269
121 Ga0105243_10343169 3300009148 Bacteria 1369
122 Ga0105243_12041926 3300009148 Bacteria 608
123 Ga0105242_10015093 3300009176 Bacteria 5994
124 Ga0105242_10059544 3300009176 Bacteria 3134
125 Ga0105248_10088557 3300009177 Bacteria 3484
126 Ga0105248_10500174 3300009177 Bacteria 1370
127 Ga0105248_10772837 3300009177 Bacteria 1084
128 Ga0105237_11035356 3300009545 Bacteria 828
129 Ga0105237_11454168 3300009545 Bacteria 692
130 Ga0105249_10095447 3300009553 Bacteria 2788
131 Ga0105249_10211249 3300009553 Bacteria 1905
132 Ga0105249_10364541 3300009553 Bacteria 1467
133 Ga0105249_11158665 3300009553 Bacteria 844
134 Ga0105239_10746083 3300010375 Bacteria 1120
135 Ga0157370_11226914 3300013104 Bacteria 676
136 Ga0157369_10003548 3300013105 Bacteria 18530
137 Ga0157369_10114420 3300013105 Bacteria 2865
138 Ga0157369_10186208 3300013105 Bacteria 2183
139 Ga0157374_10007594 3300013296 Bacteria 9253
140 Ga0157374_10178227 3300013296 Bacteria 2075
141 Ga0157378_10039081 3300013297 Bacteria 4208
142 Ga0163162_10005422 3300013306 Bacteria 12327
143 Ga0163162_10085655 3300013306 Bacteria 3228
144 Ga0163162_10402679 3300013306 Bacteria 1501
145 Ga0163162_11956208 3300013306 Bacteria 671
146 Ga0157372_10026587 3300013307 Bacteria 6297
147 Ga0157375_10004067 3300013308 Bacteria 12686
148 Ga0157375_10304155 3300013308 Bacteria 1758
149 Ga0157375_10345189 3300013308 Bacteria 1654
150 Ga0163163_10189932 3300014325 Bacteria 2102
151 Ga0163163_11347006 3300014325 Bacteria 775
152 Ga0163163_13252395 3300014325 Bacteria 507
153 Ga0157380_10005230 3300014326 Bacteria 9068
154 Ga0157380_10454427 3300014326 Bacteria 1231
155 Ga0157380_10816708 3300014326 Bacteria 951
156 Ga0157380_11246572 3300014326 Bacteria 789
157 Ga0157380_11331314 3300014326 Bacteria 766
158 Ga0182008_10060436 3300014497 Bacteria 1868
159 Ga0157379_12231870 3300014968 Bacteria 544
160 Ga0157376_10012509 3300014969 Bacteria 6301
161 Ga0157376_10261278 3300014969 Bacteria 1622
162 Ga0157376_12746831 3300014969 Bacteria 532
163 Ga0163161_10077016 3300017792 Bacteria 2449
164 Ga0163161_10574447 3300017792 Bacteria 927
165 Ga0197907_10031805 3300020069 Bacteria 1070
166 Ga0206356_10157927 3300020070 Bacteria 781
167 Ga0206356_11401385 3300020070 Bacteria 683
168 Ga0206349_1138132 3300020075 Bacteria 625
169 Ga0206353_10662671 3300020082 Bacteria 941
170 Ga0209674_100016 3300025226 Bacteria 696756
171 Ga0207427_100117 3300025231 Bacteria 102251
172 Ga0209437_100240 3300025233 Bacteria 89740
173 Ga0209646_1005732 3300025246 Bacteria 2141
174 Ga0209026_1000207 3300025250 Bacteria 81332
175 Ga0209759_1056689 3300025256 Bacteria 571
176 Ga0209233_1000083 3300025261 Bacteria 336016
177 Ga0209233_1000417 3300025261 Bacteria 32180
178 Ga0209455_1000535 3300025272 Bacteria 26363
179 Ga0209130_1006914 3300025284 Bacteria 3592
180 Ga0209675_1009967 3300025291 Bacteria 3294
181 Ga0209676_1000196 3300025292 Bacteria 135726
182 Ga0209676_1001468 3300025292 Bacteria 21920
183 Ga0209676_1002369 3300025292 Bacteria 13564
184 Ga0209676_1002638 3300025292 Bacteria 12223
185 Ga0209025_1040515 3300025294 Bacteria 2013
186 Ga0209564_1003676 3300025295 Bacteria 10130
187 Ga0209564_1050524 3300025295 Bacteria 1017
188 Ga0209050_1001267 3300025298 Bacteria 29081
189 Ga0209256_1001647 3300025299 Bacteria 21722
190 Ga0209051_1017574 3300025303 Bacteria 3192
191 Ga0209257_1000356 3300025304 Bacteria 93656
192 Ga0209257_1002260 3300025304 Bacteria 19684
193 Ga0209257_1063166 3300025304 Bacteria 999
194 Ga0207697_10414252 3300025315 Bacteria 598
195 Ga0207682_10002667 3300025893 Bacteria 7948
196 Ga0207642_10249906 3300025899 Bacteria 1006
197 Ga0207710_10000666 3300025900 Bacteria 19351
198 Ga0207680_10058161 3300025903 Bacteria 2342
199 Ga0207680_10142508 3300025903 Bacteria 1590
200 Ga0207680_10290828 3300025903 Bacteria 1137
201 Ga0207647_10053567 3300025904 Bacteria 2485
202 Ga0207645_10145355 3300025907 Bacteria 1546
203 Ga0207645_11065424 3300025907 Bacteria 546
204 Ga0207643_10005180 3300025908 Bacteria 6972
205 Ga0207695_10665359 3300025913 Bacteria 922
206 Ga0207671_10382900 3300025914 Bacteria 1118
207 Ga0207671_10844770 3300025914 Bacteria 725
208 Ga0207663_10005990 3300025916 Bacteria 6182
209 Ga0207660_10175567 3300025917 Bacteria 1661
210 Ga0207681_10218612 3300025923 Bacteria 1473
211 Ga0207694_10349512 3300025924 Bacteria 1224
212 Ga0207650_10062181 3300025925 Bacteria 2789
213 Ga0207650_10158305 3300025925 Bacteria 1792
214 Ga0207650_10200945 3300025925 Bacteria 1597
215 Ga0207659_10124650 3300025926 Bacteria 1979
216 Ga0207659_11311859 3300025926 Bacteria 621
217 Ga0207687_10129410 3300025927 Bacteria 1900
218 Ga0207700_11274102 3300025928 Bacteria 655
219 Ga0207644_10004431 3300025931 Bacteria 9113
220 Ga0207644_11213184 3300025931 Bacteria 634
221 Ga0207706_10139977 3300025933 Bacteria 2129
222 Ga0207706_10156871 3300025933 Bacteria 2001
223 Ga0207686_10026819 3300025934 Bacteria 3366
224 Ga0207686_10062876 3300025934 Bacteria 2359
225 Ga0207670_10111926 3300025936 Bacteria 1969
226 Ga0207669_10613784 3300025937 Bacteria 885
227 Ga0207704_10019984 3300025938 Bacteria 3532
228 Ga0207704_10089159 3300025938 Bacteria 2020
229 Ga0207704_10207107 3300025938 Bacteria 1440
230 Ga0207704_11664913 3300025938 Bacteria 548
231 Ga0207691_10064050 3300025940 Bacteria 3332
232 Ga0207711_10113149 3300025941 Bacteria 2416
233 Ga0207711_10614322 3300025941 Bacteria 1014
234 Ga0207689_10047696 3300025942 Bacteria 3534
235 Ga0207679_11844793 3300025945 Bacteria 552
236 Ga0207667_10448962 3300025949 Bacteria 1310
237 Ga0207651_10044633 3300025960 Bacteria 2968
238 Ga0207712_10019704 3300025961 Bacteria 4408
239 Ga0207712_10042121 3300025961 Bacteria 3142
240 Ga0207712_10601830 3300025961 Bacteria 951
241 Ga0207668_10364515 3300025972 Bacteria 1212
242 Ga0207640_10193977 3300025981 Bacteria 1533
243 Ga0207640_10902652 3300025981 Bacteria 772
244 Ga0207658_10004450 3300025986 Bacteria 9742
245 Ga0207658_10364542 3300025986 Bacteria 1262
246 Ga0207658_11362096 3300025986 Bacteria 649
247 Ga0207677_10007213 3300026023 Bacteria 6128
248 Ga0207677_11979991 3300026023 Bacteria 541
249 Ga0207677_12008107 3300026023 Unclassified 538
250 Ga0207703_10000855 3300026035 Bacteria 29877
251 Ga0207703_10904714 3300026035 Bacteria 845
252 Ga0207639_10681611 3300026041 Bacteria 953
253 Ga0207678_10006781 3300026067 Bacteria 10151
254 Ga0207678_10618807 3300026067 Bacteria 950
255 Ga0207708_10243051 3300026075 Bacteria 1448
256 Ga0207702_10374878 3300026078 Bacteria 1367
257 Ga0207702_11158382 3300026078 Bacteria 767
258 Ga0207641_10064577 3300026088 Bacteria 3129
259 Ga0207641_10828004 3300026088 Bacteria 916
260 Ga0207641_11745301 3300026088 Bacteria 624
261 Ga0207641_12626015 3300026088 Bacteria 501
262 Ga0207648_10014132 3300026089 Bacteria 7383
263 Ga0207648_10091881 3300026089 Bacteria 2654
264 Ga0207676_10214421 3300026095 Bacteria 1710
265 Ga0207676_10495252 3300026095 Bacteria 1160
266 Ga0207674_12198847 3300026116 Bacteria 515
267 Ga0207675_100010773 3300026118 Bacteria 8568
268 Ga0207675_100019991 3300026118 Bacteria 6248
269 Ga0207675_100188519 3300026118 Bacteria 1977
270 Ga0207675_100308367 3300026118 Bacteria 1543
271 Ga0207675_100456389 3300026118 Bacteria 1267
272 Ga0207683_10098943 3300026121 Bacteria 2603
273 Ga0207683_10391788 3300026121 Bacteria 1277
274 Ga0207698_11060015 3300026142 Bacteria 822
275 Ga0207698_12169898 3300026142 Bacteria 568
276 Ga0207698_12227785 3300026142 Bacteria 560
277 Ga0209281_1012480 3300027111 Bacteria 1864
278 Ga0209371_1000075 3300027312 Bacteria 196676
279 Ga0268266_10045112 3300028379 Bacteria 3770
280 Ga0268266_10310249 3300028379 Bacteria 1474
281 Ga0268266_10331544 3300028379 Bacteria 1426
282 Ga0268266_10988078 3300028379 Bacteria 814
283 Ga0268265_10228255 3300028380 Bacteria 1634
284 Ga0268265_10239976 3300028380 Bacteria 1599
285 Ga0268265_10730565 3300028380 Unclassified 959
286 Ga0268264_10014540 3300028381 Bacteria 6466
287 Ga0268264_10061954 3300028381 Bacteria 3140
288 Ga0268264_10800077 3300028381 Bacteria 942
289 Ga0268264_11163249 3300028381 Bacteria 781
290 Ga0265319_1048759 3300028563 Bacteria 1405
291 Ga0265334_10000089 3300028573 Bacteria 65336
292 Ga0265318_10010901 3300028577 Bacteria 3938
293 Ga0265338_10007138 3300028800 Bacteria 13985
294 Ga0265324_10104971 3300029957 Bacteria 960
295 Ga0268256_1000068 3300030500 Bacteria 196676
296 Ga0307511_10000112 3300030521 Bacteria 73319
297 Ga0307511_10060866 3300030521 Bacteria 2884
298 Ga0265330_10002999 3300031235 Bacteria 8979
299 Ga0265330_10463576 3300031235 Unclassified 538
300 Ga0265332_10004069 3300031238 Bacteria 6938
301 Ga0265332_10183024 3300031238 Bacteria 872
302 Ga0265328_10245454 3300031239 Bacteria 685
303 Ga0265320_10199525 3300031240 Bacteria 893
304 Ga0265325_10001937 3300031241 Bacteria 14276
305 Ga0265339_10054812 3300031249 Bacteria 2164
306 Ga0265339_10108665 3300031249 Bacteria 1437
307 Ga0265331_10060184 3300031250 Bacteria 1794
308 Ga0265327_10000027 3300031251 Bacteria 364541
309 Ga0265316_10436333 3300031344 Unclassified 940
310 Ga0307513_10055934 3300031456 Bacteria 4218
311 Ga0307513_11108846 3300031456 Unclassified 504
312 Ga0307408_100272797 3300031548 Bacteria 1405
313 Ga0265313_10019234 3300031595 Bacteria 3809
314 Ga0307508_10312605 3300031616 Bacteria 1163
315 Ga0307508_10549218 3300031616 Bacteria 753
316 Ga0316575_10174474 3300031665 Bacteria 892
317 Ga0265314_10014486 3300031711 Bacteria 6304
318 Ga0265314_10205592 3300031711 Unclassified 1160
319 Ga0265342_10012744 3300031712 Bacteria 5680
320 Ga0265342_10018193 3300031712 Bacteria 4558
321 Ga0316576_10645674 3300031727 Bacteria 770
322 Ga0316576_10756393 3300031727 Bacteria 701
323 Ga0316576_10907942 3300031727 Bacteria 630
324 Ga0316578_10110274 3300031728 Bacteria 1652
325 Ga0307516_10021678 3300031730 Bacteria 6606
326 Ga0307413_10993479 3300031824 Bacteria 719
327 Ga0307410_10148771 3300031852 Bacteria 1741
328 Ga0307406_10395120 3300031901 Bacteria 1094
329 Ga0307406_10703895 3300031901 Bacteria 844
330 Ga0307407_10243223 3300031903 Bacteria 1229
331 Ga0307412_11658496 3300031911 Bacteria 585
332 Ga0307412_12189446 3300031911 Bacteria 514
333 Ga0307409_100401395 3300031995 Bacteria 1309
334 Ga0307416_101529984 3300032002 Bacteria 773
335 Ga0307411_10139084 3300032005 Bacteria 1788
336 Ga0307411_11111043 3300032005 Bacteria 713
337 Ga0316580_10016325 3300032139 Bacteria 2278
338 Ga0373938_0172900 3300034957 Bacteria 586
339 Ga0373936_0002456 3300035113 Bacteria 6934
340 Ga0316574_0018957 3300035398 Bacteria 4052
341 Ga0316574_0992750 3300035398 Bacteria 505
342 Ga0316582_0087525 3300036647 Bacteria 2044
343 Ga0316584_0137508 3300036712 Bacteria 1823
344 Ga0395898_0174813 3300037466 Bacteria 2052
345 Ga0395905_0055313 3300037471 Bacteria 3714
346 Ga0395901_0008721 3300038443 Bacteria 10247
347 Ga0451791_0330967 3300041451 Bacteria 1163
348 Ga0451797_0525625 3300041453 Bacteria 1122
349 Ga0451839_0926928 3300041496 Bacteria 807
350 Ga0451841_0143415 3300041498 Bacteria 953
351 Ga0451841_1299822 3300041498 Bacteria 776
352 Ga0451845_0161850 3300041501 Bacteria 554
353 Ga0451849_0461382 3300041505 Bacteria 1222
354 Ga0451849_0957858 3300041505 Bacteria 584
355 Ga0451851_0438943 3300041507 Bacteria 700
356 Ga0451843_1222740 3300041509 Bacteria 809
357 Ga0451843_1529574 3300041509 Bacteria 930
358 Ga0439452_010484 3300042010 Bacteria 2693
359 Ga0450906_044706 3300042145 Bacteria 782
360 Ga0439460_0215589 3300042461 Bacteria 657
361 Ga0451577_0015537 3300042876 Bacteria 7080
362 Ga0466969_0032559 3300044656 Bacteria 2650
363 Ga0466972_0188148 3300044658 Bacteria 968
364 Ga0466966_0010105 3300044684 Bacteria 6261
365 Ga0453684_0010616 3300044712 Bacteria 15699
366 Ga0453684_1315259 3300044712 Bacteria 753
367 Ga0466970_0931331 3300044765 Bacteria 511
368 Ga0466959_0002148 3300045049 Bacteria 12507
369 Ga0466959_0042999 3300045049 Bacteria 3332
370 Ga0451576_2630017 3300045051 Bacteria 513
371 Ga0495638_0078582 3300046460 Bacteria 2007
372 Ga0495638_0440958 3300046460 Bacteria 667
373 Ga0495650_0016936 3300046471 Bacteria 3668
374 Ga0495650_0199536 3300046471 Bacteria 696
375 Ga0495632_0141625 3300046519 Bacteria 1115
376 Ga0495621_0136370 3300046539 Bacteria 958
377 Ga0495621_0227454 3300046539 Bacteria 757
378 Ga0495633_0040355 3300046558 Bacteria 2224
379 Ga0495625_0028658 3300046660 Bacteria 4173
380 Ga0495625_0045648 3300046660 Bacteria 3166
381 Ga0495657_0620187 3300046675 Bacteria 625
382 Ga0495670_0726387 3300046691 Bacteria 542
383 Ga0495649_0156203 3300046694 Bacteria 1197
384 Ga0495680_0877039 3300047322 Unclassified 581
385 Ga0496100_1479706 3300048903 Bacteria 536
386 Ga0496101_0160462 3300048904 Bacteria 1724
387 Ga0496104_0047693 3300048907 Bacteria 4038
388 Ga0496104_0611785 3300048907 Bacteria 1000
389 Ga0496104_1836392 3300048907 Bacteria 508
390 Ga0496105_0082258 3300048908 Bacteria 2659
391 Ga0496107_0108188 3300048910 Bacteria 2042
392 Ga0496112_0452055 3300048915 Bacteria 1222
393 Ga0496113_0055996 3300048916 Bacteria 2958
394 Ga0496115_0000782 3300048918 Bacteria 23341
395 Ga0496116_0241377 3300048919 Bacteria 907
396 Ga0496117_0001663 3300048920 Bacteria 31146
397 Ga0496118_0031793 3300048921 Bacteria 4365
398 Ga0496118_0035543 3300048921 Bacteria 4043
399 Ga0496118_0114282 3300048921 Bacteria 1780
400 Ga0496119_0000177 3300048922 Bacteria 89166
401 Ga0496119_0001108 3300048922 Bacteria 33950
402 Ga0496119_0350274 3300048922 Bacteria 715
403 Ga0496120_0000188 3300048923 Bacteria 105545
404 Ga0496120_0000328 3300048923 Bacteria 79028
405 Ga0496120_0109591 3300048923 Bacteria 1444
406 Ga0496121_0025636 3300048924 Bacteria 5588
407 Ga0496121_0151460 3300048924 Bacteria 1706
408 Ga0496122_0000209 3300048925 Bacteria 130440
409 Ga0496122_0242202 3300048925 Bacteria 1016
410 Ga0496123_0000106 3300048926 Bacteria 167799
411 Ga0496123_0341377 3300048926 Bacteria 700
412 Ga0496124_0000401 3300048927 Bacteria 79057
413 Ga0496125_0002206 3300048928 Bacteria 25985
414 Ga0496125_0038336 3300048928 Bacteria 4149
415 Ga0496126_0002462 3300048929 Bacteria 24953
416 Ga0495678_230501 3300049459 Bacteria 558
417 Ga0501031_0001097 3300049568 Bacteria 16491
418 Ga0501031_0213687 3300049568 Bacteria 1256
419 Ga0501032_0005261 3300049569 Bacteria 9626
420 Ga0501032_0014161 3300049569 Bacteria 5653
421 Ga0501032_0756536 3300049569 Bacteria 614
422 Ga0501033_0000720 3300049570 Bacteria 30337
423 Ga0501033_0014033 3300049570 Bacteria 6095
424 Ga0501033_0031736 3300049570 Bacteria 3966
425 Ga0501034_0002484 3300049571 Bacteria 22159
426 Ga0501034_0004188 3300049571 Bacteria 16100
427 Ga0501034_0714230 3300049571 Bacteria 900
428 Ga0501034_1252587 3300049571 Bacteria 619
429 Ga0501036_0007244 3300049572 Bacteria 9033
430 Ga0501036_0007930 3300049572 Bacteria 8687
431 Ga0501036_0160322 3300049572 Bacteria 1896
432 Ga0501036_0284259 3300049572 Bacteria 1384
433 Ga0501037_0001245 3300049573 Bacteria 18769
434 Ga0501037_0283164 3300049573 Bacteria 1154
435 Ga0501038_0000673 3300049574 Bacteria 30442
436 Ga0501038_0842244 3300049574 Bacteria 679
437 Ga0501039_0002430 3300049575 Bacteria 13866
438 Ga0501039_0005379 3300049575 Bacteria 9681
439 Ga0501039_0052721 3300049575 Bacteria 3146
440 Ga0501040_0030210 3300049576 Bacteria 3660
441 Ga0501042_0000212 3300049578 Bacteria 27705
442 Ga0501042_0703901 3300049578 Bacteria 735
443 Ga0501043_0003203 3300049579 Bacteria 13541
444 Ga0501043_0014430 3300049579 Bacteria 6182
445 Ga0501043_0028000 3300049579 Bacteria 4422
446 Ga0501043_0088572 3300049579 Bacteria 2432
447 Ga0501046_0002962 3300049580 Bacteria 15706
448 Ga0501046_0013109 3300049580 Bacteria 7036
449 Ga0501046_0013611 3300049580 Bacteria 6880
450 Ga0501047_0005546 3300049581 Bacteria 11875
451 Ga0501047_0034653 3300049581 Bacteria 4874
452 Ga0501047_0107772 3300049581 Bacteria 2668
453 Ga0501047_0208807 3300049581 Bacteria 1811
454 Ga0501048_0069337 3300049582 Bacteria 2490
455 Ga0501048_0095168 3300049582 Bacteria 2100
456 Ga0501067_0009020 3300049583 Bacteria 5528
457 Ga0501067_0041945 3300049583 Bacteria 2541
458 Ga0501067_0233470 3300049583 Bacteria 1024
459 Ga0501069_0055903 3300049585 Bacteria 2198
460 Ga0501069_0126607 3300049585 Bacteria 1461
461 Ga0501070_0056925 3300049586 Bacteria 3241
462 Ga0501070_0059406 3300049586 Bacteria 3170
463 Ga0501070_0138229 3300049586 Bacteria 2011
464 Ga0501070_0227269 3300049586 Bacteria 1529
465 Ga0501071_0008741 3300049587 Bacteria 6704
466 Ga0501071_0095677 3300049587 Bacteria 2185
467 Ga0501072_0071696 3300049588 Bacteria 2737
468 Ga0501073_0016778 3300049589 Bacteria 5306
469 Ga0501073_0050715 3300049589 Bacteria 2907
470 Ga0501073_0989987 3300049589 Bacteria 578
471 Ga0501074_0008025 3300049590 Bacteria 7644
472 Ga0501074_0025724 3300049590 Bacteria 4270
473 Ga0501075_0240312 3300049591 Bacteria 1381
474 Ga0501079_0016173 3300049741 Bacteria 5702
475 Ga0501079_0034570 3300049741 Bacteria 3889
476 Ga0501080_0021473 3300049742 Bacteria 5975
477 Ga0501080_0390689 3300049742 Bacteria 1252
478 Ga0501080_0460279 3300049742 Bacteria 1139
479 Ga0501081_0082346 3300049743 Bacteria 2254
480 Ga0501083_0016466 3300049744 Bacteria 5174
481 Ga0501035_0004344 3300049822 Bacteria 13451
482 Ga0501035_0021681 3300049822 Bacteria 5907
483 Ga0501035_0028763 3300049822 Bacteria 5071
484 Ga0501044_0006784 3300049823 Bacteria 12621
485 Ga0501044_0016545 3300049823 Bacteria 7916
486 Ga0501044_0114223 3300049823 Bacteria 2706
487 Ga0501045_0078084 3300049824 Bacteria 2440
488 Ga0501045_0447055 3300049824 Bacteria 961
489 nmdc:mga05p37_35518_c1 3300050507 Bacteria 6112
490 nmdc:mga09592_1185621_c1 3300050508 Bacteria 632
491 nmdc:mga0qj67_40234_c1 3300050509 Bacteria 3675
492 nmdc:mga0qj67_9876_c1 3300050509 Bacteria 7115
493 Ga0495655_0188233 3300053083 Bacteria 669
494 Ga0500644_0029071 3300053088 Bacteria 1735
495 Ga0500557_102851 3300053105 Bacteria 949
496 Ga0500572_093531 3300053111 Bacteria 955
497 Ga0500591_144680 3300053115 Bacteria 931
498 Ga0500630_070629 3300053159 Bacteria 1652
499 Ga0500639_198171 3300053163 Bacteria 866
500 Ga0501084_0062028 3300054114 Bacteria 3130
501 Ga0501084_0198135 3300054114 Bacteria 1694
502 Ga0501082_0054243 3300060353 Bacteria 3455
503 Ga0501082_0348151 3300060353 Bacteria 1291
504 Ga0530510_0087572 3300061734 Bacteria 2269

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10182935 Ga0070666_101829352 79
2 3300005338 Ga0068868_100118245 Ga0068868_1001182452 79
3 3300005617 Ga0068859_101670018 Ga0068859_1016700181 79
4 3300005841 Ga0068863_100094897 Ga0068863_1000948973 79
5 3300005842 Ga0068858_100062404 Ga0068858_1000624042 79
6 3300005843 Ga0068860_100012186 Ga0068860_1000121862 79
7 3300006358 Ga0068871_100070677 Ga0068871_1000706773 79
8 3300006881 Ga0068865_100557206 Ga0068865_1005572061 79
9 3300006931 Ga0097620_101669980 Ga0097620_1016699801 79
10 3300009098 Ga0105245_10040120 Ga0105245_100401205 79
11 3300009176 Ga0105242_10015093 Ga0105242_100150936 79
12 3300013296 Ga0157374_10007594 Ga0157374_100075943 79
13 3300013297 Ga0157378_10039081 Ga0157378_100390813 79
14 3300014969 Ga0157376_10012509 Ga0157376_100125095 79
15 3300025903 Ga0207680_10058161 Ga0207680_100581612 79
16 3300025927 Ga0207687_10129410 Ga0207687_101294102 79
17 3300025938 Ga0207704_10207107 Ga0207704_102071071 79
18 3300026023 Ga0207677_10007213 Ga0207677_100072134 79
19 3300026088 Ga0207641_12626015 Ga0207641_126260151 79
20 3300028379 Ga0268266_10310249 Ga0268266_103102492 79
21 3300048903 Ga0496100_1479706 Ga0496100_1479706_32_298 79
22 3300048904 Ga0496101_0160462 Ga0496101_0160462_29_295 79
23 3300048910 Ga0496107_0108188 Ga0496107_0108188_962_1228 79
24 3300006880 Ga0075429_100001826 Ga0075429_1000018262 80
25 3300009147 Ga0114129_10001307 Ga0114129_1000130720 80
26 3300031548 Ga0307408_100272797 Ga0307408_1002727972 80
27 3300031901 Ga0307406_10395120 Ga0307406_103951202 80
28 3300031911 Ga0307412_12189446 Ga0307412_121894462 80
29 3300042461 Ga0439460_0215589 Ga0439460_0215589_331_597 80
30 3300050507 nmdc:mga05p37_35518_c1 nmdc:mga05p37_35518_c1_4495_4761 80
31 3300050508 nmdc:mga09592_1185621_c1 nmdc:mga09592_1185621_c1_301_567 80
32 3300050509 nmdc:mga0qj67_40234_c1 nmdc:mga0qj67_40234_c1_78_344 80
33 3300005334 Ga0068869_100053188 Ga0068869_1000531883 81
34 3300025942 Ga0207689_10047696 Ga0207689_100476964 81
35 3300005338 Ga0068868_100521948 Ga0068868_1005219482 82
36 3300005367 Ga0070667_100077067 Ga0070667_1000770671 82
37 3300006237 Ga0097621_100745152 Ga0097621_1007451522 82
38 3300006358 Ga0068871_100378886 Ga0068871_1003788862 82
39 3300006881 Ga0068865_100108835 Ga0068865_1001088353 82
40 3300009148 Ga0105243_10343169 Ga0105243_103431692 82
41 3300009176 Ga0105242_10059544 Ga0105242_100595442 82
42 3300009177 Ga0105248_10772837 Ga0105248_107728372 82
43 3300009553 Ga0105249_11158665 Ga0105249_111586652 82
44 3300013296 Ga0157374_10178227 Ga0157374_101782273 82
45 3300013306 Ga0163162_10085655 Ga0163162_100856553 82
46 3300013308 Ga0157375_10345189 Ga0157375_103451892 82
47 3300014325 Ga0163163_10189932 Ga0163163_101899322 82
48 3300014326 Ga0157380_11246572 Ga0157380_112465721 82
49 3300025899 Ga0207642_10249906 Ga0207642_102499062 82
50 3300025931 Ga0207644_11213184 Ga0207644_112131842 82
51 3300025934 Ga0207686_10062876 Ga0207686_100628762 82
52 3300025938 Ga0207704_10089159 Ga0207704_100891592 82
53 3300025941 Ga0207711_10113149 Ga0207711_101131492 82
54 3300025986 Ga0207658_11362096 Ga0207658_113620961 82
55 3300026035 Ga0207703_10904714 Ga0207703_109047142 82
56 3300026067 Ga0207678_10618807 Ga0207678_106188071 82
57 3300026088 Ga0207641_10828004 Ga0207641_108280042 82
58 3300046539 Ga0495621_0136370 Ga0495621_0136370_658_924 82
59 3300046694 Ga0495649_0156203 Ga0495649_0156203_151_417 82
60 3300053083 Ga0495655_0188233 Ga0495655_0188233_319_585 82
61 iso_pu_bacteria 2643221559 2643817430 83
62 iso_pu_bacteria 2643221586 2643938141 83
63 iso_pu_bacteria 2643221612 2644079213 83
64 iso_pu_bacteria 2643221727 2644694657 83
65 iso_pu_bacteria 2884411467 2884415486 83
66 iso_pu_bacteria 2508501071 2508851459 84
67 iso_pu_bacteria 2609459761 2609913705 84
68 iso_pu_bacteria 2636415599 2637226305 84
69 iso_pu_bacteria 2643221579 2643907924 84
70 iso_pu_bacteria 2706794495 2707101407 84
71 iso_pu_bacteria 2738541276 2738714570 84
72 iso_pu_bacteria 2775507074 2777020378 84
73 iso_pu_bacteria 2806310673 2807179584 84
74 iso_pu_bacteria 2818991457 2819660207 84
75 iso_pu_bacteria 2836160341 2836163947 84
76 iso_pu_bacteria 2852684882 2852684979 84
77 iso_pu_bacteria 2857442823 2857444683 84
78 iso_pu_bacteria 2895395659 2895396794 84
79 iso_pu_bacteria 2904513164 2904517305 84
80 iso_pu_bacteria 2919130084 2919130520 84
81 iso_pu_bacteria 2923516293 2923518595 84
82 iso_pu_bacteria 2929195423 2929198476 84
83 iso_pu_bacteria 2941475908 2941476747 84
84 iso_pu_bacteria 2945874760 2945878859 84
85 iso_pu_bacteria 2952252522 2952254536 84
86 iso_pu_bacteria 2969079654 2969083284 84
87 iso_pu_bacteria 2984559226 2984560301 84
88 iso_pu_bacteria 2984595703 2984598378 84
89 iso_pu_bacteria 640753048 640937012 84
90 iso_pu_bacteria 8003014200 8003015870 84
91 iso_pu_bacteria 8021622325 8021625614 84
92 iso_pu_bacteria 8021626552 8021626985 84
93 iso_pu_bacteria 8021648035 8021652104 84
94 iso_pu_bacteria 8055693939 8055695393 84
95 3300020069 Ga0197907_10031805 Ga0197907_100318052 87
96 3300020070 Ga0206356_10157927 Ga0206356_101579272 87
97 3300020082 Ga0206353_10662671 Ga0206353_106626712 87
98 3300025246 Ga0209646_1005732 Ga0209646_10057321 87
99 3300025250 Ga0209026_1000207 Ga0209026_100020771 87
100 3300025256 Ga0209759_1056689 Ga0209759_10566891 87
101 3300025272 Ga0209455_1000535 Ga0209455_10005356 87
102 3300025981 Ga0207640_10193977 Ga0207640_101939772 87
103 3300026067 Ga0207678_10006781 Ga0207678_1000678114 87
104 3300031911 Ga0307412_11658496 Ga0307412_116584962 87
105 3300049571 Ga0501034_1252587 Ga0501034_1252587_306_569 87
106 2162886006 SwRhRL3b_contig_859695 SwRhRL3b_0411.00001660 88
107 2162886007 SwRhRL2b_contig_1363613 SwRhRL2b_0792.00003520 88
108 3300001990 JGI24737J22298_10089389 JGI24737J22298_100893891 88
109 3300002067 JGI24735J21928_10003683 JGI24735J21928_100036832 88
110 3300003320 rootH2_10131900 rootH2_101319003 88
111 3300003320 rootH2_10245041 rootH2_102450412 88
112 3300003781 Ga0055536_1000970 Ga0055536_10009701 88
113 3300003781 Ga0055536_1011213 Ga0055536_10112131 88
114 3300003791 Ga0055530_10000993 Ga0055530_1000099318 88
115 3300003794 Ga0055531_10013615 Ga0055531_100136152 88
116 3300003794 Ga0055531_10048434 Ga0055531_100484342 88
117 3300003856 Ga0058692_1000055 Ga0058692_100005576 88
118 3300005289 Ga0065704_10071085 Ga0065704_100710859 88
119 3300005293 Ga0065715_10967946 Ga0065715_109679462 88
120 3300005295 Ga0065707_10082037 Ga0065707_1008203712 88
121 3300005295 Ga0065707_10083710 Ga0065707_100837104 88
122 3300005327 Ga0070658_11023626 Ga0070658_110236261 88
123 3300005331 Ga0070670_100004160 Ga0070670_1000041605 88
124 3300005331 Ga0070670_100202268 Ga0070670_1002022682 88
125 3300005331 Ga0070670_101595674 Ga0070670_1015956741 88
126 3300005335 Ga0070666_10065753 Ga0070666_100657531 88
127 3300005337 Ga0070682_100072394 Ga0070682_1000723942 88
128 3300005340 Ga0070689_100098231 Ga0070689_1000982314 88
129 3300005341 Ga0070691_10123409 Ga0070691_101234092 88
130 3300005345 Ga0070692_10331493 Ga0070692_103314931 88
131 3300005347 Ga0070668_100411904 Ga0070668_1004119042 88
132 3300005347 Ga0070668_101185923 Ga0070668_1011859231 88
133 3300005347 Ga0070668_101533488 Ga0070668_1015334881 88
134 3300005353 Ga0070669_100076573 Ga0070669_1000765733 88
135 3300005353 Ga0070669_100217975 Ga0070669_1002179752 88
136 3300005354 Ga0070675_100040018 Ga0070675_1000400183 88
137 3300005355 Ga0070671_100001380 Ga0070671_1000013804 88
138 3300005356 Ga0070674_100064798 Ga0070674_1000647983 88
139 3300005364 Ga0070673_100020751 Ga0070673_1000207514 88
140 3300005365 Ga0070688_100032930 Ga0070688_1000329302 88
141 3300005365 Ga0070688_100671076 Ga0070688_1006710762 88
142 3300005436 Ga0070713_101603764 Ga0070713_1016037641 88
143 3300005441 Ga0070700_100232517 Ga0070700_1002325172 88
144 3300005456 Ga0070678_100073688 Ga0070678_1000736882 88
145 3300005457 Ga0070662_100290273 Ga0070662_1002902732 88
146 3300005459 Ga0068867_100041432 Ga0068867_1000414323 88
147 3300005459 Ga0068867_100055110 Ga0068867_1000551102 88
148 3300005466 Ga0070685_10252352 Ga0070685_102523523 88
149 3300005530 Ga0070679_100017777 Ga0070679_1000177775 88
150 3300005530 Ga0070679_100045539 Ga0070679_1000455394 88
151 3300005539 Ga0068853_100726574 Ga0068853_1007265742 88
152 3300005543 Ga0070672_100104839 Ga0070672_1001048393 88
153 3300005543 Ga0070672_100221160 Ga0070672_1002211602 88
154 3300005544 Ga0070686_100057119 Ga0070686_1000571193 88
155 3300005544 Ga0070686_100101699 Ga0070686_1001016993 88
156 3300005548 Ga0070665_100054361 Ga0070665_1000543612 88
157 3300005548 Ga0070665_100123241 Ga0070665_1001232413 88
158 3300005548 Ga0070665_100364906 Ga0070665_1003649061 88
159 3300005548 Ga0070665_101292238 Ga0070665_1012922382 88
160 3300005548 Ga0070665_101901222 Ga0070665_1019012222 88
161 3300005563 Ga0068855_100074335 Ga0068855_1000743352 88
162 3300005563 Ga0068855_101698437 Ga0068855_1016984371 88
163 3300005563 Ga0068855_102517679 Ga0068855_1025176792 88
164 3300005564 Ga0070664_101347100 Ga0070664_1013471001 88
165 3300005577 Ga0068857_101698805 Ga0068857_1016988052 88
166 3300005578 Ga0068854_100033542 Ga0068854_1000335423 88
167 3300005614 Ga0068856_100041848 Ga0068856_1000418484 88
168 3300005614 Ga0068856_102547393 Ga0068856_1025473931 88
169 3300005616 Ga0068852_100392849 Ga0068852_1003928492 88
170 3300005616 Ga0068852_101049734 Ga0068852_1010497342 88
171 3300005617 Ga0068859_100001453 Ga0068859_10000145320 88
172 3300005617 Ga0068859_100713974 Ga0068859_1007139742 88
173 3300005618 Ga0068864_100163574 Ga0068864_1001635742 88
174 3300005618 Ga0068864_102274242 Ga0068864_1022742422 88
175 3300005719 Ga0068861_100000904 Ga0068861_1000009049 88
176 3300005719 Ga0068861_100157462 Ga0068861_1001574622 88
177 3300005719 Ga0068861_100223257 Ga0068861_1002232572 88
178 3300005719 Ga0068861_100790355 Ga0068861_1007903551 88
179 3300005840 Ga0068870_10181253 Ga0068870_101812532 88
180 3300005841 Ga0068863_100005193 Ga0068863_1000051936 88
181 3300005841 Ga0068863_100229123 Ga0068863_1002291232 88
182 3300005841 Ga0068863_102005194 Ga0068863_1020051941 88
183 3300005842 Ga0068858_100001329 Ga0068858_10000132920 88
184 3300005843 Ga0068860_100181873 Ga0068860_1001818732 88
185 3300005843 Ga0068860_101040997 Ga0068860_1010409971 88
186 3300005844 Ga0068862_100071800 Ga0068862_1000718002 88
187 3300005844 Ga0068862_100622121 Ga0068862_1006221211 88
188 3300005983 Ga0081540_1003092 Ga0081540_100309210 88
189 3300006175 Ga0070712_100375695 Ga0070712_1003756952 88
190 3300006175 Ga0070712_101520287 Ga0070712_1015202872 88
191 3300006237 Ga0097621_100107958 Ga0097621_1001079583 88
192 3300006237 Ga0097621_100351340 Ga0097621_1003513402 88
193 3300006237 Ga0097621_100541663 Ga0097621_1005416632 88
194 3300006237 Ga0097621_101107441 Ga0097621_1011074412 88
195 3300006358 Ga0068871_100043575 Ga0068871_1000435753 88
196 3300006358 Ga0068871_101707333 Ga0068871_1017073331 88
197 3300006846 Ga0075430_100016289 Ga0075430_1000162894 88
198 3300006881 Ga0068865_100088371 Ga0068865_1000883713 88
199 3300006931 Ga0097620_100001453 Ga0097620_10000145320 88
200 3300006931 Ga0097620_100713989 Ga0097620_1007139892 88
201 3300006946 Ga0079104_1019822 Ga0079104_10198222 88
202 3300009011 Ga0105251_10369950 Ga0105251_103699501 88
203 3300009092 Ga0105250_10134755 Ga0105250_101347552 88
204 3300009093 Ga0105240_10020797 Ga0105240_1002079710 88
205 3300009093 Ga0105240_10130509 Ga0105240_101305092 88
206 3300009094 Ga0111539_10780109 Ga0111539_107801091 88
207 3300009101 Ga0105247_10000173 Ga0105247_1000017350 88
208 3300009148 Ga0105243_12041926 Ga0105243_120419262 88
209 3300009177 Ga0105248_10088557 Ga0105248_100885572 88
210 3300009177 Ga0105248_10500174 Ga0105248_105001743 88
211 3300009545 Ga0105237_11035356 Ga0105237_110353562 88
212 3300009545 Ga0105237_11454168 Ga0105237_114541681 88
213 3300009553 Ga0105249_10095447 Ga0105249_100954471 88
214 3300009553 Ga0105249_10211249 Ga0105249_102112492 88
215 3300009553 Ga0105249_10364541 Ga0105249_103645412 88
216 3300010375 Ga0105239_10746083 Ga0105239_107460832 88
217 3300013104 Ga0157370_11226914 Ga0157370_112269142 88
218 3300013105 Ga0157369_10003548 Ga0157369_100035482 88
219 3300013105 Ga0157369_10114420 Ga0157369_101144202 88
220 3300013105 Ga0157369_10186208 Ga0157369_101862083 88
221 3300013306 Ga0163162_10005422 Ga0163162_100054223 88
222 3300013306 Ga0163162_10402679 Ga0163162_104026792 88
223 3300013306 Ga0163162_11956208 Ga0163162_119562081 88
224 3300013307 Ga0157372_10026587 Ga0157372_100265874 88
225 3300013308 Ga0157375_10004067 Ga0157375_100040675 88
226 3300013308 Ga0157375_10304155 Ga0157375_103041551 88
227 3300014325 Ga0163163_11347006 Ga0163163_113470062 88
228 3300014325 Ga0163163_13252395 Ga0163163_132523952 88
229 3300014326 Ga0157380_10005230 Ga0157380_100052302 88
230 3300014326 Ga0157380_10454427 Ga0157380_104544272 88
231 3300014326 Ga0157380_10816708 Ga0157380_108167082 88
232 3300014326 Ga0157380_11331314 Ga0157380_113313141 88
233 3300014497 Ga0182008_10060436 Ga0182008_100604363 88
234 3300014968 Ga0157379_12231870 Ga0157379_122318701 88
235 3300014969 Ga0157376_10261278 Ga0157376_102612781 88
236 3300014969 Ga0157376_12746831 Ga0157376_127468311 88
237 3300017792 Ga0163161_10077016 Ga0163161_100770161 88
238 3300017792 Ga0163161_10574447 Ga0163161_105744472 88
239 3300020070 Ga0206356_11401385 Ga0206356_114013852 88
240 3300020075 Ga0206349_1138132 Ga0206349_11381322 88
241 3300025226 Ga0209674_100016 Ga0209674_10001694 88
242 3300025231 Ga0207427_100117 Ga0207427_10011779 88
243 3300025233 Ga0209437_100240 Ga0209437_10024033 88
244 3300025261 Ga0209233_1000083 Ga0209233_1000083302 88
245 3300025261 Ga0209233_1000417 Ga0209233_100041733 88
246 3300025284 Ga0209130_1006914 Ga0209130_10069142 88
247 3300025291 Ga0209675_1009967 Ga0209675_10099674 88
248 3300025292 Ga0209676_1000196 Ga0209676_1000196118 88
249 3300025292 Ga0209676_1001468 Ga0209676_10014685 88
250 3300025292 Ga0209676_1002369 Ga0209676_100236912 88
251 3300025292 Ga0209676_1002638 Ga0209676_10026389 88
252 3300025294 Ga0209025_1040515 Ga0209025_10405152 88
253 3300025295 Ga0209564_1003676 Ga0209564_10036769 88
254 3300025295 Ga0209564_1050524 Ga0209564_10505242 88
255 3300025298 Ga0209050_1001267 Ga0209050_100126715 88
256 3300025299 Ga0209256_1001647 Ga0209256_10016479 88
257 3300025303 Ga0209051_1017574 Ga0209051_10175743 88
258 3300025304 Ga0209257_1000356 Ga0209257_100035617 88
259 3300025304 Ga0209257_1002260 Ga0209257_100226015 88
260 3300025304 Ga0209257_1063166 Ga0209257_10631662 88
261 3300025315 Ga0207697_10414252 Ga0207697_104142521 88
262 3300025893 Ga0207682_10002667 Ga0207682_100026672 88
263 3300025900 Ga0207710_10000666 Ga0207710_100006664 88
264 3300025903 Ga0207680_10142508 Ga0207680_101425082 88
265 3300025903 Ga0207680_10290828 Ga0207680_102908281 88
266 3300025904 Ga0207647_10053567 Ga0207647_100535672 88
267 3300025907 Ga0207645_10145355 Ga0207645_101453552 88
268 3300025907 Ga0207645_11065424 Ga0207645_110654241 88
269 3300025908 Ga0207643_10005180 Ga0207643_100051803 88
270 3300025913 Ga0207695_10665359 Ga0207695_106653591 88
271 3300025914 Ga0207671_10382900 Ga0207671_103829002 88
272 3300025914 Ga0207671_10844770 Ga0207671_108447701 88
273 3300025916 Ga0207663_10005990 Ga0207663_100059904 88
274 3300025917 Ga0207660_10175567 Ga0207660_101755672 88
275 3300025923 Ga0207681_10218612 Ga0207681_102186122 88
276 3300025924 Ga0207694_10349512 Ga0207694_103495122 88
277 3300025925 Ga0207650_10062181 Ga0207650_100621812 88
278 3300025925 Ga0207650_10158305 Ga0207650_101583052 88
279 3300025925 Ga0207650_10200945 Ga0207650_102009452 88
280 3300025926 Ga0207659_10124650 Ga0207659_101246503 88
281 3300025926 Ga0207659_11311859 Ga0207659_113118592 88
282 3300025928 Ga0207700_11274102 Ga0207700_112741021 88
283 3300025931 Ga0207644_10004431 Ga0207644_100044314 88
284 3300025933 Ga0207706_10139977 Ga0207706_101399772 88
285 3300025933 Ga0207706_10156871 Ga0207706_101568712 88
286 3300025934 Ga0207686_10026819 Ga0207686_100268194 88
287 3300025936 Ga0207670_10111926 Ga0207670_101119263 88
288 3300025937 Ga0207669_10613784 Ga0207669_106137842 88
289 3300025938 Ga0207704_10019984 Ga0207704_100199843 88
290 3300025938 Ga0207704_11664913 Ga0207704_116649131 88
291 3300025940 Ga0207691_10064050 Ga0207691_100640502 88
292 3300025941 Ga0207711_10614322 Ga0207711_106143223 88
293 3300025945 Ga0207679_11844793 Ga0207679_118447932 88
294 3300025949 Ga0207667_10448962 Ga0207667_104489622 88
295 3300025960 Ga0207651_10044633 Ga0207651_100446334 88
296 3300025961 Ga0207712_10019704 Ga0207712_100197046 88
297 3300025961 Ga0207712_10042121 Ga0207712_100421213 88
298 3300025961 Ga0207712_10601830 Ga0207712_106018301 88
299 3300025972 Ga0207668_10364515 Ga0207668_103645152 88
300 3300025981 Ga0207640_10902652 Ga0207640_109026521 88
301 3300025986 Ga0207658_10004450 Ga0207658_100044506 88
302 3300025986 Ga0207658_10364542 Ga0207658_103645422 88
303 3300026023 Ga0207677_11979991 Ga0207677_119799911 88
304 3300026023 Ga0207677_12008107 Ga0207677_120081071 88
305 3300026035 Ga0207703_10000855 Ga0207703_1000085521 88
306 3300026041 Ga0207639_10681611 Ga0207639_106816112 88
307 3300026075 Ga0207708_10243051 Ga0207708_102430513 88
308 3300026078 Ga0207702_10374878 Ga0207702_103748782 88
309 3300026078 Ga0207702_11158382 Ga0207702_111583822 88
310 3300026088 Ga0207641_10064577 Ga0207641_100645772 88
311 3300026088 Ga0207641_11745301 Ga0207641_117453012 88
312 3300026089 Ga0207648_10014132 Ga0207648_100141326 88
313 3300026089 Ga0207648_10091881 Ga0207648_100918812 88
314 3300026095 Ga0207676_10214421 Ga0207676_102144212 88
315 3300026095 Ga0207676_10495252 Ga0207676_104952521 88
316 3300026116 Ga0207674_12198847 Ga0207674_121988471 88
317 3300026118 Ga0207675_100010773 Ga0207675_1000107734 88
318 3300026118 Ga0207675_100019991 Ga0207675_1000199912 88
319 3300026118 Ga0207675_100188519 Ga0207675_1001885192 88
320 3300026118 Ga0207675_100308367 Ga0207675_1003083672 88
321 3300026118 Ga0207675_100456389 Ga0207675_1004563892 88
322 3300026121 Ga0207683_10098943 Ga0207683_100989433 88
323 3300026121 Ga0207683_10391788 Ga0207683_103917883 88
324 3300026142 Ga0207698_11060015 Ga0207698_110600152 88
325 3300026142 Ga0207698_12169898 Ga0207698_121698981 88
326 3300026142 Ga0207698_12227785 Ga0207698_122277852 88
327 3300027111 Ga0209281_1012480 Ga0209281_10124803 88
328 3300027312 Ga0209371_1000075 Ga0209371_100007565 88
329 3300028379 Ga0268266_10045112 Ga0268266_100451121 88
330 3300028379 Ga0268266_10331544 Ga0268266_103315442 88
331 3300028379 Ga0268266_10988078 Ga0268266_109880782 88
332 3300028380 Ga0268265_10228255 Ga0268265_102282552 88
333 3300028380 Ga0268265_10239976 Ga0268265_102399763 88
334 3300028380 Ga0268265_10730565 Ga0268265_107305652 88
335 3300028381 Ga0268264_10014540 Ga0268264_100145404 88
336 3300028381 Ga0268264_10061954 Ga0268264_100619543 88
337 3300028381 Ga0268264_10800077 Ga0268264_108000772 88
338 3300028381 Ga0268264_11163249 Ga0268264_111632491 88
339 3300028563 Ga0265319_1048759 Ga0265319_10487592 88
340 3300028573 Ga0265334_10000089 Ga0265334_100000898 88
341 3300028577 Ga0265318_10010901 Ga0265318_100109011 88
342 3300028800 Ga0265338_10007138 Ga0265338_1000713814 88
343 3300029957 Ga0265324_10104971 Ga0265324_101049711 88
344 3300030500 Ga0268256_1000068 Ga0268256_1000068132 88
345 3300030521 Ga0307511_10000112 Ga0307511_1000011230 88
346 3300030521 Ga0307511_10060866 Ga0307511_100608662 88
347 3300031235 Ga0265330_10002999 Ga0265330_100029994 88
348 3300031235 Ga0265330_10463576 Ga0265330_104635762 88
349 3300031238 Ga0265332_10004069 Ga0265332_100040691 88
350 3300031238 Ga0265332_10183024 Ga0265332_101830242 88
351 3300031239 Ga0265328_10245454 Ga0265328_102454541 88
352 3300031240 Ga0265320_10199525 Ga0265320_101995252 88
353 3300031241 Ga0265325_10001937 Ga0265325_100019374 88
354 3300031249 Ga0265339_10054812 Ga0265339_100548122 88
355 3300031249 Ga0265339_10108665 Ga0265339_101086652 88
356 3300031250 Ga0265331_10060184 Ga0265331_100601842 88
357 3300031251 Ga0265327_10000027 Ga0265327_10000027146 88
358 3300031344 Ga0265316_10436333 Ga0265316_104363331 88
359 3300031456 Ga0307513_10055934 Ga0307513_100559342 88
360 3300031456 Ga0307513_11108846 Ga0307513_111088462 88
361 3300031595 Ga0265313_10019234 Ga0265313_100192344 88
362 3300031616 Ga0307508_10312605 Ga0307508_103126052 88
363 3300031616 Ga0307508_10549218 Ga0307508_105492182 88
364 3300031665 Ga0316575_10174474 Ga0316575_101744742 88
365 3300031711 Ga0265314_10014486 Ga0265314_100144864 88
366 3300031711 Ga0265314_10205592 Ga0265314_102055923 88
367 3300031712 Ga0265342_10012744 Ga0265342_100127444 88
368 3300031712 Ga0265342_10018193 Ga0265342_100181933 88
369 3300031727 Ga0316576_10645674 Ga0316576_106456741 88
370 3300031727 Ga0316576_10756393 Ga0316576_107563932 88
371 3300031727 Ga0316576_10907942 Ga0316576_109079422 88
372 3300031728 Ga0316578_10110274 Ga0316578_101102741 88
373 3300031730 Ga0307516_10021678 Ga0307516_100216783 88
374 3300031824 Ga0307413_10993479 Ga0307413_109934791 88
375 3300031852 Ga0307410_10148771 Ga0307410_101487711 88
376 3300031901 Ga0307406_10703895 Ga0307406_107038951 88
377 3300031903 Ga0307407_10243223 Ga0307407_102432232 88
378 3300031995 Ga0307409_100401395 Ga0307409_1004013952 88
379 3300032002 Ga0307416_101529984 Ga0307416_1015299841 88
380 3300032005 Ga0307411_10139084 Ga0307411_101390843 88
381 3300032005 Ga0307411_11111043 Ga0307411_111110432 88
382 3300032139 Ga0316580_10016325 Ga0316580_100163252 88
383 3300034957 Ga0373938_0172900 Ga0373938_0172900_249_515 88
384 3300035113 Ga0373936_0002456 Ga0373936_0002456_3384_3650 88
385 3300035398 Ga0316574_0018957 Ga0316574_0018957_190_456 88
386 3300035398 Ga0316574_0992750 Ga0316574_0992750_85_351 88
387 3300036647 Ga0316582_0087525 Ga0316582_0087525_1272_1538 88
388 3300036712 Ga0316584_0137508 Ga0316584_0137508_317_583 88
389 3300037466 Ga0395898_0174813 Ga0395898_0174813_448_714 88
390 3300037471 Ga0395905_0055313 Ga0395905_0055313_123_389 88
391 3300038443 Ga0395901_0008721 Ga0395901_0008721_1670_1936 88
392 3300041451 Ga0451791_0330967 Ga0451791_0330967_578_844 88
393 3300041453 Ga0451797_0525625 Ga0451797_0525625_357_623 88
394 3300041496 Ga0451839_0926928 Ga0451839_0926928_362_628 88
395 3300041498 Ga0451841_0143415 Ga0451841_0143415_629_895 88
396 3300041498 Ga0451841_1299822 Ga0451841_1299822_46_312 88
397 3300041501 Ga0451845_0161850 Ga0451845_0161850_155_442 88
398 3300041505 Ga0451849_0461382 Ga0451849_0461382_573_839 88
399 3300041505 Ga0451849_0957858 Ga0451849_0957858_258_536 88
400 3300041507 Ga0451851_0438943 Ga0451851_0438943_185_451 88
401 3300041509 Ga0451843_1222740 Ga0451843_1222740_384_650 88
402 3300041509 Ga0451843_1529574 Ga0451843_1529574_417_683 88
403 3300042010 Ga0439452_010484 Ga0439452_010484_369_635 88
404 3300042145 Ga0450906_044706 Ga0450906_044706_116_382 88
405 3300042876 Ga0451577_0015537 Ga0451577_0015537_4386_4652 88
406 3300044656 Ga0466969_0032559 Ga0466969_0032559_826_1092 88
407 3300044658 Ga0466972_0188148 Ga0466972_0188148_687_953 88
408 3300044684 Ga0466966_0010105 Ga0466966_0010105_3453_3719 88
409 3300044712 Ga0453684_0010616 Ga0453684_0010616_8884_9150 88
410 3300044712 Ga0453684_1315259 Ga0453684_1315259_284_550 88
411 3300044765 Ga0466970_0931331 Ga0466970_0931331_181_447 88
412 3300045049 Ga0466959_0002148 Ga0466959_0002148_8327_8593 88
413 3300045049 Ga0466959_0042999 Ga0466959_0042999_1944_2210 88
414 3300045051 Ga0451576_2630017 Ga0451576_2630017_175_441 88
415 3300046460 Ga0495638_0078582 Ga0495638_0078582_552_818 88
416 3300046460 Ga0495638_0440958 Ga0495638_0440958_51_317 88
417 3300046471 Ga0495650_0016936 Ga0495650_0016936_2984_3250 88
418 3300046471 Ga0495650_0199536 Ga0495650_0199536_237_503 88
419 3300046519 Ga0495632_0141625 Ga0495632_0141625_241_507 88
420 3300046539 Ga0495621_0227454 Ga0495621_0227454_463_729 88
421 3300046558 Ga0495633_0040355 Ga0495633_0040355_1586_1852 88
422 3300046660 Ga0495625_0028658 Ga0495625_0028658_1507_1773 88
423 3300046660 Ga0495625_0045648 Ga0495625_0045648_2210_2476 88
424 3300046675 Ga0495657_0620187 Ga0495657_0620187_237_503 88
425 3300046691 Ga0495670_0726387 Ga0495670_0726387_73_339 88
426 3300047322 Ga0495680_0877039 Ga0495680_0877039_46_312 88
427 3300048907 Ga0496104_0047693 Ga0496104_0047693_2183_2449 88
428 3300048907 Ga0496104_0611785 Ga0496104_0611785_722_988 88
429 3300048907 Ga0496104_1836392 Ga0496104_1836392_118_384 88
430 3300048908 Ga0496105_0082258 Ga0496105_0082258_568_834 88
431 3300048915 Ga0496112_0452055 Ga0496112_0452055_168_434 88
432 3300048916 Ga0496113_0055996 Ga0496113_0055996_1760_2026 88
433 3300048918 Ga0496115_0000782 Ga0496115_0000782_16348_16614 88
434 3300048919 Ga0496116_0241377 Ga0496116_0241377_148_414 88
435 3300048920 Ga0496117_0001663 Ga0496117_0001663_3869_4135 88
436 3300048921 Ga0496118_0031793 Ga0496118_0031793_4002_4268 88
437 3300048921 Ga0496118_0035543 Ga0496118_0035543_2658_2924 88
438 3300048921 Ga0496118_0114282 Ga0496118_0114282_576_842 88
439 3300048922 Ga0496119_0000177 Ga0496119_0000177_50302_50568 88
440 3300048922 Ga0496119_0001108 Ga0496119_0001108_31885_32151 88
441 3300048922 Ga0496119_0350274 Ga0496119_0350274_237_503 88
442 3300048923 Ga0496120_0000188 Ga0496120_0000188_31869_32135 88
443 3300048923 Ga0496120_0000328 Ga0496120_0000328_53702_53968 88
444 3300048923 Ga0496120_0109591 Ga0496120_0109591_690_956 88
445 3300048924 Ga0496121_0025636 Ga0496121_0025636_2338_2604 88
446 3300048924 Ga0496121_0151460 Ga0496121_0151460_1298_1564 88
447 3300048925 Ga0496122_0000209 Ga0496122_0000209_76200_76466 88
448 3300048925 Ga0496122_0242202 Ga0496122_0242202_166_432 88
449 3300048926 Ga0496123_0000106 Ga0496123_0000106_113554_113820 88
450 3300048926 Ga0496123_0341377 Ga0496123_0341377_80_346 88
451 3300048927 Ga0496124_0000401 Ga0496124_0000401_25103_25369 88
452 3300048928 Ga0496125_0002206 Ga0496125_0002206_22529_22795 88
453 3300048928 Ga0496125_0038336 Ga0496125_0038336_3203_3469 88
454 3300048929 Ga0496126_0002462 Ga0496126_0002462_3280_3546 88
455 3300049459 Ga0495678_230501 Ga0495678_230501_272_538 88
456 3300049568 Ga0501031_0001097 Ga0501031_0001097_5033_5299 88
457 3300049568 Ga0501031_0213687 Ga0501031_0213687_80_346 88
458 3300049569 Ga0501032_0005261 Ga0501032_0005261_3721_3987 88
459 3300049569 Ga0501032_0014161 Ga0501032_0014161_2594_2860 88
460 3300049569 Ga0501032_0756536 Ga0501032_0756536_55_321 88
461 3300049570 Ga0501033_0000720 Ga0501033_0000720_2116_2382 88
462 3300049570 Ga0501033_0014033 Ga0501033_0014033_2522_2788 88
463 3300049570 Ga0501033_0031736 Ga0501033_0031736_1729_1995 88
464 3300049571 Ga0501034_0002484 Ga0501034_0002484_7544_7810 88
465 3300049571 Ga0501034_0004188 Ga0501034_0004188_2244_2510 88
466 3300049571 Ga0501034_0714230 Ga0501034_0714230_599_865 88
467 3300049572 Ga0501036_0007244 Ga0501036_0007244_2786_3052 88
468 3300049572 Ga0501036_0007930 Ga0501036_0007930_6178_6444 88
469 3300049572 Ga0501036_0160322 Ga0501036_0160322_369_635 88
470 3300049572 Ga0501036_0284259 Ga0501036_0284259_299_565 88
471 3300049573 Ga0501037_0001245 Ga0501037_0001245_2812_3078 88
472 3300049573 Ga0501037_0283164 Ga0501037_0283164_354_620 88
473 3300049574 Ga0501038_0000673 Ga0501038_0000673_17568_17834 88
474 3300049574 Ga0501038_0842244 Ga0501038_0842244_188_454 88
475 3300049575 Ga0501039_0002430 Ga0501039_0002430_4359_4625 88
476 3300049575 Ga0501039_0005379 Ga0501039_0005379_1718_1984 88
477 3300049575 Ga0501039_0052721 Ga0501039_0052721_1969_2235 88
478 3300049576 Ga0501040_0030210 Ga0501040_0030210_1005_1271 88
479 3300049578 Ga0501042_0000212 Ga0501042_0000212_24098_24364 88
480 3300049578 Ga0501042_0703901 Ga0501042_0703901_248_514 88
481 3300049579 Ga0501043_0003203 Ga0501043_0003203_10693_10959 88
482 3300049579 Ga0501043_0014430 Ga0501043_0014430_4473_4739 88
483 3300049579 Ga0501043_0028000 Ga0501043_0028000_2817_3083 88
484 3300049579 Ga0501043_0088572 Ga0501043_0088572_736_1002 88
485 3300049580 Ga0501046_0002962 Ga0501046_0002962_6800_7066 88
486 3300049580 Ga0501046_0013109 Ga0501046_0013109_837_1103 88
487 3300049580 Ga0501046_0013611 Ga0501046_0013611_3490_3756 88
488 3300049581 Ga0501047_0005546 Ga0501047_0005546_5499_5765 88
489 3300049581 Ga0501047_0034653 Ga0501047_0034653_672_938 88
490 3300049581 Ga0501047_0107772 Ga0501047_0107772_1699_1965 88
491 3300049581 Ga0501047_0208807 Ga0501047_0208807_733_999 88
492 3300049582 Ga0501048_0069337 Ga0501048_0069337_1314_1580 88
493 3300049582 Ga0501048_0095168 Ga0501048_0095168_1485_1751 88
494 3300049583 Ga0501067_0009020 Ga0501067_0009020_4307_4573 88
495 3300049583 Ga0501067_0041945 Ga0501067_0041945_285_551 88
496 3300049583 Ga0501067_0233470 Ga0501067_0233470_648_914 88
497 3300049585 Ga0501069_0055903 Ga0501069_0055903_1371_1637 88
498 3300049585 Ga0501069_0126607 Ga0501069_0126607_1071_1337 88
499 3300049586 Ga0501070_0056925 Ga0501070_0056925_1113_1379 88
500 3300049586 Ga0501070_0059406 Ga0501070_0059406_2682_2948 88
501 3300049586 Ga0501070_0138229 Ga0501070_0138229_1444_1710 88
502 3300049586 Ga0501070_0227269 Ga0501070_0227269_942_1208 88
503 3300049587 Ga0501071_0008741 Ga0501071_0008741_2446_2712 88
504 3300049587 Ga0501071_0095677 Ga0501071_0095677_1320_1586 88
505 3300049588 Ga0501072_0071696 Ga0501072_0071696_1672_1938 88
506 3300049589 Ga0501073_0016778 Ga0501073_0016778_2420_2686 88
507 3300049589 Ga0501073_0050715 Ga0501073_0050715_398_664 88
508 3300049589 Ga0501073_0989987 Ga0501073_0989987_62_328 88
509 3300049590 Ga0501074_0008025 Ga0501074_0008025_3550_3816 88
510 3300049590 Ga0501074_0025724 Ga0501074_0025724_1226_1492 88
511 3300049591 Ga0501075_0240312 Ga0501075_0240312_130_396 88
512 3300049741 Ga0501079_0016173 Ga0501079_0016173_3829_4095 88
513 3300049741 Ga0501079_0034570 Ga0501079_0034570_2466_2732 88
514 3300049742 Ga0501080_0021473 Ga0501080_0021473_4370_4636 88
515 3300049742 Ga0501080_0390689 Ga0501080_0390689_672_938 88
516 3300049742 Ga0501080_0460279 Ga0501080_0460279_80_346 88
517 3300049743 Ga0501081_0082346 Ga0501081_0082346_231_497 88
518 3300049744 Ga0501083_0016466 Ga0501083_0016466_3843_4109 88
519 3300049822 Ga0501035_0004344 Ga0501035_0004344_12548_12814 88
520 3300049822 Ga0501035_0021681 Ga0501035_0021681_4422_4688 88
521 3300049822 Ga0501035_0028763 Ga0501035_0028763_4408_4674 88
522 3300049823 Ga0501044_0006784 Ga0501044_0006784_5561_5827 88
523 3300049823 Ga0501044_0016545 Ga0501044_0016545_2244_2510 88
524 3300049823 Ga0501044_0114223 Ga0501044_0114223_2119_2385 88
525 3300049824 Ga0501045_0078084 Ga0501045_0078084_1881_2147 88
526 3300049824 Ga0501045_0447055 Ga0501045_0447055_25_291 88
527 3300050509 nmdc:mga0qj67_9876_c1 nmdc:mga0qj67_9876_c1_2259_2525 88
528 3300053088 Ga0500644_0029071 Ga0500644_0029071_1382_1648 88
529 3300053105 Ga0500557_102851 Ga0500557_102851_604_870 88
530 3300053111 Ga0500572_093531 Ga0500572_093531_62_328 88
531 3300053115 Ga0500591_144680 Ga0500591_144680_446_712 88
532 3300053159 Ga0500630_070629 Ga0500630_070629_687_953 88
533 3300053163 Ga0500639_198171 Ga0500639_198171_277_543 88
534 3300054114 Ga0501084_0062028 Ga0501084_0062028_1616_1882 88
535 3300054114 Ga0501084_0198135 Ga0501084_0198135_601_867 88
536 3300060353 Ga0501082_0054243 Ga0501082_0054243_2756_3022 88
537 3300060353 Ga0501082_0348151 Ga0501082_0348151_184_450 88
538 3300061734 Ga0530510_0087572 Ga0530510_0087572_157_423 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

44

80

0.91

Feature Viewer

pLDDT pTM Quality
73.1 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map