F460975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 538 | 330 | 504 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10245041|rootH2_102450412 |
| Length | 99 |
| Sequence | LRSGKIDEENAVATGWAGDGAVQDQIDATVHDAVMRAKNNLPTGPSLTHCEECQAEIPEARRVAMPGVHLCVTCQEHHDRETQNFSGYNRRGSKDSQLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 4 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 5 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 6 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 7 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 11 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 12 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 13 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 14 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 15 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 16 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 17 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 18 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 19 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 20 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 21 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 22 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 23 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 24 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 25 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 26 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 27 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 28 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 29 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 30 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 215 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 238 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 239 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 240 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 241 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 242 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 243 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 318 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 321 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 326 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 327 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 328 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 329 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 330 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.75 |
| Metatranscriptomes | 0.93 |
| Isolates | 6.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 6.13 |
| Nodule | 0.37 |
| Rhizoplane | 2.42 |
| Rhizosphere | 79.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_859695 | 2162886006 | Bacteria | 1823 |
| 2 | SwRhRL2b_contig_1363613 | 2162886007 | Bacteria | 2227 |
| 3 | JGI24737J22298_10089389 | 3300001990 | Bacteria | 914 |
| 4 | JGI24735J21928_10003683 | 3300002067 | Bacteria | 5194 |
| 5 | rootH2_10131900 | 3300003320 | Bacteria | 1641 |
| 6 | rootH2_10245041 | 3300003320 | Bacteria | 1096 |
| 7 | Ga0055536_1000970 | 3300003781 | Bacteria | 18283 |
| 8 | Ga0055536_1011213 | 3300003781 | Bacteria | 3465 |
| 9 | Ga0055530_10000993 | 3300003791 | Bacteria | 22741 |
| 10 | Ga0055531_10013615 | 3300003794 | Bacteria | 3734 |
| 11 | Ga0055531_10048434 | 3300003794 | Bacteria | 1146 |
| 12 | Ga0058692_1000055 | 3300003856 | Bacteria | 105550 |
| 13 | Ga0065704_10071085 | 3300005289 | Bacteria | 13278 |
| 14 | Ga0065715_10967946 | 3300005293 | Bacteria | 544 |
| 15 | Ga0065707_10082037 | 3300005295 | Bacteria | 23924 |
| 16 | Ga0065707_10083710 | 3300005295 | Bacteria | 8403 |
| 17 | Ga0070658_11023626 | 3300005327 | Bacteria | 718 |
| 18 | Ga0070670_100004160 | 3300005331 | Bacteria | 12104 |
| 19 | Ga0070670_100202268 | 3300005331 | Bacteria | 1726 |
| 20 | Ga0070670_101595674 | 3300005331 | Bacteria | 600 |
| 21 | Ga0068869_100053188 | 3300005334 | Bacteria | 2942 |
| 22 | Ga0070666_10065753 | 3300005335 | Bacteria | 2460 |
| 23 | Ga0070666_10182935 | 3300005335 | Bacteria | 1470 |
| 24 | Ga0070682_100072394 | 3300005337 | Bacteria | 2209 |
| 25 | Ga0068868_100118245 | 3300005338 | Bacteria | 2160 |
| 26 | Ga0068868_100521948 | 3300005338 | Bacteria | 1043 |
| 27 | Ga0070689_100098231 | 3300005340 | Bacteria | 2316 |
| 28 | Ga0070691_10123409 | 3300005341 | Bacteria | 1306 |
| 29 | Ga0070692_10331493 | 3300005345 | Bacteria | 939 |
| 30 | Ga0070668_100411904 | 3300005347 | Bacteria | 1156 |
| 31 | Ga0070668_101185923 | 3300005347 | Unclassified | 691 |
| 32 | Ga0070668_101533488 | 3300005347 | Bacteria | 609 |
| 33 | Ga0070669_100076573 | 3300005353 | Bacteria | 2483 |
| 34 | Ga0070669_100217975 | 3300005353 | Bacteria | 1508 |
| 35 | Ga0070675_100040018 | 3300005354 | Bacteria | 3826 |
| 36 | Ga0070671_100001380 | 3300005355 | Bacteria | 18139 |
| 37 | Ga0070674_100064798 | 3300005356 | Bacteria | 2562 |
| 38 | Ga0070673_100020751 | 3300005364 | Bacteria | 4744 |
| 39 | Ga0070688_100032930 | 3300005365 | Bacteria | 3130 |
| 40 | Ga0070688_100671076 | 3300005365 | Bacteria | 800 |
| 41 | Ga0070667_100077067 | 3300005367 | Bacteria | 2847 |
| 42 | Ga0070713_101603764 | 3300005436 | Bacteria | 632 |
| 43 | Ga0070700_100232517 | 3300005441 | Bacteria | 1313 |
| 44 | Ga0070678_100073688 | 3300005456 | Bacteria | 2563 |
| 45 | Ga0070662_100290273 | 3300005457 | Bacteria | 1326 |
| 46 | Ga0068867_100041432 | 3300005459 | Bacteria | 3366 |
| 47 | Ga0068867_100055110 | 3300005459 | Bacteria | 2939 |
| 48 | Ga0070685_10252352 | 3300005466 | Bacteria | 1169 |
| 49 | Ga0070679_100017777 | 3300005530 | Bacteria | 6884 |
| 50 | Ga0070679_100045539 | 3300005530 | Bacteria | 4371 |
| 51 | Ga0068853_100726574 | 3300005539 | Bacteria | 948 |
| 52 | Ga0070672_100104839 | 3300005543 | Bacteria | 2298 |
| 53 | Ga0070672_100221160 | 3300005543 | Bacteria | 1588 |
| 54 | Ga0070686_100057119 | 3300005544 | Bacteria | 2506 |
| 55 | Ga0070686_100101699 | 3300005544 | Bacteria | 1943 |
| 56 | Ga0070665_100054361 | 3300005548 | Bacteria | 4016 |
| 57 | Ga0070665_100123241 | 3300005548 | Bacteria | 2594 |
| 58 | Ga0070665_100364906 | 3300005548 | Bacteria | 1450 |
| 59 | Ga0070665_101292238 | 3300005548 | Bacteria | 740 |
| 60 | Ga0070665_101901222 | 3300005548 | Bacteria | 601 |
| 61 | Ga0068855_100074335 | 3300005563 | Bacteria | 3948 |
| 62 | Ga0068855_101698437 | 3300005563 | Bacteria | 644 |
| 63 | Ga0068855_102517679 | 3300005563 | Bacteria | 512 |
| 64 | Ga0070664_101347100 | 3300005564 | Bacteria | 674 |
| 65 | Ga0068857_101698805 | 3300005577 | Bacteria | 617 |
| 66 | Ga0068854_100033542 | 3300005578 | Bacteria | 3580 |
| 67 | Ga0068856_100041848 | 3300005614 | Bacteria | 4504 |
| 68 | Ga0068856_102547393 | 3300005614 | Bacteria | 518 |
| 69 | Ga0068852_100392849 | 3300005616 | Bacteria | 1363 |
| 70 | Ga0068852_101049734 | 3300005616 | Bacteria | 834 |
| 71 | Ga0068859_100001453 | 3300005617 | Bacteria | 24054 |
| 72 | Ga0068859_100713974 | 3300005617 | Bacteria | 1093 |
| 73 | Ga0068859_101670018 | 3300005617 | Bacteria | 704 |
| 74 | Ga0068864_100163574 | 3300005618 | Bacteria | 2024 |
| 75 | Ga0068864_102274242 | 3300005618 | Bacteria | 549 |
| 76 | Ga0068861_100000904 | 3300005719 | Bacteria | 18021 |
| 77 | Ga0068861_100157462 | 3300005719 | Bacteria | 1870 |
| 78 | Ga0068861_100223257 | 3300005719 | Bacteria | 1593 |
| 79 | Ga0068861_100790355 | 3300005719 | Bacteria | 890 |
| 80 | Ga0068870_10181253 | 3300005840 | Bacteria | 1264 |
| 81 | Ga0068863_100005193 | 3300005841 | Bacteria | 12847 |
| 82 | Ga0068863_100094897 | 3300005841 | Bacteria | 2831 |
| 83 | Ga0068863_100229123 | 3300005841 | Bacteria | 1792 |
| 84 | Ga0068863_102005194 | 3300005841 | Bacteria | 589 |
| 85 | Ga0068858_100001329 | 3300005842 | Bacteria | 25527 |
| 86 | Ga0068858_100062404 | 3300005842 | Bacteria | 3445 |
| 87 | Ga0068860_100012186 | 3300005843 | Bacteria | 8470 |
| 88 | Ga0068860_100181873 | 3300005843 | Bacteria | 2032 |
| 89 | Ga0068860_101040997 | 3300005843 | Bacteria | 837 |
| 90 | Ga0068862_100071800 | 3300005844 | Bacteria | 2989 |
| 91 | Ga0068862_100622121 | 3300005844 | Unclassified | 1039 |
| 92 | Ga0081540_1003092 | 3300005983 | Bacteria | 13333 |
| 93 | Ga0070712_100375695 | 3300006175 | Bacteria | 1169 |
| 94 | Ga0070712_101520287 | 3300006175 | Bacteria | 585 |
| 95 | Ga0097621_100107958 | 3300006237 | Bacteria | 2349 |
| 96 | Ga0097621_100351340 | 3300006237 | Bacteria | 1311 |
| 97 | Ga0097621_100541663 | 3300006237 | Bacteria | 1058 |
| 98 | Ga0097621_100745152 | 3300006237 | Bacteria | 904 |
| 99 | Ga0097621_101107441 | 3300006237 | Bacteria | 744 |
| 100 | Ga0068871_100043575 | 3300006358 | Bacteria | 3605 |
| 101 | Ga0068871_100070677 | 3300006358 | Bacteria | 2869 |
| 102 | Ga0068871_100378886 | 3300006358 | Bacteria | 1256 |
| 103 | Ga0068871_101707333 | 3300006358 | Bacteria | 597 |
| 104 | Ga0075430_100016289 | 3300006846 | Bacteria | 6332 |
| 105 | Ga0075429_100001826 | 3300006880 | Bacteria | 17622 |
| 106 | Ga0068865_100088371 | 3300006881 | Bacteria | 2242 |
| 107 | Ga0068865_100108835 | 3300006881 | Bacteria | 2041 |
| 108 | Ga0068865_100557206 | 3300006881 | Bacteria | 963 |
| 109 | Ga0097620_100001453 | 3300006931 | Bacteria | 24054 |
| 110 | Ga0097620_100713989 | 3300006931 | Bacteria | 1093 |
| 111 | Ga0097620_101669980 | 3300006931 | Bacteria | 704 |
| 112 | Ga0079104_1019822 | 3300006946 | Bacteria | 1867 |
| 113 | Ga0105251_10369950 | 3300009011 | Bacteria | 656 |
| 114 | Ga0105250_10134755 | 3300009092 | Unclassified | 1021 |
| 115 | Ga0105240_10020797 | 3300009093 | Bacteria | 8741 |
| 116 | Ga0105240_10130509 | 3300009093 | Bacteria | 3015 |
| 117 | Ga0111539_10780109 | 3300009094 | Bacteria | 1112 |
| 118 | Ga0105245_10040120 | 3300009098 | Bacteria | 4169 |
| 119 | Ga0105247_10000173 | 3300009101 | Bacteria | 63815 |
| 120 | Ga0114129_10001307 | 3300009147 | Bacteria | 33269 |
| 121 | Ga0105243_10343169 | 3300009148 | Bacteria | 1369 |
| 122 | Ga0105243_12041926 | 3300009148 | Bacteria | 608 |
| 123 | Ga0105242_10015093 | 3300009176 | Bacteria | 5994 |
| 124 | Ga0105242_10059544 | 3300009176 | Bacteria | 3134 |
| 125 | Ga0105248_10088557 | 3300009177 | Bacteria | 3484 |
| 126 | Ga0105248_10500174 | 3300009177 | Bacteria | 1370 |
| 127 | Ga0105248_10772837 | 3300009177 | Bacteria | 1084 |
| 128 | Ga0105237_11035356 | 3300009545 | Bacteria | 828 |
| 129 | Ga0105237_11454168 | 3300009545 | Bacteria | 692 |
| 130 | Ga0105249_10095447 | 3300009553 | Bacteria | 2788 |
| 131 | Ga0105249_10211249 | 3300009553 | Bacteria | 1905 |
| 132 | Ga0105249_10364541 | 3300009553 | Bacteria | 1467 |
| 133 | Ga0105249_11158665 | 3300009553 | Bacteria | 844 |
| 134 | Ga0105239_10746083 | 3300010375 | Bacteria | 1120 |
| 135 | Ga0157370_11226914 | 3300013104 | Bacteria | 676 |
| 136 | Ga0157369_10003548 | 3300013105 | Bacteria | 18530 |
| 137 | Ga0157369_10114420 | 3300013105 | Bacteria | 2865 |
| 138 | Ga0157369_10186208 | 3300013105 | Bacteria | 2183 |
| 139 | Ga0157374_10007594 | 3300013296 | Bacteria | 9253 |
| 140 | Ga0157374_10178227 | 3300013296 | Bacteria | 2075 |
| 141 | Ga0157378_10039081 | 3300013297 | Bacteria | 4208 |
| 142 | Ga0163162_10005422 | 3300013306 | Bacteria | 12327 |
| 143 | Ga0163162_10085655 | 3300013306 | Bacteria | 3228 |
| 144 | Ga0163162_10402679 | 3300013306 | Bacteria | 1501 |
| 145 | Ga0163162_11956208 | 3300013306 | Bacteria | 671 |
| 146 | Ga0157372_10026587 | 3300013307 | Bacteria | 6297 |
| 147 | Ga0157375_10004067 | 3300013308 | Bacteria | 12686 |
| 148 | Ga0157375_10304155 | 3300013308 | Bacteria | 1758 |
| 149 | Ga0157375_10345189 | 3300013308 | Bacteria | 1654 |
| 150 | Ga0163163_10189932 | 3300014325 | Bacteria | 2102 |
| 151 | Ga0163163_11347006 | 3300014325 | Bacteria | 775 |
| 152 | Ga0163163_13252395 | 3300014325 | Bacteria | 507 |
| 153 | Ga0157380_10005230 | 3300014326 | Bacteria | 9068 |
| 154 | Ga0157380_10454427 | 3300014326 | Bacteria | 1231 |
| 155 | Ga0157380_10816708 | 3300014326 | Bacteria | 951 |
| 156 | Ga0157380_11246572 | 3300014326 | Bacteria | 789 |
| 157 | Ga0157380_11331314 | 3300014326 | Bacteria | 766 |
| 158 | Ga0182008_10060436 | 3300014497 | Bacteria | 1868 |
| 159 | Ga0157379_12231870 | 3300014968 | Bacteria | 544 |
| 160 | Ga0157376_10012509 | 3300014969 | Bacteria | 6301 |
| 161 | Ga0157376_10261278 | 3300014969 | Bacteria | 1622 |
| 162 | Ga0157376_12746831 | 3300014969 | Bacteria | 532 |
| 163 | Ga0163161_10077016 | 3300017792 | Bacteria | 2449 |
| 164 | Ga0163161_10574447 | 3300017792 | Bacteria | 927 |
| 165 | Ga0197907_10031805 | 3300020069 | Bacteria | 1070 |
| 166 | Ga0206356_10157927 | 3300020070 | Bacteria | 781 |
| 167 | Ga0206356_11401385 | 3300020070 | Bacteria | 683 |
| 168 | Ga0206349_1138132 | 3300020075 | Bacteria | 625 |
| 169 | Ga0206353_10662671 | 3300020082 | Bacteria | 941 |
| 170 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 171 | Ga0207427_100117 | 3300025231 | Bacteria | 102251 |
| 172 | Ga0209437_100240 | 3300025233 | Bacteria | 89740 |
| 173 | Ga0209646_1005732 | 3300025246 | Bacteria | 2141 |
| 174 | Ga0209026_1000207 | 3300025250 | Bacteria | 81332 |
| 175 | Ga0209759_1056689 | 3300025256 | Bacteria | 571 |
| 176 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 177 | Ga0209233_1000417 | 3300025261 | Bacteria | 32180 |
| 178 | Ga0209455_1000535 | 3300025272 | Bacteria | 26363 |
| 179 | Ga0209130_1006914 | 3300025284 | Bacteria | 3592 |
| 180 | Ga0209675_1009967 | 3300025291 | Bacteria | 3294 |
| 181 | Ga0209676_1000196 | 3300025292 | Bacteria | 135726 |
| 182 | Ga0209676_1001468 | 3300025292 | Bacteria | 21920 |
| 183 | Ga0209676_1002369 | 3300025292 | Bacteria | 13564 |
| 184 | Ga0209676_1002638 | 3300025292 | Bacteria | 12223 |
| 185 | Ga0209025_1040515 | 3300025294 | Bacteria | 2013 |
| 186 | Ga0209564_1003676 | 3300025295 | Bacteria | 10130 |
| 187 | Ga0209564_1050524 | 3300025295 | Bacteria | 1017 |
| 188 | Ga0209050_1001267 | 3300025298 | Bacteria | 29081 |
| 189 | Ga0209256_1001647 | 3300025299 | Bacteria | 21722 |
| 190 | Ga0209051_1017574 | 3300025303 | Bacteria | 3192 |
| 191 | Ga0209257_1000356 | 3300025304 | Bacteria | 93656 |
| 192 | Ga0209257_1002260 | 3300025304 | Bacteria | 19684 |
| 193 | Ga0209257_1063166 | 3300025304 | Bacteria | 999 |
| 194 | Ga0207697_10414252 | 3300025315 | Bacteria | 598 |
| 195 | Ga0207682_10002667 | 3300025893 | Bacteria | 7948 |
| 196 | Ga0207642_10249906 | 3300025899 | Bacteria | 1006 |
| 197 | Ga0207710_10000666 | 3300025900 | Bacteria | 19351 |
| 198 | Ga0207680_10058161 | 3300025903 | Bacteria | 2342 |
| 199 | Ga0207680_10142508 | 3300025903 | Bacteria | 1590 |
| 200 | Ga0207680_10290828 | 3300025903 | Bacteria | 1137 |
| 201 | Ga0207647_10053567 | 3300025904 | Bacteria | 2485 |
| 202 | Ga0207645_10145355 | 3300025907 | Bacteria | 1546 |
| 203 | Ga0207645_11065424 | 3300025907 | Bacteria | 546 |
| 204 | Ga0207643_10005180 | 3300025908 | Bacteria | 6972 |
| 205 | Ga0207695_10665359 | 3300025913 | Bacteria | 922 |
| 206 | Ga0207671_10382900 | 3300025914 | Bacteria | 1118 |
| 207 | Ga0207671_10844770 | 3300025914 | Bacteria | 725 |
| 208 | Ga0207663_10005990 | 3300025916 | Bacteria | 6182 |
| 209 | Ga0207660_10175567 | 3300025917 | Bacteria | 1661 |
| 210 | Ga0207681_10218612 | 3300025923 | Bacteria | 1473 |
| 211 | Ga0207694_10349512 | 3300025924 | Bacteria | 1224 |
| 212 | Ga0207650_10062181 | 3300025925 | Bacteria | 2789 |
| 213 | Ga0207650_10158305 | 3300025925 | Bacteria | 1792 |
| 214 | Ga0207650_10200945 | 3300025925 | Bacteria | 1597 |
| 215 | Ga0207659_10124650 | 3300025926 | Bacteria | 1979 |
| 216 | Ga0207659_11311859 | 3300025926 | Bacteria | 621 |
| 217 | Ga0207687_10129410 | 3300025927 | Bacteria | 1900 |
| 218 | Ga0207700_11274102 | 3300025928 | Bacteria | 655 |
| 219 | Ga0207644_10004431 | 3300025931 | Bacteria | 9113 |
| 220 | Ga0207644_11213184 | 3300025931 | Bacteria | 634 |
| 221 | Ga0207706_10139977 | 3300025933 | Bacteria | 2129 |
| 222 | Ga0207706_10156871 | 3300025933 | Bacteria | 2001 |
| 223 | Ga0207686_10026819 | 3300025934 | Bacteria | 3366 |
| 224 | Ga0207686_10062876 | 3300025934 | Bacteria | 2359 |
| 225 | Ga0207670_10111926 | 3300025936 | Bacteria | 1969 |
| 226 | Ga0207669_10613784 | 3300025937 | Bacteria | 885 |
| 227 | Ga0207704_10019984 | 3300025938 | Bacteria | 3532 |
| 228 | Ga0207704_10089159 | 3300025938 | Bacteria | 2020 |
| 229 | Ga0207704_10207107 | 3300025938 | Bacteria | 1440 |
| 230 | Ga0207704_11664913 | 3300025938 | Bacteria | 548 |
| 231 | Ga0207691_10064050 | 3300025940 | Bacteria | 3332 |
| 232 | Ga0207711_10113149 | 3300025941 | Bacteria | 2416 |
| 233 | Ga0207711_10614322 | 3300025941 | Bacteria | 1014 |
| 234 | Ga0207689_10047696 | 3300025942 | Bacteria | 3534 |
| 235 | Ga0207679_11844793 | 3300025945 | Bacteria | 552 |
| 236 | Ga0207667_10448962 | 3300025949 | Bacteria | 1310 |
| 237 | Ga0207651_10044633 | 3300025960 | Bacteria | 2968 |
| 238 | Ga0207712_10019704 | 3300025961 | Bacteria | 4408 |
| 239 | Ga0207712_10042121 | 3300025961 | Bacteria | 3142 |
| 240 | Ga0207712_10601830 | 3300025961 | Bacteria | 951 |
| 241 | Ga0207668_10364515 | 3300025972 | Bacteria | 1212 |
| 242 | Ga0207640_10193977 | 3300025981 | Bacteria | 1533 |
| 243 | Ga0207640_10902652 | 3300025981 | Bacteria | 772 |
| 244 | Ga0207658_10004450 | 3300025986 | Bacteria | 9742 |
| 245 | Ga0207658_10364542 | 3300025986 | Bacteria | 1262 |
| 246 | Ga0207658_11362096 | 3300025986 | Bacteria | 649 |
| 247 | Ga0207677_10007213 | 3300026023 | Bacteria | 6128 |
| 248 | Ga0207677_11979991 | 3300026023 | Bacteria | 541 |
| 249 | Ga0207677_12008107 | 3300026023 | Unclassified | 538 |
| 250 | Ga0207703_10000855 | 3300026035 | Bacteria | 29877 |
| 251 | Ga0207703_10904714 | 3300026035 | Bacteria | 845 |
| 252 | Ga0207639_10681611 | 3300026041 | Bacteria | 953 |
| 253 | Ga0207678_10006781 | 3300026067 | Bacteria | 10151 |
| 254 | Ga0207678_10618807 | 3300026067 | Bacteria | 950 |
| 255 | Ga0207708_10243051 | 3300026075 | Bacteria | 1448 |
| 256 | Ga0207702_10374878 | 3300026078 | Bacteria | 1367 |
| 257 | Ga0207702_11158382 | 3300026078 | Bacteria | 767 |
| 258 | Ga0207641_10064577 | 3300026088 | Bacteria | 3129 |
| 259 | Ga0207641_10828004 | 3300026088 | Bacteria | 916 |
| 260 | Ga0207641_11745301 | 3300026088 | Bacteria | 624 |
| 261 | Ga0207641_12626015 | 3300026088 | Bacteria | 501 |
| 262 | Ga0207648_10014132 | 3300026089 | Bacteria | 7383 |
| 263 | Ga0207648_10091881 | 3300026089 | Bacteria | 2654 |
| 264 | Ga0207676_10214421 | 3300026095 | Bacteria | 1710 |
| 265 | Ga0207676_10495252 | 3300026095 | Bacteria | 1160 |
| 266 | Ga0207674_12198847 | 3300026116 | Bacteria | 515 |
| 267 | Ga0207675_100010773 | 3300026118 | Bacteria | 8568 |
| 268 | Ga0207675_100019991 | 3300026118 | Bacteria | 6248 |
| 269 | Ga0207675_100188519 | 3300026118 | Bacteria | 1977 |
| 270 | Ga0207675_100308367 | 3300026118 | Bacteria | 1543 |
| 271 | Ga0207675_100456389 | 3300026118 | Bacteria | 1267 |
| 272 | Ga0207683_10098943 | 3300026121 | Bacteria | 2603 |
| 273 | Ga0207683_10391788 | 3300026121 | Bacteria | 1277 |
| 274 | Ga0207698_11060015 | 3300026142 | Bacteria | 822 |
| 275 | Ga0207698_12169898 | 3300026142 | Bacteria | 568 |
| 276 | Ga0207698_12227785 | 3300026142 | Bacteria | 560 |
| 277 | Ga0209281_1012480 | 3300027111 | Bacteria | 1864 |
| 278 | Ga0209371_1000075 | 3300027312 | Bacteria | 196676 |
| 279 | Ga0268266_10045112 | 3300028379 | Bacteria | 3770 |
| 280 | Ga0268266_10310249 | 3300028379 | Bacteria | 1474 |
| 281 | Ga0268266_10331544 | 3300028379 | Bacteria | 1426 |
| 282 | Ga0268266_10988078 | 3300028379 | Bacteria | 814 |
| 283 | Ga0268265_10228255 | 3300028380 | Bacteria | 1634 |
| 284 | Ga0268265_10239976 | 3300028380 | Bacteria | 1599 |
| 285 | Ga0268265_10730565 | 3300028380 | Unclassified | 959 |
| 286 | Ga0268264_10014540 | 3300028381 | Bacteria | 6466 |
| 287 | Ga0268264_10061954 | 3300028381 | Bacteria | 3140 |
| 288 | Ga0268264_10800077 | 3300028381 | Bacteria | 942 |
| 289 | Ga0268264_11163249 | 3300028381 | Bacteria | 781 |
| 290 | Ga0265319_1048759 | 3300028563 | Bacteria | 1405 |
| 291 | Ga0265334_10000089 | 3300028573 | Bacteria | 65336 |
| 292 | Ga0265318_10010901 | 3300028577 | Bacteria | 3938 |
| 293 | Ga0265338_10007138 | 3300028800 | Bacteria | 13985 |
| 294 | Ga0265324_10104971 | 3300029957 | Bacteria | 960 |
| 295 | Ga0268256_1000068 | 3300030500 | Bacteria | 196676 |
| 296 | Ga0307511_10000112 | 3300030521 | Bacteria | 73319 |
| 297 | Ga0307511_10060866 | 3300030521 | Bacteria | 2884 |
| 298 | Ga0265330_10002999 | 3300031235 | Bacteria | 8979 |
| 299 | Ga0265330_10463576 | 3300031235 | Unclassified | 538 |
| 300 | Ga0265332_10004069 | 3300031238 | Bacteria | 6938 |
| 301 | Ga0265332_10183024 | 3300031238 | Bacteria | 872 |
| 302 | Ga0265328_10245454 | 3300031239 | Bacteria | 685 |
| 303 | Ga0265320_10199525 | 3300031240 | Bacteria | 893 |
| 304 | Ga0265325_10001937 | 3300031241 | Bacteria | 14276 |
| 305 | Ga0265339_10054812 | 3300031249 | Bacteria | 2164 |
| 306 | Ga0265339_10108665 | 3300031249 | Bacteria | 1437 |
| 307 | Ga0265331_10060184 | 3300031250 | Bacteria | 1794 |
| 308 | Ga0265327_10000027 | 3300031251 | Bacteria | 364541 |
| 309 | Ga0265316_10436333 | 3300031344 | Unclassified | 940 |
| 310 | Ga0307513_10055934 | 3300031456 | Bacteria | 4218 |
| 311 | Ga0307513_11108846 | 3300031456 | Unclassified | 504 |
| 312 | Ga0307408_100272797 | 3300031548 | Bacteria | 1405 |
| 313 | Ga0265313_10019234 | 3300031595 | Bacteria | 3809 |
| 314 | Ga0307508_10312605 | 3300031616 | Bacteria | 1163 |
| 315 | Ga0307508_10549218 | 3300031616 | Bacteria | 753 |
| 316 | Ga0316575_10174474 | 3300031665 | Bacteria | 892 |
| 317 | Ga0265314_10014486 | 3300031711 | Bacteria | 6304 |
| 318 | Ga0265314_10205592 | 3300031711 | Unclassified | 1160 |
| 319 | Ga0265342_10012744 | 3300031712 | Bacteria | 5680 |
| 320 | Ga0265342_10018193 | 3300031712 | Bacteria | 4558 |
| 321 | Ga0316576_10645674 | 3300031727 | Bacteria | 770 |
| 322 | Ga0316576_10756393 | 3300031727 | Bacteria | 701 |
| 323 | Ga0316576_10907942 | 3300031727 | Bacteria | 630 |
| 324 | Ga0316578_10110274 | 3300031728 | Bacteria | 1652 |
| 325 | Ga0307516_10021678 | 3300031730 | Bacteria | 6606 |
| 326 | Ga0307413_10993479 | 3300031824 | Bacteria | 719 |
| 327 | Ga0307410_10148771 | 3300031852 | Bacteria | 1741 |
| 328 | Ga0307406_10395120 | 3300031901 | Bacteria | 1094 |
| 329 | Ga0307406_10703895 | 3300031901 | Bacteria | 844 |
| 330 | Ga0307407_10243223 | 3300031903 | Bacteria | 1229 |
| 331 | Ga0307412_11658496 | 3300031911 | Bacteria | 585 |
| 332 | Ga0307412_12189446 | 3300031911 | Bacteria | 514 |
| 333 | Ga0307409_100401395 | 3300031995 | Bacteria | 1309 |
| 334 | Ga0307416_101529984 | 3300032002 | Bacteria | 773 |
| 335 | Ga0307411_10139084 | 3300032005 | Bacteria | 1788 |
| 336 | Ga0307411_11111043 | 3300032005 | Bacteria | 713 |
| 337 | Ga0316580_10016325 | 3300032139 | Bacteria | 2278 |
| 338 | Ga0373938_0172900 | 3300034957 | Bacteria | 586 |
| 339 | Ga0373936_0002456 | 3300035113 | Bacteria | 6934 |
| 340 | Ga0316574_0018957 | 3300035398 | Bacteria | 4052 |
| 341 | Ga0316574_0992750 | 3300035398 | Bacteria | 505 |
| 342 | Ga0316582_0087525 | 3300036647 | Bacteria | 2044 |
| 343 | Ga0316584_0137508 | 3300036712 | Bacteria | 1823 |
| 344 | Ga0395898_0174813 | 3300037466 | Bacteria | 2052 |
| 345 | Ga0395905_0055313 | 3300037471 | Bacteria | 3714 |
| 346 | Ga0395901_0008721 | 3300038443 | Bacteria | 10247 |
| 347 | Ga0451791_0330967 | 3300041451 | Bacteria | 1163 |
| 348 | Ga0451797_0525625 | 3300041453 | Bacteria | 1122 |
| 349 | Ga0451839_0926928 | 3300041496 | Bacteria | 807 |
| 350 | Ga0451841_0143415 | 3300041498 | Bacteria | 953 |
| 351 | Ga0451841_1299822 | 3300041498 | Bacteria | 776 |
| 352 | Ga0451845_0161850 | 3300041501 | Bacteria | 554 |
| 353 | Ga0451849_0461382 | 3300041505 | Bacteria | 1222 |
| 354 | Ga0451849_0957858 | 3300041505 | Bacteria | 584 |
| 355 | Ga0451851_0438943 | 3300041507 | Bacteria | 700 |
| 356 | Ga0451843_1222740 | 3300041509 | Bacteria | 809 |
| 357 | Ga0451843_1529574 | 3300041509 | Bacteria | 930 |
| 358 | Ga0439452_010484 | 3300042010 | Bacteria | 2693 |
| 359 | Ga0450906_044706 | 3300042145 | Bacteria | 782 |
| 360 | Ga0439460_0215589 | 3300042461 | Bacteria | 657 |
| 361 | Ga0451577_0015537 | 3300042876 | Bacteria | 7080 |
| 362 | Ga0466969_0032559 | 3300044656 | Bacteria | 2650 |
| 363 | Ga0466972_0188148 | 3300044658 | Bacteria | 968 |
| 364 | Ga0466966_0010105 | 3300044684 | Bacteria | 6261 |
| 365 | Ga0453684_0010616 | 3300044712 | Bacteria | 15699 |
| 366 | Ga0453684_1315259 | 3300044712 | Bacteria | 753 |
| 367 | Ga0466970_0931331 | 3300044765 | Bacteria | 511 |
| 368 | Ga0466959_0002148 | 3300045049 | Bacteria | 12507 |
| 369 | Ga0466959_0042999 | 3300045049 | Bacteria | 3332 |
| 370 | Ga0451576_2630017 | 3300045051 | Bacteria | 513 |
| 371 | Ga0495638_0078582 | 3300046460 | Bacteria | 2007 |
| 372 | Ga0495638_0440958 | 3300046460 | Bacteria | 667 |
| 373 | Ga0495650_0016936 | 3300046471 | Bacteria | 3668 |
| 374 | Ga0495650_0199536 | 3300046471 | Bacteria | 696 |
| 375 | Ga0495632_0141625 | 3300046519 | Bacteria | 1115 |
| 376 | Ga0495621_0136370 | 3300046539 | Bacteria | 958 |
| 377 | Ga0495621_0227454 | 3300046539 | Bacteria | 757 |
| 378 | Ga0495633_0040355 | 3300046558 | Bacteria | 2224 |
| 379 | Ga0495625_0028658 | 3300046660 | Bacteria | 4173 |
| 380 | Ga0495625_0045648 | 3300046660 | Bacteria | 3166 |
| 381 | Ga0495657_0620187 | 3300046675 | Bacteria | 625 |
| 382 | Ga0495670_0726387 | 3300046691 | Bacteria | 542 |
| 383 | Ga0495649_0156203 | 3300046694 | Bacteria | 1197 |
| 384 | Ga0495680_0877039 | 3300047322 | Unclassified | 581 |
| 385 | Ga0496100_1479706 | 3300048903 | Bacteria | 536 |
| 386 | Ga0496101_0160462 | 3300048904 | Bacteria | 1724 |
| 387 | Ga0496104_0047693 | 3300048907 | Bacteria | 4038 |
| 388 | Ga0496104_0611785 | 3300048907 | Bacteria | 1000 |
| 389 | Ga0496104_1836392 | 3300048907 | Bacteria | 508 |
| 390 | Ga0496105_0082258 | 3300048908 | Bacteria | 2659 |
| 391 | Ga0496107_0108188 | 3300048910 | Bacteria | 2042 |
| 392 | Ga0496112_0452055 | 3300048915 | Bacteria | 1222 |
| 393 | Ga0496113_0055996 | 3300048916 | Bacteria | 2958 |
| 394 | Ga0496115_0000782 | 3300048918 | Bacteria | 23341 |
| 395 | Ga0496116_0241377 | 3300048919 | Bacteria | 907 |
| 396 | Ga0496117_0001663 | 3300048920 | Bacteria | 31146 |
| 397 | Ga0496118_0031793 | 3300048921 | Bacteria | 4365 |
| 398 | Ga0496118_0035543 | 3300048921 | Bacteria | 4043 |
| 399 | Ga0496118_0114282 | 3300048921 | Bacteria | 1780 |
| 400 | Ga0496119_0000177 | 3300048922 | Bacteria | 89166 |
| 401 | Ga0496119_0001108 | 3300048922 | Bacteria | 33950 |
| 402 | Ga0496119_0350274 | 3300048922 | Bacteria | 715 |
| 403 | Ga0496120_0000188 | 3300048923 | Bacteria | 105545 |
| 404 | Ga0496120_0000328 | 3300048923 | Bacteria | 79028 |
| 405 | Ga0496120_0109591 | 3300048923 | Bacteria | 1444 |
| 406 | Ga0496121_0025636 | 3300048924 | Bacteria | 5588 |
| 407 | Ga0496121_0151460 | 3300048924 | Bacteria | 1706 |
| 408 | Ga0496122_0000209 | 3300048925 | Bacteria | 130440 |
| 409 | Ga0496122_0242202 | 3300048925 | Bacteria | 1016 |
| 410 | Ga0496123_0000106 | 3300048926 | Bacteria | 167799 |
| 411 | Ga0496123_0341377 | 3300048926 | Bacteria | 700 |
| 412 | Ga0496124_0000401 | 3300048927 | Bacteria | 79057 |
| 413 | Ga0496125_0002206 | 3300048928 | Bacteria | 25985 |
| 414 | Ga0496125_0038336 | 3300048928 | Bacteria | 4149 |
| 415 | Ga0496126_0002462 | 3300048929 | Bacteria | 24953 |
| 416 | Ga0495678_230501 | 3300049459 | Bacteria | 558 |
| 417 | Ga0501031_0001097 | 3300049568 | Bacteria | 16491 |
| 418 | Ga0501031_0213687 | 3300049568 | Bacteria | 1256 |
| 419 | Ga0501032_0005261 | 3300049569 | Bacteria | 9626 |
| 420 | Ga0501032_0014161 | 3300049569 | Bacteria | 5653 |
| 421 | Ga0501032_0756536 | 3300049569 | Bacteria | 614 |
| 422 | Ga0501033_0000720 | 3300049570 | Bacteria | 30337 |
| 423 | Ga0501033_0014033 | 3300049570 | Bacteria | 6095 |
| 424 | Ga0501033_0031736 | 3300049570 | Bacteria | 3966 |
| 425 | Ga0501034_0002484 | 3300049571 | Bacteria | 22159 |
| 426 | Ga0501034_0004188 | 3300049571 | Bacteria | 16100 |
| 427 | Ga0501034_0714230 | 3300049571 | Bacteria | 900 |
| 428 | Ga0501034_1252587 | 3300049571 | Bacteria | 619 |
| 429 | Ga0501036_0007244 | 3300049572 | Bacteria | 9033 |
| 430 | Ga0501036_0007930 | 3300049572 | Bacteria | 8687 |
| 431 | Ga0501036_0160322 | 3300049572 | Bacteria | 1896 |
| 432 | Ga0501036_0284259 | 3300049572 | Bacteria | 1384 |
| 433 | Ga0501037_0001245 | 3300049573 | Bacteria | 18769 |
| 434 | Ga0501037_0283164 | 3300049573 | Bacteria | 1154 |
| 435 | Ga0501038_0000673 | 3300049574 | Bacteria | 30442 |
| 436 | Ga0501038_0842244 | 3300049574 | Bacteria | 679 |
| 437 | Ga0501039_0002430 | 3300049575 | Bacteria | 13866 |
| 438 | Ga0501039_0005379 | 3300049575 | Bacteria | 9681 |
| 439 | Ga0501039_0052721 | 3300049575 | Bacteria | 3146 |
| 440 | Ga0501040_0030210 | 3300049576 | Bacteria | 3660 |
| 441 | Ga0501042_0000212 | 3300049578 | Bacteria | 27705 |
| 442 | Ga0501042_0703901 | 3300049578 | Bacteria | 735 |
| 443 | Ga0501043_0003203 | 3300049579 | Bacteria | 13541 |
| 444 | Ga0501043_0014430 | 3300049579 | Bacteria | 6182 |
| 445 | Ga0501043_0028000 | 3300049579 | Bacteria | 4422 |
| 446 | Ga0501043_0088572 | 3300049579 | Bacteria | 2432 |
| 447 | Ga0501046_0002962 | 3300049580 | Bacteria | 15706 |
| 448 | Ga0501046_0013109 | 3300049580 | Bacteria | 7036 |
| 449 | Ga0501046_0013611 | 3300049580 | Bacteria | 6880 |
| 450 | Ga0501047_0005546 | 3300049581 | Bacteria | 11875 |
| 451 | Ga0501047_0034653 | 3300049581 | Bacteria | 4874 |
| 452 | Ga0501047_0107772 | 3300049581 | Bacteria | 2668 |
| 453 | Ga0501047_0208807 | 3300049581 | Bacteria | 1811 |
| 454 | Ga0501048_0069337 | 3300049582 | Bacteria | 2490 |
| 455 | Ga0501048_0095168 | 3300049582 | Bacteria | 2100 |
| 456 | Ga0501067_0009020 | 3300049583 | Bacteria | 5528 |
| 457 | Ga0501067_0041945 | 3300049583 | Bacteria | 2541 |
| 458 | Ga0501067_0233470 | 3300049583 | Bacteria | 1024 |
| 459 | Ga0501069_0055903 | 3300049585 | Bacteria | 2198 |
| 460 | Ga0501069_0126607 | 3300049585 | Bacteria | 1461 |
| 461 | Ga0501070_0056925 | 3300049586 | Bacteria | 3241 |
| 462 | Ga0501070_0059406 | 3300049586 | Bacteria | 3170 |
| 463 | Ga0501070_0138229 | 3300049586 | Bacteria | 2011 |
| 464 | Ga0501070_0227269 | 3300049586 | Bacteria | 1529 |
| 465 | Ga0501071_0008741 | 3300049587 | Bacteria | 6704 |
| 466 | Ga0501071_0095677 | 3300049587 | Bacteria | 2185 |
| 467 | Ga0501072_0071696 | 3300049588 | Bacteria | 2737 |
| 468 | Ga0501073_0016778 | 3300049589 | Bacteria | 5306 |
| 469 | Ga0501073_0050715 | 3300049589 | Bacteria | 2907 |
| 470 | Ga0501073_0989987 | 3300049589 | Bacteria | 578 |
| 471 | Ga0501074_0008025 | 3300049590 | Bacteria | 7644 |
| 472 | Ga0501074_0025724 | 3300049590 | Bacteria | 4270 |
| 473 | Ga0501075_0240312 | 3300049591 | Bacteria | 1381 |
| 474 | Ga0501079_0016173 | 3300049741 | Bacteria | 5702 |
| 475 | Ga0501079_0034570 | 3300049741 | Bacteria | 3889 |
| 476 | Ga0501080_0021473 | 3300049742 | Bacteria | 5975 |
| 477 | Ga0501080_0390689 | 3300049742 | Bacteria | 1252 |
| 478 | Ga0501080_0460279 | 3300049742 | Bacteria | 1139 |
| 479 | Ga0501081_0082346 | 3300049743 | Bacteria | 2254 |
| 480 | Ga0501083_0016466 | 3300049744 | Bacteria | 5174 |
| 481 | Ga0501035_0004344 | 3300049822 | Bacteria | 13451 |
| 482 | Ga0501035_0021681 | 3300049822 | Bacteria | 5907 |
| 483 | Ga0501035_0028763 | 3300049822 | Bacteria | 5071 |
| 484 | Ga0501044_0006784 | 3300049823 | Bacteria | 12621 |
| 485 | Ga0501044_0016545 | 3300049823 | Bacteria | 7916 |
| 486 | Ga0501044_0114223 | 3300049823 | Bacteria | 2706 |
| 487 | Ga0501045_0078084 | 3300049824 | Bacteria | 2440 |
| 488 | Ga0501045_0447055 | 3300049824 | Bacteria | 961 |
| 489 | nmdc:mga05p37_35518_c1 | 3300050507 | Bacteria | 6112 |
| 490 | nmdc:mga09592_1185621_c1 | 3300050508 | Bacteria | 632 |
| 491 | nmdc:mga0qj67_40234_c1 | 3300050509 | Bacteria | 3675 |
| 492 | nmdc:mga0qj67_9876_c1 | 3300050509 | Bacteria | 7115 |
| 493 | Ga0495655_0188233 | 3300053083 | Bacteria | 669 |
| 494 | Ga0500644_0029071 | 3300053088 | Bacteria | 1735 |
| 495 | Ga0500557_102851 | 3300053105 | Bacteria | 949 |
| 496 | Ga0500572_093531 | 3300053111 | Bacteria | 955 |
| 497 | Ga0500591_144680 | 3300053115 | Bacteria | 931 |
| 498 | Ga0500630_070629 | 3300053159 | Bacteria | 1652 |
| 499 | Ga0500639_198171 | 3300053163 | Bacteria | 866 |
| 500 | Ga0501084_0062028 | 3300054114 | Bacteria | 3130 |
| 501 | Ga0501084_0198135 | 3300054114 | Bacteria | 1694 |
| 502 | Ga0501082_0054243 | 3300060353 | Bacteria | 3455 |
| 503 | Ga0501082_0348151 | 3300060353 | Bacteria | 1291 |
| 504 | Ga0530510_0087572 | 3300061734 | Bacteria | 2269 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10182935 | Ga0070666_101829352 | 79 |
| 2 | 3300005338 | Ga0068868_100118245 | Ga0068868_1001182452 | 79 |
| 3 | 3300005617 | Ga0068859_101670018 | Ga0068859_1016700181 | 79 |
| 4 | 3300005841 | Ga0068863_100094897 | Ga0068863_1000948973 | 79 |
| 5 | 3300005842 | Ga0068858_100062404 | Ga0068858_1000624042 | 79 |
| 6 | 3300005843 | Ga0068860_100012186 | Ga0068860_1000121862 | 79 |
| 7 | 3300006358 | Ga0068871_100070677 | Ga0068871_1000706773 | 79 |
| 8 | 3300006881 | Ga0068865_100557206 | Ga0068865_1005572061 | 79 |
| 9 | 3300006931 | Ga0097620_101669980 | Ga0097620_1016699801 | 79 |
| 10 | 3300009098 | Ga0105245_10040120 | Ga0105245_100401205 | 79 |
| 11 | 3300009176 | Ga0105242_10015093 | Ga0105242_100150936 | 79 |
| 12 | 3300013296 | Ga0157374_10007594 | Ga0157374_100075943 | 79 |
| 13 | 3300013297 | Ga0157378_10039081 | Ga0157378_100390813 | 79 |
| 14 | 3300014969 | Ga0157376_10012509 | Ga0157376_100125095 | 79 |
| 15 | 3300025903 | Ga0207680_10058161 | Ga0207680_100581612 | 79 |
| 16 | 3300025927 | Ga0207687_10129410 | Ga0207687_101294102 | 79 |
| 17 | 3300025938 | Ga0207704_10207107 | Ga0207704_102071071 | 79 |
| 18 | 3300026023 | Ga0207677_10007213 | Ga0207677_100072134 | 79 |
| 19 | 3300026088 | Ga0207641_12626015 | Ga0207641_126260151 | 79 |
| 20 | 3300028379 | Ga0268266_10310249 | Ga0268266_103102492 | 79 |
| 21 | 3300048903 | Ga0496100_1479706 | Ga0496100_1479706_32_298 | 79 |
| 22 | 3300048904 | Ga0496101_0160462 | Ga0496101_0160462_29_295 | 79 |
| 23 | 3300048910 | Ga0496107_0108188 | Ga0496107_0108188_962_1228 | 79 |
| 24 | 3300006880 | Ga0075429_100001826 | Ga0075429_1000018262 | 80 |
| 25 | 3300009147 | Ga0114129_10001307 | Ga0114129_1000130720 | 80 |
| 26 | 3300031548 | Ga0307408_100272797 | Ga0307408_1002727972 | 80 |
| 27 | 3300031901 | Ga0307406_10395120 | Ga0307406_103951202 | 80 |
| 28 | 3300031911 | Ga0307412_12189446 | Ga0307412_121894462 | 80 |
| 29 | 3300042461 | Ga0439460_0215589 | Ga0439460_0215589_331_597 | 80 |
| 30 | 3300050507 | nmdc:mga05p37_35518_c1 | nmdc:mga05p37_35518_c1_4495_4761 | 80 |
| 31 | 3300050508 | nmdc:mga09592_1185621_c1 | nmdc:mga09592_1185621_c1_301_567 | 80 |
| 32 | 3300050509 | nmdc:mga0qj67_40234_c1 | nmdc:mga0qj67_40234_c1_78_344 | 80 |
| 33 | 3300005334 | Ga0068869_100053188 | Ga0068869_1000531883 | 81 |
| 34 | 3300025942 | Ga0207689_10047696 | Ga0207689_100476964 | 81 |
| 35 | 3300005338 | Ga0068868_100521948 | Ga0068868_1005219482 | 82 |
| 36 | 3300005367 | Ga0070667_100077067 | Ga0070667_1000770671 | 82 |
| 37 | 3300006237 | Ga0097621_100745152 | Ga0097621_1007451522 | 82 |
| 38 | 3300006358 | Ga0068871_100378886 | Ga0068871_1003788862 | 82 |
| 39 | 3300006881 | Ga0068865_100108835 | Ga0068865_1001088353 | 82 |
| 40 | 3300009148 | Ga0105243_10343169 | Ga0105243_103431692 | 82 |
| 41 | 3300009176 | Ga0105242_10059544 | Ga0105242_100595442 | 82 |
| 42 | 3300009177 | Ga0105248_10772837 | Ga0105248_107728372 | 82 |
| 43 | 3300009553 | Ga0105249_11158665 | Ga0105249_111586652 | 82 |
| 44 | 3300013296 | Ga0157374_10178227 | Ga0157374_101782273 | 82 |
| 45 | 3300013306 | Ga0163162_10085655 | Ga0163162_100856553 | 82 |
| 46 | 3300013308 | Ga0157375_10345189 | Ga0157375_103451892 | 82 |
| 47 | 3300014325 | Ga0163163_10189932 | Ga0163163_101899322 | 82 |
| 48 | 3300014326 | Ga0157380_11246572 | Ga0157380_112465721 | 82 |
| 49 | 3300025899 | Ga0207642_10249906 | Ga0207642_102499062 | 82 |
| 50 | 3300025931 | Ga0207644_11213184 | Ga0207644_112131842 | 82 |
| 51 | 3300025934 | Ga0207686_10062876 | Ga0207686_100628762 | 82 |
| 52 | 3300025938 | Ga0207704_10089159 | Ga0207704_100891592 | 82 |
| 53 | 3300025941 | Ga0207711_10113149 | Ga0207711_101131492 | 82 |
| 54 | 3300025986 | Ga0207658_11362096 | Ga0207658_113620961 | 82 |
| 55 | 3300026035 | Ga0207703_10904714 | Ga0207703_109047142 | 82 |
| 56 | 3300026067 | Ga0207678_10618807 | Ga0207678_106188071 | 82 |
| 57 | 3300026088 | Ga0207641_10828004 | Ga0207641_108280042 | 82 |
| 58 | 3300046539 | Ga0495621_0136370 | Ga0495621_0136370_658_924 | 82 |
| 59 | 3300046694 | Ga0495649_0156203 | Ga0495649_0156203_151_417 | 82 |
| 60 | 3300053083 | Ga0495655_0188233 | Ga0495655_0188233_319_585 | 82 |
| 61 | iso_pu_bacteria | 2643221559 | 2643817430 | 83 |
| 62 | iso_pu_bacteria | 2643221586 | 2643938141 | 83 |
| 63 | iso_pu_bacteria | 2643221612 | 2644079213 | 83 |
| 64 | iso_pu_bacteria | 2643221727 | 2644694657 | 83 |
| 65 | iso_pu_bacteria | 2884411467 | 2884415486 | 83 |
| 66 | iso_pu_bacteria | 2508501071 | 2508851459 | 84 |
| 67 | iso_pu_bacteria | 2609459761 | 2609913705 | 84 |
| 68 | iso_pu_bacteria | 2636415599 | 2637226305 | 84 |
| 69 | iso_pu_bacteria | 2643221579 | 2643907924 | 84 |
| 70 | iso_pu_bacteria | 2706794495 | 2707101407 | 84 |
| 71 | iso_pu_bacteria | 2738541276 | 2738714570 | 84 |
| 72 | iso_pu_bacteria | 2775507074 | 2777020378 | 84 |
| 73 | iso_pu_bacteria | 2806310673 | 2807179584 | 84 |
| 74 | iso_pu_bacteria | 2818991457 | 2819660207 | 84 |
| 75 | iso_pu_bacteria | 2836160341 | 2836163947 | 84 |
| 76 | iso_pu_bacteria | 2852684882 | 2852684979 | 84 |
| 77 | iso_pu_bacteria | 2857442823 | 2857444683 | 84 |
| 78 | iso_pu_bacteria | 2895395659 | 2895396794 | 84 |
| 79 | iso_pu_bacteria | 2904513164 | 2904517305 | 84 |
| 80 | iso_pu_bacteria | 2919130084 | 2919130520 | 84 |
| 81 | iso_pu_bacteria | 2923516293 | 2923518595 | 84 |
| 82 | iso_pu_bacteria | 2929195423 | 2929198476 | 84 |
| 83 | iso_pu_bacteria | 2941475908 | 2941476747 | 84 |
| 84 | iso_pu_bacteria | 2945874760 | 2945878859 | 84 |
| 85 | iso_pu_bacteria | 2952252522 | 2952254536 | 84 |
| 86 | iso_pu_bacteria | 2969079654 | 2969083284 | 84 |
| 87 | iso_pu_bacteria | 2984559226 | 2984560301 | 84 |
| 88 | iso_pu_bacteria | 2984595703 | 2984598378 | 84 |
| 89 | iso_pu_bacteria | 640753048 | 640937012 | 84 |
| 90 | iso_pu_bacteria | 8003014200 | 8003015870 | 84 |
| 91 | iso_pu_bacteria | 8021622325 | 8021625614 | 84 |
| 92 | iso_pu_bacteria | 8021626552 | 8021626985 | 84 |
| 93 | iso_pu_bacteria | 8021648035 | 8021652104 | 84 |
| 94 | iso_pu_bacteria | 8055693939 | 8055695393 | 84 |
| 95 | 3300020069 | Ga0197907_10031805 | Ga0197907_100318052 | 87 |
| 96 | 3300020070 | Ga0206356_10157927 | Ga0206356_101579272 | 87 |
| 97 | 3300020082 | Ga0206353_10662671 | Ga0206353_106626712 | 87 |
| 98 | 3300025246 | Ga0209646_1005732 | Ga0209646_10057321 | 87 |
| 99 | 3300025250 | Ga0209026_1000207 | Ga0209026_100020771 | 87 |
| 100 | 3300025256 | Ga0209759_1056689 | Ga0209759_10566891 | 87 |
| 101 | 3300025272 | Ga0209455_1000535 | Ga0209455_10005356 | 87 |
| 102 | 3300025981 | Ga0207640_10193977 | Ga0207640_101939772 | 87 |
| 103 | 3300026067 | Ga0207678_10006781 | Ga0207678_1000678114 | 87 |
| 104 | 3300031911 | Ga0307412_11658496 | Ga0307412_116584962 | 87 |
| 105 | 3300049571 | Ga0501034_1252587 | Ga0501034_1252587_306_569 | 87 |
| 106 | 2162886006 | SwRhRL3b_contig_859695 | SwRhRL3b_0411.00001660 | 88 |
| 107 | 2162886007 | SwRhRL2b_contig_1363613 | SwRhRL2b_0792.00003520 | 88 |
| 108 | 3300001990 | JGI24737J22298_10089389 | JGI24737J22298_100893891 | 88 |
| 109 | 3300002067 | JGI24735J21928_10003683 | JGI24735J21928_100036832 | 88 |
| 110 | 3300003320 | rootH2_10131900 | rootH2_101319003 | 88 |
| 111 | 3300003320 | rootH2_10245041 | rootH2_102450412 | 88 |
| 112 | 3300003781 | Ga0055536_1000970 | Ga0055536_10009701 | 88 |
| 113 | 3300003781 | Ga0055536_1011213 | Ga0055536_10112131 | 88 |
| 114 | 3300003791 | Ga0055530_10000993 | Ga0055530_1000099318 | 88 |
| 115 | 3300003794 | Ga0055531_10013615 | Ga0055531_100136152 | 88 |
| 116 | 3300003794 | Ga0055531_10048434 | Ga0055531_100484342 | 88 |
| 117 | 3300003856 | Ga0058692_1000055 | Ga0058692_100005576 | 88 |
| 118 | 3300005289 | Ga0065704_10071085 | Ga0065704_100710859 | 88 |
| 119 | 3300005293 | Ga0065715_10967946 | Ga0065715_109679462 | 88 |
| 120 | 3300005295 | Ga0065707_10082037 | Ga0065707_1008203712 | 88 |
| 121 | 3300005295 | Ga0065707_10083710 | Ga0065707_100837104 | 88 |
| 122 | 3300005327 | Ga0070658_11023626 | Ga0070658_110236261 | 88 |
| 123 | 3300005331 | Ga0070670_100004160 | Ga0070670_1000041605 | 88 |
| 124 | 3300005331 | Ga0070670_100202268 | Ga0070670_1002022682 | 88 |
| 125 | 3300005331 | Ga0070670_101595674 | Ga0070670_1015956741 | 88 |
| 126 | 3300005335 | Ga0070666_10065753 | Ga0070666_100657531 | 88 |
| 127 | 3300005337 | Ga0070682_100072394 | Ga0070682_1000723942 | 88 |
| 128 | 3300005340 | Ga0070689_100098231 | Ga0070689_1000982314 | 88 |
| 129 | 3300005341 | Ga0070691_10123409 | Ga0070691_101234092 | 88 |
| 130 | 3300005345 | Ga0070692_10331493 | Ga0070692_103314931 | 88 |
| 131 | 3300005347 | Ga0070668_100411904 | Ga0070668_1004119042 | 88 |
| 132 | 3300005347 | Ga0070668_101185923 | Ga0070668_1011859231 | 88 |
| 133 | 3300005347 | Ga0070668_101533488 | Ga0070668_1015334881 | 88 |
| 134 | 3300005353 | Ga0070669_100076573 | Ga0070669_1000765733 | 88 |
| 135 | 3300005353 | Ga0070669_100217975 | Ga0070669_1002179752 | 88 |
| 136 | 3300005354 | Ga0070675_100040018 | Ga0070675_1000400183 | 88 |
| 137 | 3300005355 | Ga0070671_100001380 | Ga0070671_1000013804 | 88 |
| 138 | 3300005356 | Ga0070674_100064798 | Ga0070674_1000647983 | 88 |
| 139 | 3300005364 | Ga0070673_100020751 | Ga0070673_1000207514 | 88 |
| 140 | 3300005365 | Ga0070688_100032930 | Ga0070688_1000329302 | 88 |
| 141 | 3300005365 | Ga0070688_100671076 | Ga0070688_1006710762 | 88 |
| 142 | 3300005436 | Ga0070713_101603764 | Ga0070713_1016037641 | 88 |
| 143 | 3300005441 | Ga0070700_100232517 | Ga0070700_1002325172 | 88 |
| 144 | 3300005456 | Ga0070678_100073688 | Ga0070678_1000736882 | 88 |
| 145 | 3300005457 | Ga0070662_100290273 | Ga0070662_1002902732 | 88 |
| 146 | 3300005459 | Ga0068867_100041432 | Ga0068867_1000414323 | 88 |
| 147 | 3300005459 | Ga0068867_100055110 | Ga0068867_1000551102 | 88 |
| 148 | 3300005466 | Ga0070685_10252352 | Ga0070685_102523523 | 88 |
| 149 | 3300005530 | Ga0070679_100017777 | Ga0070679_1000177775 | 88 |
| 150 | 3300005530 | Ga0070679_100045539 | Ga0070679_1000455394 | 88 |
| 151 | 3300005539 | Ga0068853_100726574 | Ga0068853_1007265742 | 88 |
| 152 | 3300005543 | Ga0070672_100104839 | Ga0070672_1001048393 | 88 |
| 153 | 3300005543 | Ga0070672_100221160 | Ga0070672_1002211602 | 88 |
| 154 | 3300005544 | Ga0070686_100057119 | Ga0070686_1000571193 | 88 |
| 155 | 3300005544 | Ga0070686_100101699 | Ga0070686_1001016993 | 88 |
| 156 | 3300005548 | Ga0070665_100054361 | Ga0070665_1000543612 | 88 |
| 157 | 3300005548 | Ga0070665_100123241 | Ga0070665_1001232413 | 88 |
| 158 | 3300005548 | Ga0070665_100364906 | Ga0070665_1003649061 | 88 |
| 159 | 3300005548 | Ga0070665_101292238 | Ga0070665_1012922382 | 88 |
| 160 | 3300005548 | Ga0070665_101901222 | Ga0070665_1019012222 | 88 |
| 161 | 3300005563 | Ga0068855_100074335 | Ga0068855_1000743352 | 88 |
| 162 | 3300005563 | Ga0068855_101698437 | Ga0068855_1016984371 | 88 |
| 163 | 3300005563 | Ga0068855_102517679 | Ga0068855_1025176792 | 88 |
| 164 | 3300005564 | Ga0070664_101347100 | Ga0070664_1013471001 | 88 |
| 165 | 3300005577 | Ga0068857_101698805 | Ga0068857_1016988052 | 88 |
| 166 | 3300005578 | Ga0068854_100033542 | Ga0068854_1000335423 | 88 |
| 167 | 3300005614 | Ga0068856_100041848 | Ga0068856_1000418484 | 88 |
| 168 | 3300005614 | Ga0068856_102547393 | Ga0068856_1025473931 | 88 |
| 169 | 3300005616 | Ga0068852_100392849 | Ga0068852_1003928492 | 88 |
| 170 | 3300005616 | Ga0068852_101049734 | Ga0068852_1010497342 | 88 |
| 171 | 3300005617 | Ga0068859_100001453 | Ga0068859_10000145320 | 88 |
| 172 | 3300005617 | Ga0068859_100713974 | Ga0068859_1007139742 | 88 |
| 173 | 3300005618 | Ga0068864_100163574 | Ga0068864_1001635742 | 88 |
| 174 | 3300005618 | Ga0068864_102274242 | Ga0068864_1022742422 | 88 |
| 175 | 3300005719 | Ga0068861_100000904 | Ga0068861_1000009049 | 88 |
| 176 | 3300005719 | Ga0068861_100157462 | Ga0068861_1001574622 | 88 |
| 177 | 3300005719 | Ga0068861_100223257 | Ga0068861_1002232572 | 88 |
| 178 | 3300005719 | Ga0068861_100790355 | Ga0068861_1007903551 | 88 |
| 179 | 3300005840 | Ga0068870_10181253 | Ga0068870_101812532 | 88 |
| 180 | 3300005841 | Ga0068863_100005193 | Ga0068863_1000051936 | 88 |
| 181 | 3300005841 | Ga0068863_100229123 | Ga0068863_1002291232 | 88 |
| 182 | 3300005841 | Ga0068863_102005194 | Ga0068863_1020051941 | 88 |
| 183 | 3300005842 | Ga0068858_100001329 | Ga0068858_10000132920 | 88 |
| 184 | 3300005843 | Ga0068860_100181873 | Ga0068860_1001818732 | 88 |
| 185 | 3300005843 | Ga0068860_101040997 | Ga0068860_1010409971 | 88 |
| 186 | 3300005844 | Ga0068862_100071800 | Ga0068862_1000718002 | 88 |
| 187 | 3300005844 | Ga0068862_100622121 | Ga0068862_1006221211 | 88 |
| 188 | 3300005983 | Ga0081540_1003092 | Ga0081540_100309210 | 88 |
| 189 | 3300006175 | Ga0070712_100375695 | Ga0070712_1003756952 | 88 |
| 190 | 3300006175 | Ga0070712_101520287 | Ga0070712_1015202872 | 88 |
| 191 | 3300006237 | Ga0097621_100107958 | Ga0097621_1001079583 | 88 |
| 192 | 3300006237 | Ga0097621_100351340 | Ga0097621_1003513402 | 88 |
| 193 | 3300006237 | Ga0097621_100541663 | Ga0097621_1005416632 | 88 |
| 194 | 3300006237 | Ga0097621_101107441 | Ga0097621_1011074412 | 88 |
| 195 | 3300006358 | Ga0068871_100043575 | Ga0068871_1000435753 | 88 |
| 196 | 3300006358 | Ga0068871_101707333 | Ga0068871_1017073331 | 88 |
| 197 | 3300006846 | Ga0075430_100016289 | Ga0075430_1000162894 | 88 |
| 198 | 3300006881 | Ga0068865_100088371 | Ga0068865_1000883713 | 88 |
| 199 | 3300006931 | Ga0097620_100001453 | Ga0097620_10000145320 | 88 |
| 200 | 3300006931 | Ga0097620_100713989 | Ga0097620_1007139892 | 88 |
| 201 | 3300006946 | Ga0079104_1019822 | Ga0079104_10198222 | 88 |
| 202 | 3300009011 | Ga0105251_10369950 | Ga0105251_103699501 | 88 |
| 203 | 3300009092 | Ga0105250_10134755 | Ga0105250_101347552 | 88 |
| 204 | 3300009093 | Ga0105240_10020797 | Ga0105240_1002079710 | 88 |
| 205 | 3300009093 | Ga0105240_10130509 | Ga0105240_101305092 | 88 |
| 206 | 3300009094 | Ga0111539_10780109 | Ga0111539_107801091 | 88 |
| 207 | 3300009101 | Ga0105247_10000173 | Ga0105247_1000017350 | 88 |
| 208 | 3300009148 | Ga0105243_12041926 | Ga0105243_120419262 | 88 |
| 209 | 3300009177 | Ga0105248_10088557 | Ga0105248_100885572 | 88 |
| 210 | 3300009177 | Ga0105248_10500174 | Ga0105248_105001743 | 88 |
| 211 | 3300009545 | Ga0105237_11035356 | Ga0105237_110353562 | 88 |
| 212 | 3300009545 | Ga0105237_11454168 | Ga0105237_114541681 | 88 |
| 213 | 3300009553 | Ga0105249_10095447 | Ga0105249_100954471 | 88 |
| 214 | 3300009553 | Ga0105249_10211249 | Ga0105249_102112492 | 88 |
| 215 | 3300009553 | Ga0105249_10364541 | Ga0105249_103645412 | 88 |
| 216 | 3300010375 | Ga0105239_10746083 | Ga0105239_107460832 | 88 |
| 217 | 3300013104 | Ga0157370_11226914 | Ga0157370_112269142 | 88 |
| 218 | 3300013105 | Ga0157369_10003548 | Ga0157369_100035482 | 88 |
| 219 | 3300013105 | Ga0157369_10114420 | Ga0157369_101144202 | 88 |
| 220 | 3300013105 | Ga0157369_10186208 | Ga0157369_101862083 | 88 |
| 221 | 3300013306 | Ga0163162_10005422 | Ga0163162_100054223 | 88 |
| 222 | 3300013306 | Ga0163162_10402679 | Ga0163162_104026792 | 88 |
| 223 | 3300013306 | Ga0163162_11956208 | Ga0163162_119562081 | 88 |
| 224 | 3300013307 | Ga0157372_10026587 | Ga0157372_100265874 | 88 |
| 225 | 3300013308 | Ga0157375_10004067 | Ga0157375_100040675 | 88 |
| 226 | 3300013308 | Ga0157375_10304155 | Ga0157375_103041551 | 88 |
| 227 | 3300014325 | Ga0163163_11347006 | Ga0163163_113470062 | 88 |
| 228 | 3300014325 | Ga0163163_13252395 | Ga0163163_132523952 | 88 |
| 229 | 3300014326 | Ga0157380_10005230 | Ga0157380_100052302 | 88 |
| 230 | 3300014326 | Ga0157380_10454427 | Ga0157380_104544272 | 88 |
| 231 | 3300014326 | Ga0157380_10816708 | Ga0157380_108167082 | 88 |
| 232 | 3300014326 | Ga0157380_11331314 | Ga0157380_113313141 | 88 |
| 233 | 3300014497 | Ga0182008_10060436 | Ga0182008_100604363 | 88 |
| 234 | 3300014968 | Ga0157379_12231870 | Ga0157379_122318701 | 88 |
| 235 | 3300014969 | Ga0157376_10261278 | Ga0157376_102612781 | 88 |
| 236 | 3300014969 | Ga0157376_12746831 | Ga0157376_127468311 | 88 |
| 237 | 3300017792 | Ga0163161_10077016 | Ga0163161_100770161 | 88 |
| 238 | 3300017792 | Ga0163161_10574447 | Ga0163161_105744472 | 88 |
| 239 | 3300020070 | Ga0206356_11401385 | Ga0206356_114013852 | 88 |
| 240 | 3300020075 | Ga0206349_1138132 | Ga0206349_11381322 | 88 |
| 241 | 3300025226 | Ga0209674_100016 | Ga0209674_10001694 | 88 |
| 242 | 3300025231 | Ga0207427_100117 | Ga0207427_10011779 | 88 |
| 243 | 3300025233 | Ga0209437_100240 | Ga0209437_10024033 | 88 |
| 244 | 3300025261 | Ga0209233_1000083 | Ga0209233_1000083302 | 88 |
| 245 | 3300025261 | Ga0209233_1000417 | Ga0209233_100041733 | 88 |
| 246 | 3300025284 | Ga0209130_1006914 | Ga0209130_10069142 | 88 |
| 247 | 3300025291 | Ga0209675_1009967 | Ga0209675_10099674 | 88 |
| 248 | 3300025292 | Ga0209676_1000196 | Ga0209676_1000196118 | 88 |
| 249 | 3300025292 | Ga0209676_1001468 | Ga0209676_10014685 | 88 |
| 250 | 3300025292 | Ga0209676_1002369 | Ga0209676_100236912 | 88 |
| 251 | 3300025292 | Ga0209676_1002638 | Ga0209676_10026389 | 88 |
| 252 | 3300025294 | Ga0209025_1040515 | Ga0209025_10405152 | 88 |
| 253 | 3300025295 | Ga0209564_1003676 | Ga0209564_10036769 | 88 |
| 254 | 3300025295 | Ga0209564_1050524 | Ga0209564_10505242 | 88 |
| 255 | 3300025298 | Ga0209050_1001267 | Ga0209050_100126715 | 88 |
| 256 | 3300025299 | Ga0209256_1001647 | Ga0209256_10016479 | 88 |
| 257 | 3300025303 | Ga0209051_1017574 | Ga0209051_10175743 | 88 |
| 258 | 3300025304 | Ga0209257_1000356 | Ga0209257_100035617 | 88 |
| 259 | 3300025304 | Ga0209257_1002260 | Ga0209257_100226015 | 88 |
| 260 | 3300025304 | Ga0209257_1063166 | Ga0209257_10631662 | 88 |
| 261 | 3300025315 | Ga0207697_10414252 | Ga0207697_104142521 | 88 |
| 262 | 3300025893 | Ga0207682_10002667 | Ga0207682_100026672 | 88 |
| 263 | 3300025900 | Ga0207710_10000666 | Ga0207710_100006664 | 88 |
| 264 | 3300025903 | Ga0207680_10142508 | Ga0207680_101425082 | 88 |
| 265 | 3300025903 | Ga0207680_10290828 | Ga0207680_102908281 | 88 |
| 266 | 3300025904 | Ga0207647_10053567 | Ga0207647_100535672 | 88 |
| 267 | 3300025907 | Ga0207645_10145355 | Ga0207645_101453552 | 88 |
| 268 | 3300025907 | Ga0207645_11065424 | Ga0207645_110654241 | 88 |
| 269 | 3300025908 | Ga0207643_10005180 | Ga0207643_100051803 | 88 |
| 270 | 3300025913 | Ga0207695_10665359 | Ga0207695_106653591 | 88 |
| 271 | 3300025914 | Ga0207671_10382900 | Ga0207671_103829002 | 88 |
| 272 | 3300025914 | Ga0207671_10844770 | Ga0207671_108447701 | 88 |
| 273 | 3300025916 | Ga0207663_10005990 | Ga0207663_100059904 | 88 |
| 274 | 3300025917 | Ga0207660_10175567 | Ga0207660_101755672 | 88 |
| 275 | 3300025923 | Ga0207681_10218612 | Ga0207681_102186122 | 88 |
| 276 | 3300025924 | Ga0207694_10349512 | Ga0207694_103495122 | 88 |
| 277 | 3300025925 | Ga0207650_10062181 | Ga0207650_100621812 | 88 |
| 278 | 3300025925 | Ga0207650_10158305 | Ga0207650_101583052 | 88 |
| 279 | 3300025925 | Ga0207650_10200945 | Ga0207650_102009452 | 88 |
| 280 | 3300025926 | Ga0207659_10124650 | Ga0207659_101246503 | 88 |
| 281 | 3300025926 | Ga0207659_11311859 | Ga0207659_113118592 | 88 |
| 282 | 3300025928 | Ga0207700_11274102 | Ga0207700_112741021 | 88 |
| 283 | 3300025931 | Ga0207644_10004431 | Ga0207644_100044314 | 88 |
| 284 | 3300025933 | Ga0207706_10139977 | Ga0207706_101399772 | 88 |
| 285 | 3300025933 | Ga0207706_10156871 | Ga0207706_101568712 | 88 |
| 286 | 3300025934 | Ga0207686_10026819 | Ga0207686_100268194 | 88 |
| 287 | 3300025936 | Ga0207670_10111926 | Ga0207670_101119263 | 88 |
| 288 | 3300025937 | Ga0207669_10613784 | Ga0207669_106137842 | 88 |
| 289 | 3300025938 | Ga0207704_10019984 | Ga0207704_100199843 | 88 |
| 290 | 3300025938 | Ga0207704_11664913 | Ga0207704_116649131 | 88 |
| 291 | 3300025940 | Ga0207691_10064050 | Ga0207691_100640502 | 88 |
| 292 | 3300025941 | Ga0207711_10614322 | Ga0207711_106143223 | 88 |
| 293 | 3300025945 | Ga0207679_11844793 | Ga0207679_118447932 | 88 |
| 294 | 3300025949 | Ga0207667_10448962 | Ga0207667_104489622 | 88 |
| 295 | 3300025960 | Ga0207651_10044633 | Ga0207651_100446334 | 88 |
| 296 | 3300025961 | Ga0207712_10019704 | Ga0207712_100197046 | 88 |
| 297 | 3300025961 | Ga0207712_10042121 | Ga0207712_100421213 | 88 |
| 298 | 3300025961 | Ga0207712_10601830 | Ga0207712_106018301 | 88 |
| 299 | 3300025972 | Ga0207668_10364515 | Ga0207668_103645152 | 88 |
| 300 | 3300025981 | Ga0207640_10902652 | Ga0207640_109026521 | 88 |
| 301 | 3300025986 | Ga0207658_10004450 | Ga0207658_100044506 | 88 |
| 302 | 3300025986 | Ga0207658_10364542 | Ga0207658_103645422 | 88 |
| 303 | 3300026023 | Ga0207677_11979991 | Ga0207677_119799911 | 88 |
| 304 | 3300026023 | Ga0207677_12008107 | Ga0207677_120081071 | 88 |
| 305 | 3300026035 | Ga0207703_10000855 | Ga0207703_1000085521 | 88 |
| 306 | 3300026041 | Ga0207639_10681611 | Ga0207639_106816112 | 88 |
| 307 | 3300026075 | Ga0207708_10243051 | Ga0207708_102430513 | 88 |
| 308 | 3300026078 | Ga0207702_10374878 | Ga0207702_103748782 | 88 |
| 309 | 3300026078 | Ga0207702_11158382 | Ga0207702_111583822 | 88 |
| 310 | 3300026088 | Ga0207641_10064577 | Ga0207641_100645772 | 88 |
| 311 | 3300026088 | Ga0207641_11745301 | Ga0207641_117453012 | 88 |
| 312 | 3300026089 | Ga0207648_10014132 | Ga0207648_100141326 | 88 |
| 313 | 3300026089 | Ga0207648_10091881 | Ga0207648_100918812 | 88 |
| 314 | 3300026095 | Ga0207676_10214421 | Ga0207676_102144212 | 88 |
| 315 | 3300026095 | Ga0207676_10495252 | Ga0207676_104952521 | 88 |
| 316 | 3300026116 | Ga0207674_12198847 | Ga0207674_121988471 | 88 |
| 317 | 3300026118 | Ga0207675_100010773 | Ga0207675_1000107734 | 88 |
| 318 | 3300026118 | Ga0207675_100019991 | Ga0207675_1000199912 | 88 |
| 319 | 3300026118 | Ga0207675_100188519 | Ga0207675_1001885192 | 88 |
| 320 | 3300026118 | Ga0207675_100308367 | Ga0207675_1003083672 | 88 |
| 321 | 3300026118 | Ga0207675_100456389 | Ga0207675_1004563892 | 88 |
| 322 | 3300026121 | Ga0207683_10098943 | Ga0207683_100989433 | 88 |
| 323 | 3300026121 | Ga0207683_10391788 | Ga0207683_103917883 | 88 |
| 324 | 3300026142 | Ga0207698_11060015 | Ga0207698_110600152 | 88 |
| 325 | 3300026142 | Ga0207698_12169898 | Ga0207698_121698981 | 88 |
| 326 | 3300026142 | Ga0207698_12227785 | Ga0207698_122277852 | 88 |
| 327 | 3300027111 | Ga0209281_1012480 | Ga0209281_10124803 | 88 |
| 328 | 3300027312 | Ga0209371_1000075 | Ga0209371_100007565 | 88 |
| 329 | 3300028379 | Ga0268266_10045112 | Ga0268266_100451121 | 88 |
| 330 | 3300028379 | Ga0268266_10331544 | Ga0268266_103315442 | 88 |
| 331 | 3300028379 | Ga0268266_10988078 | Ga0268266_109880782 | 88 |
| 332 | 3300028380 | Ga0268265_10228255 | Ga0268265_102282552 | 88 |
| 333 | 3300028380 | Ga0268265_10239976 | Ga0268265_102399763 | 88 |
| 334 | 3300028380 | Ga0268265_10730565 | Ga0268265_107305652 | 88 |
| 335 | 3300028381 | Ga0268264_10014540 | Ga0268264_100145404 | 88 |
| 336 | 3300028381 | Ga0268264_10061954 | Ga0268264_100619543 | 88 |
| 337 | 3300028381 | Ga0268264_10800077 | Ga0268264_108000772 | 88 |
| 338 | 3300028381 | Ga0268264_11163249 | Ga0268264_111632491 | 88 |
| 339 | 3300028563 | Ga0265319_1048759 | Ga0265319_10487592 | 88 |
| 340 | 3300028573 | Ga0265334_10000089 | Ga0265334_100000898 | 88 |
| 341 | 3300028577 | Ga0265318_10010901 | Ga0265318_100109011 | 88 |
| 342 | 3300028800 | Ga0265338_10007138 | Ga0265338_1000713814 | 88 |
| 343 | 3300029957 | Ga0265324_10104971 | Ga0265324_101049711 | 88 |
| 344 | 3300030500 | Ga0268256_1000068 | Ga0268256_1000068132 | 88 |
| 345 | 3300030521 | Ga0307511_10000112 | Ga0307511_1000011230 | 88 |
| 346 | 3300030521 | Ga0307511_10060866 | Ga0307511_100608662 | 88 |
| 347 | 3300031235 | Ga0265330_10002999 | Ga0265330_100029994 | 88 |
| 348 | 3300031235 | Ga0265330_10463576 | Ga0265330_104635762 | 88 |
| 349 | 3300031238 | Ga0265332_10004069 | Ga0265332_100040691 | 88 |
| 350 | 3300031238 | Ga0265332_10183024 | Ga0265332_101830242 | 88 |
| 351 | 3300031239 | Ga0265328_10245454 | Ga0265328_102454541 | 88 |
| 352 | 3300031240 | Ga0265320_10199525 | Ga0265320_101995252 | 88 |
| 353 | 3300031241 | Ga0265325_10001937 | Ga0265325_100019374 | 88 |
| 354 | 3300031249 | Ga0265339_10054812 | Ga0265339_100548122 | 88 |
| 355 | 3300031249 | Ga0265339_10108665 | Ga0265339_101086652 | 88 |
| 356 | 3300031250 | Ga0265331_10060184 | Ga0265331_100601842 | 88 |
| 357 | 3300031251 | Ga0265327_10000027 | Ga0265327_10000027146 | 88 |
| 358 | 3300031344 | Ga0265316_10436333 | Ga0265316_104363331 | 88 |
| 359 | 3300031456 | Ga0307513_10055934 | Ga0307513_100559342 | 88 |
| 360 | 3300031456 | Ga0307513_11108846 | Ga0307513_111088462 | 88 |
| 361 | 3300031595 | Ga0265313_10019234 | Ga0265313_100192344 | 88 |
| 362 | 3300031616 | Ga0307508_10312605 | Ga0307508_103126052 | 88 |
| 363 | 3300031616 | Ga0307508_10549218 | Ga0307508_105492182 | 88 |
| 364 | 3300031665 | Ga0316575_10174474 | Ga0316575_101744742 | 88 |
| 365 | 3300031711 | Ga0265314_10014486 | Ga0265314_100144864 | 88 |
| 366 | 3300031711 | Ga0265314_10205592 | Ga0265314_102055923 | 88 |
| 367 | 3300031712 | Ga0265342_10012744 | Ga0265342_100127444 | 88 |
| 368 | 3300031712 | Ga0265342_10018193 | Ga0265342_100181933 | 88 |
| 369 | 3300031727 | Ga0316576_10645674 | Ga0316576_106456741 | 88 |
| 370 | 3300031727 | Ga0316576_10756393 | Ga0316576_107563932 | 88 |
| 371 | 3300031727 | Ga0316576_10907942 | Ga0316576_109079422 | 88 |
| 372 | 3300031728 | Ga0316578_10110274 | Ga0316578_101102741 | 88 |
| 373 | 3300031730 | Ga0307516_10021678 | Ga0307516_100216783 | 88 |
| 374 | 3300031824 | Ga0307413_10993479 | Ga0307413_109934791 | 88 |
| 375 | 3300031852 | Ga0307410_10148771 | Ga0307410_101487711 | 88 |
| 376 | 3300031901 | Ga0307406_10703895 | Ga0307406_107038951 | 88 |
| 377 | 3300031903 | Ga0307407_10243223 | Ga0307407_102432232 | 88 |
| 378 | 3300031995 | Ga0307409_100401395 | Ga0307409_1004013952 | 88 |
| 379 | 3300032002 | Ga0307416_101529984 | Ga0307416_1015299841 | 88 |
| 380 | 3300032005 | Ga0307411_10139084 | Ga0307411_101390843 | 88 |
| 381 | 3300032005 | Ga0307411_11111043 | Ga0307411_111110432 | 88 |
| 382 | 3300032139 | Ga0316580_10016325 | Ga0316580_100163252 | 88 |
| 383 | 3300034957 | Ga0373938_0172900 | Ga0373938_0172900_249_515 | 88 |
| 384 | 3300035113 | Ga0373936_0002456 | Ga0373936_0002456_3384_3650 | 88 |
| 385 | 3300035398 | Ga0316574_0018957 | Ga0316574_0018957_190_456 | 88 |
| 386 | 3300035398 | Ga0316574_0992750 | Ga0316574_0992750_85_351 | 88 |
| 387 | 3300036647 | Ga0316582_0087525 | Ga0316582_0087525_1272_1538 | 88 |
| 388 | 3300036712 | Ga0316584_0137508 | Ga0316584_0137508_317_583 | 88 |
| 389 | 3300037466 | Ga0395898_0174813 | Ga0395898_0174813_448_714 | 88 |
| 390 | 3300037471 | Ga0395905_0055313 | Ga0395905_0055313_123_389 | 88 |
| 391 | 3300038443 | Ga0395901_0008721 | Ga0395901_0008721_1670_1936 | 88 |
| 392 | 3300041451 | Ga0451791_0330967 | Ga0451791_0330967_578_844 | 88 |
| 393 | 3300041453 | Ga0451797_0525625 | Ga0451797_0525625_357_623 | 88 |
| 394 | 3300041496 | Ga0451839_0926928 | Ga0451839_0926928_362_628 | 88 |
| 395 | 3300041498 | Ga0451841_0143415 | Ga0451841_0143415_629_895 | 88 |
| 396 | 3300041498 | Ga0451841_1299822 | Ga0451841_1299822_46_312 | 88 |
| 397 | 3300041501 | Ga0451845_0161850 | Ga0451845_0161850_155_442 | 88 |
| 398 | 3300041505 | Ga0451849_0461382 | Ga0451849_0461382_573_839 | 88 |
| 399 | 3300041505 | Ga0451849_0957858 | Ga0451849_0957858_258_536 | 88 |
| 400 | 3300041507 | Ga0451851_0438943 | Ga0451851_0438943_185_451 | 88 |
| 401 | 3300041509 | Ga0451843_1222740 | Ga0451843_1222740_384_650 | 88 |
| 402 | 3300041509 | Ga0451843_1529574 | Ga0451843_1529574_417_683 | 88 |
| 403 | 3300042010 | Ga0439452_010484 | Ga0439452_010484_369_635 | 88 |
| 404 | 3300042145 | Ga0450906_044706 | Ga0450906_044706_116_382 | 88 |
| 405 | 3300042876 | Ga0451577_0015537 | Ga0451577_0015537_4386_4652 | 88 |
| 406 | 3300044656 | Ga0466969_0032559 | Ga0466969_0032559_826_1092 | 88 |
| 407 | 3300044658 | Ga0466972_0188148 | Ga0466972_0188148_687_953 | 88 |
| 408 | 3300044684 | Ga0466966_0010105 | Ga0466966_0010105_3453_3719 | 88 |
| 409 | 3300044712 | Ga0453684_0010616 | Ga0453684_0010616_8884_9150 | 88 |
| 410 | 3300044712 | Ga0453684_1315259 | Ga0453684_1315259_284_550 | 88 |
| 411 | 3300044765 | Ga0466970_0931331 | Ga0466970_0931331_181_447 | 88 |
| 412 | 3300045049 | Ga0466959_0002148 | Ga0466959_0002148_8327_8593 | 88 |
| 413 | 3300045049 | Ga0466959_0042999 | Ga0466959_0042999_1944_2210 | 88 |
| 414 | 3300045051 | Ga0451576_2630017 | Ga0451576_2630017_175_441 | 88 |
| 415 | 3300046460 | Ga0495638_0078582 | Ga0495638_0078582_552_818 | 88 |
| 416 | 3300046460 | Ga0495638_0440958 | Ga0495638_0440958_51_317 | 88 |
| 417 | 3300046471 | Ga0495650_0016936 | Ga0495650_0016936_2984_3250 | 88 |
| 418 | 3300046471 | Ga0495650_0199536 | Ga0495650_0199536_237_503 | 88 |
| 419 | 3300046519 | Ga0495632_0141625 | Ga0495632_0141625_241_507 | 88 |
| 420 | 3300046539 | Ga0495621_0227454 | Ga0495621_0227454_463_729 | 88 |
| 421 | 3300046558 | Ga0495633_0040355 | Ga0495633_0040355_1586_1852 | 88 |
| 422 | 3300046660 | Ga0495625_0028658 | Ga0495625_0028658_1507_1773 | 88 |
| 423 | 3300046660 | Ga0495625_0045648 | Ga0495625_0045648_2210_2476 | 88 |
| 424 | 3300046675 | Ga0495657_0620187 | Ga0495657_0620187_237_503 | 88 |
| 425 | 3300046691 | Ga0495670_0726387 | Ga0495670_0726387_73_339 | 88 |
| 426 | 3300047322 | Ga0495680_0877039 | Ga0495680_0877039_46_312 | 88 |
| 427 | 3300048907 | Ga0496104_0047693 | Ga0496104_0047693_2183_2449 | 88 |
| 428 | 3300048907 | Ga0496104_0611785 | Ga0496104_0611785_722_988 | 88 |
| 429 | 3300048907 | Ga0496104_1836392 | Ga0496104_1836392_118_384 | 88 |
| 430 | 3300048908 | Ga0496105_0082258 | Ga0496105_0082258_568_834 | 88 |
| 431 | 3300048915 | Ga0496112_0452055 | Ga0496112_0452055_168_434 | 88 |
| 432 | 3300048916 | Ga0496113_0055996 | Ga0496113_0055996_1760_2026 | 88 |
| 433 | 3300048918 | Ga0496115_0000782 | Ga0496115_0000782_16348_16614 | 88 |
| 434 | 3300048919 | Ga0496116_0241377 | Ga0496116_0241377_148_414 | 88 |
| 435 | 3300048920 | Ga0496117_0001663 | Ga0496117_0001663_3869_4135 | 88 |
| 436 | 3300048921 | Ga0496118_0031793 | Ga0496118_0031793_4002_4268 | 88 |
| 437 | 3300048921 | Ga0496118_0035543 | Ga0496118_0035543_2658_2924 | 88 |
| 438 | 3300048921 | Ga0496118_0114282 | Ga0496118_0114282_576_842 | 88 |
| 439 | 3300048922 | Ga0496119_0000177 | Ga0496119_0000177_50302_50568 | 88 |
| 440 | 3300048922 | Ga0496119_0001108 | Ga0496119_0001108_31885_32151 | 88 |
| 441 | 3300048922 | Ga0496119_0350274 | Ga0496119_0350274_237_503 | 88 |
| 442 | 3300048923 | Ga0496120_0000188 | Ga0496120_0000188_31869_32135 | 88 |
| 443 | 3300048923 | Ga0496120_0000328 | Ga0496120_0000328_53702_53968 | 88 |
| 444 | 3300048923 | Ga0496120_0109591 | Ga0496120_0109591_690_956 | 88 |
| 445 | 3300048924 | Ga0496121_0025636 | Ga0496121_0025636_2338_2604 | 88 |
| 446 | 3300048924 | Ga0496121_0151460 | Ga0496121_0151460_1298_1564 | 88 |
| 447 | 3300048925 | Ga0496122_0000209 | Ga0496122_0000209_76200_76466 | 88 |
| 448 | 3300048925 | Ga0496122_0242202 | Ga0496122_0242202_166_432 | 88 |
| 449 | 3300048926 | Ga0496123_0000106 | Ga0496123_0000106_113554_113820 | 88 |
| 450 | 3300048926 | Ga0496123_0341377 | Ga0496123_0341377_80_346 | 88 |
| 451 | 3300048927 | Ga0496124_0000401 | Ga0496124_0000401_25103_25369 | 88 |
| 452 | 3300048928 | Ga0496125_0002206 | Ga0496125_0002206_22529_22795 | 88 |
| 453 | 3300048928 | Ga0496125_0038336 | Ga0496125_0038336_3203_3469 | 88 |
| 454 | 3300048929 | Ga0496126_0002462 | Ga0496126_0002462_3280_3546 | 88 |
| 455 | 3300049459 | Ga0495678_230501 | Ga0495678_230501_272_538 | 88 |
| 456 | 3300049568 | Ga0501031_0001097 | Ga0501031_0001097_5033_5299 | 88 |
| 457 | 3300049568 | Ga0501031_0213687 | Ga0501031_0213687_80_346 | 88 |
| 458 | 3300049569 | Ga0501032_0005261 | Ga0501032_0005261_3721_3987 | 88 |
| 459 | 3300049569 | Ga0501032_0014161 | Ga0501032_0014161_2594_2860 | 88 |
| 460 | 3300049569 | Ga0501032_0756536 | Ga0501032_0756536_55_321 | 88 |
| 461 | 3300049570 | Ga0501033_0000720 | Ga0501033_0000720_2116_2382 | 88 |
| 462 | 3300049570 | Ga0501033_0014033 | Ga0501033_0014033_2522_2788 | 88 |
| 463 | 3300049570 | Ga0501033_0031736 | Ga0501033_0031736_1729_1995 | 88 |
| 464 | 3300049571 | Ga0501034_0002484 | Ga0501034_0002484_7544_7810 | 88 |
| 465 | 3300049571 | Ga0501034_0004188 | Ga0501034_0004188_2244_2510 | 88 |
| 466 | 3300049571 | Ga0501034_0714230 | Ga0501034_0714230_599_865 | 88 |
| 467 | 3300049572 | Ga0501036_0007244 | Ga0501036_0007244_2786_3052 | 88 |
| 468 | 3300049572 | Ga0501036_0007930 | Ga0501036_0007930_6178_6444 | 88 |
| 469 | 3300049572 | Ga0501036_0160322 | Ga0501036_0160322_369_635 | 88 |
| 470 | 3300049572 | Ga0501036_0284259 | Ga0501036_0284259_299_565 | 88 |
| 471 | 3300049573 | Ga0501037_0001245 | Ga0501037_0001245_2812_3078 | 88 |
| 472 | 3300049573 | Ga0501037_0283164 | Ga0501037_0283164_354_620 | 88 |
| 473 | 3300049574 | Ga0501038_0000673 | Ga0501038_0000673_17568_17834 | 88 |
| 474 | 3300049574 | Ga0501038_0842244 | Ga0501038_0842244_188_454 | 88 |
| 475 | 3300049575 | Ga0501039_0002430 | Ga0501039_0002430_4359_4625 | 88 |
| 476 | 3300049575 | Ga0501039_0005379 | Ga0501039_0005379_1718_1984 | 88 |
| 477 | 3300049575 | Ga0501039_0052721 | Ga0501039_0052721_1969_2235 | 88 |
| 478 | 3300049576 | Ga0501040_0030210 | Ga0501040_0030210_1005_1271 | 88 |
| 479 | 3300049578 | Ga0501042_0000212 | Ga0501042_0000212_24098_24364 | 88 |
| 480 | 3300049578 | Ga0501042_0703901 | Ga0501042_0703901_248_514 | 88 |
| 481 | 3300049579 | Ga0501043_0003203 | Ga0501043_0003203_10693_10959 | 88 |
| 482 | 3300049579 | Ga0501043_0014430 | Ga0501043_0014430_4473_4739 | 88 |
| 483 | 3300049579 | Ga0501043_0028000 | Ga0501043_0028000_2817_3083 | 88 |
| 484 | 3300049579 | Ga0501043_0088572 | Ga0501043_0088572_736_1002 | 88 |
| 485 | 3300049580 | Ga0501046_0002962 | Ga0501046_0002962_6800_7066 | 88 |
| 486 | 3300049580 | Ga0501046_0013109 | Ga0501046_0013109_837_1103 | 88 |
| 487 | 3300049580 | Ga0501046_0013611 | Ga0501046_0013611_3490_3756 | 88 |
| 488 | 3300049581 | Ga0501047_0005546 | Ga0501047_0005546_5499_5765 | 88 |
| 489 | 3300049581 | Ga0501047_0034653 | Ga0501047_0034653_672_938 | 88 |
| 490 | 3300049581 | Ga0501047_0107772 | Ga0501047_0107772_1699_1965 | 88 |
| 491 | 3300049581 | Ga0501047_0208807 | Ga0501047_0208807_733_999 | 88 |
| 492 | 3300049582 | Ga0501048_0069337 | Ga0501048_0069337_1314_1580 | 88 |
| 493 | 3300049582 | Ga0501048_0095168 | Ga0501048_0095168_1485_1751 | 88 |
| 494 | 3300049583 | Ga0501067_0009020 | Ga0501067_0009020_4307_4573 | 88 |
| 495 | 3300049583 | Ga0501067_0041945 | Ga0501067_0041945_285_551 | 88 |
| 496 | 3300049583 | Ga0501067_0233470 | Ga0501067_0233470_648_914 | 88 |
| 497 | 3300049585 | Ga0501069_0055903 | Ga0501069_0055903_1371_1637 | 88 |
| 498 | 3300049585 | Ga0501069_0126607 | Ga0501069_0126607_1071_1337 | 88 |
| 499 | 3300049586 | Ga0501070_0056925 | Ga0501070_0056925_1113_1379 | 88 |
| 500 | 3300049586 | Ga0501070_0059406 | Ga0501070_0059406_2682_2948 | 88 |
| 501 | 3300049586 | Ga0501070_0138229 | Ga0501070_0138229_1444_1710 | 88 |
| 502 | 3300049586 | Ga0501070_0227269 | Ga0501070_0227269_942_1208 | 88 |
| 503 | 3300049587 | Ga0501071_0008741 | Ga0501071_0008741_2446_2712 | 88 |
| 504 | 3300049587 | Ga0501071_0095677 | Ga0501071_0095677_1320_1586 | 88 |
| 505 | 3300049588 | Ga0501072_0071696 | Ga0501072_0071696_1672_1938 | 88 |
| 506 | 3300049589 | Ga0501073_0016778 | Ga0501073_0016778_2420_2686 | 88 |
| 507 | 3300049589 | Ga0501073_0050715 | Ga0501073_0050715_398_664 | 88 |
| 508 | 3300049589 | Ga0501073_0989987 | Ga0501073_0989987_62_328 | 88 |
| 509 | 3300049590 | Ga0501074_0008025 | Ga0501074_0008025_3550_3816 | 88 |
| 510 | 3300049590 | Ga0501074_0025724 | Ga0501074_0025724_1226_1492 | 88 |
| 511 | 3300049591 | Ga0501075_0240312 | Ga0501075_0240312_130_396 | 88 |
| 512 | 3300049741 | Ga0501079_0016173 | Ga0501079_0016173_3829_4095 | 88 |
| 513 | 3300049741 | Ga0501079_0034570 | Ga0501079_0034570_2466_2732 | 88 |
| 514 | 3300049742 | Ga0501080_0021473 | Ga0501080_0021473_4370_4636 | 88 |
| 515 | 3300049742 | Ga0501080_0390689 | Ga0501080_0390689_672_938 | 88 |
| 516 | 3300049742 | Ga0501080_0460279 | Ga0501080_0460279_80_346 | 88 |
| 517 | 3300049743 | Ga0501081_0082346 | Ga0501081_0082346_231_497 | 88 |
| 518 | 3300049744 | Ga0501083_0016466 | Ga0501083_0016466_3843_4109 | 88 |
| 519 | 3300049822 | Ga0501035_0004344 | Ga0501035_0004344_12548_12814 | 88 |
| 520 | 3300049822 | Ga0501035_0021681 | Ga0501035_0021681_4422_4688 | 88 |
| 521 | 3300049822 | Ga0501035_0028763 | Ga0501035_0028763_4408_4674 | 88 |
| 522 | 3300049823 | Ga0501044_0006784 | Ga0501044_0006784_5561_5827 | 88 |
| 523 | 3300049823 | Ga0501044_0016545 | Ga0501044_0016545_2244_2510 | 88 |
| 524 | 3300049823 | Ga0501044_0114223 | Ga0501044_0114223_2119_2385 | 88 |
| 525 | 3300049824 | Ga0501045_0078084 | Ga0501045_0078084_1881_2147 | 88 |
| 526 | 3300049824 | Ga0501045_0447055 | Ga0501045_0447055_25_291 | 88 |
| 527 | 3300050509 | nmdc:mga0qj67_9876_c1 | nmdc:mga0qj67_9876_c1_2259_2525 | 88 |
| 528 | 3300053088 | Ga0500644_0029071 | Ga0500644_0029071_1382_1648 | 88 |
| 529 | 3300053105 | Ga0500557_102851 | Ga0500557_102851_604_870 | 88 |
| 530 | 3300053111 | Ga0500572_093531 | Ga0500572_093531_62_328 | 88 |
| 531 | 3300053115 | Ga0500591_144680 | Ga0500591_144680_446_712 | 88 |
| 532 | 3300053159 | Ga0500630_070629 | Ga0500630_070629_687_953 | 88 |
| 533 | 3300053163 | Ga0500639_198171 | Ga0500639_198171_277_543 | 88 |
| 534 | 3300054114 | Ga0501084_0062028 | Ga0501084_0062028_1616_1882 | 88 |
| 535 | 3300054114 | Ga0501084_0198135 | Ga0501084_0198135_601_867 | 88 |
| 536 | 3300060353 | Ga0501082_0054243 | Ga0501082_0054243_2756_3022 | 88 |
| 537 | 3300060353 | Ga0501082_0348151 | Ga0501082_0348151_184_450 | 88 |
| 538 | 3300061734 | Ga0530510_0087572 | Ga0530510_0087572_157_423 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar