F460193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 281 | 531 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_1122703|Ga0501040_1122703_112_459 |
| Length | 115 |
| Sequence | MRLTMLETGKTRIVLPERIQRGDVVRVQIVVQHPMDTGFFRDANANIIPAWFISDVRVLLNGGEIARFEWTSGISRDPMVAFRLKAETEGTLTVVSKDNRGSEFRGSAEIKFATT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 167 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 168 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 169 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 170 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 171 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 220 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 222 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 223 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 236 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 239 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 240 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 242 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 243 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 245 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 246 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 247 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 250 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 253 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 255 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 261 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 263 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.17 |
| Rhizosphere | 89.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4742051 | 2162886012 | Bacteria | 1983 |
| 2 | Ga0058862_11776041 | 3300004803 | Unclassified | 594 |
| 3 | Ga0065715_10010100 | 3300005293 | Unclassified | 3582 |
| 4 | Ga0065715_10255232 | 3300005293 | Bacteria | 1154 |
| 5 | Ga0065715_10863454 | 3300005293 | Unclassified | 577 |
| 6 | Ga0070676_10000689 | 3300005328 | Bacteria | 16580 |
| 7 | Ga0070683_100311457 | 3300005329 | Unclassified | 1498 |
| 8 | Ga0070690_100034372 | 3300005330 | Unclassified | 3177 |
| 9 | Ga0070690_100268539 | 3300005330 | Bacteria | 1213 |
| 10 | Ga0070690_100965893 | 3300005330 | Unclassified | 670 |
| 11 | Ga0070670_101144989 | 3300005331 | Bacteria | 710 |
| 12 | Ga0070677_10891181 | 3300005333 | Unclassified | 513 |
| 13 | Ga0068869_100005324 | 3300005334 | Bacteria | 8087 |
| 14 | Ga0070666_10056084 | 3300005335 | Bacteria | 2660 |
| 15 | Ga0070680_100020954 | 3300005336 | Bacteria | 5191 |
| 16 | Ga0070680_101028649 | 3300005336 | Unclassified | 712 |
| 17 | Ga0070682_100254066 | 3300005337 | Bacteria | 1269 |
| 18 | Ga0070660_100919514 | 3300005339 | Unclassified | 738 |
| 19 | Ga0070691_10016149 | 3300005341 | Bacteria | 3431 |
| 20 | Ga0070691_10506471 | 3300005341 | Bacteria | 699 |
| 21 | Ga0070692_10249134 | 3300005345 | Bacteria | 1062 |
| 22 | Ga0070668_100405644 | 3300005347 | Bacteria | 1164 |
| 23 | Ga0070668_101064042 | 3300005347 | Unclassified | 729 |
| 24 | Ga0070668_101921552 | 3300005347 | Bacteria | 545 |
| 25 | Ga0070669_100121329 | 3300005353 | Bacteria | 1994 |
| 26 | Ga0070675_100321699 | 3300005354 | Bacteria | 1366 |
| 27 | Ga0070671_100956414 | 3300005355 | Unclassified | 749 |
| 28 | Ga0070674_100000437 | 3300005356 | Bacteria | 21014 |
| 29 | Ga0070659_101030725 | 3300005366 | Archaea | 723 |
| 30 | Ga0070659_101069219 | 3300005366 | Bacteria | 710 |
| 31 | Ga0070659_101077493 | 3300005366 | Unclassified | 708 |
| 32 | Ga0070659_101608070 | 3300005366 | Unclassified | 580 |
| 33 | Ga0070709_10633794 | 3300005434 | Unclassified | 826 |
| 34 | Ga0070713_100434924 | 3300005436 | Unclassified | 1230 |
| 35 | Ga0070713_102315657 | 3300005436 | Unclassified | 520 |
| 36 | Ga0070701_11374875 | 3300005438 | Unclassified | 507 |
| 37 | Ga0070705_100008391 | 3300005440 | Bacteria | 5117 |
| 38 | Ga0070705_100108939 | 3300005440 | Bacteria | 1765 |
| 39 | Ga0070705_100163741 | 3300005440 | Bacteria | 1490 |
| 40 | Ga0070700_101130691 | 3300005441 | Unclassified | 651 |
| 41 | Ga0070694_100133889 | 3300005444 | Unclassified | 1794 |
| 42 | Ga0070694_100192432 | 3300005444 | Bacteria | 1515 |
| 43 | Ga0070694_100251359 | 3300005444 | Bacteria | 1337 |
| 44 | Ga0070708_100002723 | 3300005445 | Bacteria | 13718 |
| 45 | Ga0070708_100061914 | 3300005445 | Bacteria | 3345 |
| 46 | Ga0070708_100167838 | 3300005445 | Bacteria | 2048 |
| 47 | Ga0070708_101233343 | 3300005445 | Unclassified | 699 |
| 48 | Ga0070708_102016726 | 3300005445 | Bacteria | 534 |
| 49 | Ga0070663_100033021 | 3300005455 | Bacteria | 3572 |
| 50 | Ga0070663_100280431 | 3300005455 | Unclassified | 1328 |
| 51 | Ga0070678_100013437 | 3300005456 | Bacteria | 5134 |
| 52 | Ga0070678_100857623 | 3300005456 | Unclassified | 828 |
| 53 | Ga0070662_100001184 | 3300005457 | Bacteria | 15989 |
| 54 | Ga0070662_100489014 | 3300005457 | Bacteria | 1025 |
| 55 | Ga0070681_10030120 | 3300005458 | Bacteria | 5445 |
| 56 | Ga0070681_10221528 | 3300005458 | Bacteria | 1807 |
| 57 | Ga0070681_10224415 | 3300005458 | Bacteria | 1794 |
| 58 | Ga0070681_10790468 | 3300005458 | Bacteria | 866 |
| 59 | Ga0068867_100002643 | 3300005459 | Bacteria | 12638 |
| 60 | Ga0070707_100006439 | 3300005468 | Bacteria | 10915 |
| 61 | Ga0070707_100259106 | 3300005468 | Bacteria | 1692 |
| 62 | Ga0070707_100627139 | 3300005468 | Unclassified | 1038 |
| 63 | Ga0070699_100013167 | 3300005518 | Bacteria | 7132 |
| 64 | Ga0070699_100711297 | 3300005518 | Unclassified | 918 |
| 65 | Ga0070699_100950409 | 3300005518 | Unclassified | 788 |
| 66 | Ga0070679_100128767 | 3300005530 | Unclassified | 2512 |
| 67 | Ga0070679_100411145 | 3300005530 | Bacteria | 1299 |
| 68 | Ga0070679_100413384 | 3300005530 | Unclassified | 1294 |
| 69 | Ga0070679_101133272 | 3300005530 | Bacteria | 727 |
| 70 | Ga0070679_101413215 | 3300005530 | Unclassified | 642 |
| 71 | Ga0070697_100198670 | 3300005536 | Bacteria | 1704 |
| 72 | Ga0070697_100361879 | 3300005536 | Bacteria | 1254 |
| 73 | Ga0070697_100594661 | 3300005536 | Unclassified | 972 |
| 74 | Ga0070697_101594364 | 3300005536 | Unclassified | 584 |
| 75 | Ga0068853_100180754 | 3300005539 | Unclassified | 1913 |
| 76 | Ga0068853_100247780 | 3300005539 | Bacteria | 1634 |
| 77 | Ga0070672_100504633 | 3300005543 | Bacteria | 1047 |
| 78 | Ga0070686_100112691 | 3300005544 | Bacteria | 1855 |
| 79 | Ga0070695_100022448 | 3300005545 | Bacteria | 3870 |
| 80 | Ga0070695_100053517 | 3300005545 | Unclassified | 2596 |
| 81 | Ga0070695_101488842 | 3300005545 | Unclassified | 563 |
| 82 | Ga0070696_100003093 | 3300005546 | Bacteria | 11069 |
| 83 | Ga0070696_100076537 | 3300005546 | Bacteria | 2363 |
| 84 | Ga0070696_100192126 | 3300005546 | Bacteria | 1520 |
| 85 | Ga0070696_100486995 | 3300005546 | Unclassified | 979 |
| 86 | Ga0070693_100009180 | 3300005547 | Unclassified | 4912 |
| 87 | Ga0070693_101007807 | 3300005547 | Unclassified | 630 |
| 88 | Ga0070693_101611325 | 3300005547 | Unclassified | 510 |
| 89 | Ga0070704_100006869 | 3300005549 | Bacteria | 6740 |
| 90 | Ga0070704_100021934 | 3300005549 | Bacteria | 4148 |
| 91 | Ga0070704_100658280 | 3300005549 | Unclassified | 925 |
| 92 | Ga0068855_100227642 | 3300005563 | Unclassified | 2089 |
| 93 | Ga0068857_100029068 | 3300005577 | Bacteria | 4877 |
| 94 | Ga0068854_100000862 | 3300005578 | Bacteria | 18171 |
| 95 | Ga0068854_100222897 | 3300005578 | Bacteria | 1493 |
| 96 | Ga0068856_102141134 | 3300005614 | Unclassified | 569 |
| 97 | Ga0070702_100014670 | 3300005615 | Bacteria | 3980 |
| 98 | Ga0070702_100090661 | 3300005615 | Bacteria | 1853 |
| 99 | Ga0070702_100148108 | 3300005615 | Bacteria | 1503 |
| 100 | Ga0070702_101208883 | 3300005615 | Unclassified | 609 |
| 101 | Ga0068852_100092629 | 3300005616 | Bacteria | 2707 |
| 102 | Ga0068852_101243505 | 3300005616 | Unclassified | 766 |
| 103 | Ga0068859_100049602 | 3300005617 | Unclassified | 4216 |
| 104 | Ga0068859_100216805 | 3300005617 | Bacteria | 2001 |
| 105 | Ga0068859_101339601 | 3300005617 | Bacteria | 789 |
| 106 | Ga0068864_100022287 | 3300005618 | Bacteria | 5310 |
| 107 | Ga0068864_100447666 | 3300005618 | Bacteria | 1235 |
| 108 | Ga0068864_100942303 | 3300005618 | Bacteria | 854 |
| 109 | Ga0068864_101356884 | 3300005618 | Unclassified | 712 |
| 110 | Ga0068866_10000042 | 3300005718 | Bacteria | 48856 |
| 111 | Ga0068866_10282113 | 3300005718 | Unclassified | 1029 |
| 112 | Ga0068866_10739080 | 3300005718 | Unclassified | 678 |
| 113 | Ga0068861_100594797 | 3300005719 | Unclassified | 1014 |
| 114 | Ga0068870_10075252 | 3300005840 | Archaea | 1852 |
| 115 | Ga0068863_100279279 | 3300005841 | Bacteria | 1618 |
| 116 | Ga0068863_100827953 | 3300005841 | Unclassified | 924 |
| 117 | Ga0068863_101846522 | 3300005841 | Bacteria | 614 |
| 118 | Ga0068858_100051116 | 3300005842 | Bacteria | 3824 |
| 119 | Ga0068860_101893919 | 3300005843 | Unclassified | 618 |
| 120 | Ga0070715_10110857 | 3300006163 | Bacteria | 1294 |
| 121 | Ga0097621_100058094 | 3300006237 | Bacteria | 3165 |
| 122 | Ga0068871_100269892 | 3300006358 | Bacteria | 1486 |
| 123 | Ga0075428_100061383 | 3300006844 | Bacteria | 4117 |
| 124 | Ga0075428_100779982 | 3300006844 | Unclassified | 1016 |
| 125 | Ga0075430_100011232 | 3300006846 | Bacteria | 7595 |
| 126 | Ga0075430_100577768 | 3300006846 | Unclassified | 927 |
| 127 | Ga0075431_100016224 | 3300006847 | Bacteria | 7556 |
| 128 | Ga0075431_100126054 | 3300006847 | Bacteria | 2642 |
| 129 | Ga0075431_101036867 | 3300006847 | Archaea | 786 |
| 130 | Ga0075433_10036183 | 3300006852 | Bacteria | 4251 |
| 131 | Ga0075433_10072461 | 3300006852 | Bacteria | 3029 |
| 132 | Ga0075433_10694274 | 3300006852 | Bacteria | 891 |
| 133 | Ga0075433_11000036 | 3300006852 | Unclassified | 728 |
| 134 | Ga0075434_100001882 | 3300006871 | Bacteria | 18167 |
| 135 | Ga0075434_100407861 | 3300006871 | Bacteria | 1380 |
| 136 | Ga0075434_100433145 | 3300006871 | Bacteria | 1336 |
| 137 | Ga0075434_100469112 | 3300006871 | Bacteria | 1280 |
| 138 | Ga0075434_101469555 | 3300006871 | Bacteria | 691 |
| 139 | Ga0075429_100058921 | 3300006880 | Bacteria | 3345 |
| 140 | Ga0068865_100002446 | 3300006881 | Bacteria | 10983 |
| 141 | Ga0068865_100395853 | 3300006881 | Bacteria | 1130 |
| 142 | Ga0075436_100010878 | 3300006914 | Bacteria | 6243 |
| 143 | Ga0075436_100041869 | 3300006914 | Bacteria | 3160 |
| 144 | Ga0097620_100049602 | 3300006931 | Unclassified | 4216 |
| 145 | Ga0097620_100216813 | 3300006931 | Bacteria | 2001 |
| 146 | Ga0097620_101339044 | 3300006931 | Bacteria | 789 |
| 147 | Ga0075435_100437488 | 3300007076 | Bacteria | 1127 |
| 148 | Ga0105240_10147722 | 3300009093 | Bacteria | 2803 |
| 149 | Ga0105245_10024899 | 3300009098 | Bacteria | 5260 |
| 150 | Ga0105245_10606438 | 3300009098 | Unclassified | 1122 |
| 151 | Ga0114129_10000461 | 3300009147 | Bacteria | 48733 |
| 152 | Ga0114129_10469381 | 3300009147 | Bacteria | 1648 |
| 153 | Ga0114129_10651154 | 3300009147 | Bacteria | 1360 |
| 154 | Ga0114129_12091829 | 3300009147 | Unclassified | 683 |
| 155 | Ga0105243_10010025 | 3300009148 | Bacteria | 7205 |
| 156 | Ga0105243_10752969 | 3300009148 | Bacteria | 955 |
| 157 | Ga0105241_10116920 | 3300009174 | Unclassified | 2142 |
| 158 | Ga0105242_10000472 | 3300009176 | Bacteria | 31922 |
| 159 | Ga0105242_10147117 | 3300009176 | Unclassified | 2050 |
| 160 | Ga0105242_12168473 | 3300009176 | Unclassified | 600 |
| 161 | Ga0105248_10058552 | 3300009177 | Bacteria | 4327 |
| 162 | Ga0105238_10429765 | 3300009551 | Bacteria | 1316 |
| 163 | Ga0105249_10002206 | 3300009553 | Bacteria | 16872 |
| 164 | Ga0105249_10659365 | 3300009553 | Unclassified | 1104 |
| 165 | Ga0105239_10022475 | 3300010375 | Bacteria | 6953 |
| 166 | Ga0105239_10023621 | 3300010375 | Bacteria | 6770 |
| 167 | Ga0105239_12466405 | 3300010375 | Unclassified | 606 |
| 168 | Ga0105246_10022881 | 3300011119 | Bacteria | 4038 |
| 169 | Ga0157371_10110095 | 3300013102 | Unclassified | 1955 |
| 170 | Ga0157378_10005549 | 3300013297 | Bacteria | 11047 |
| 171 | Ga0163162_10701581 | 3300013306 | Bacteria | 1133 |
| 172 | Ga0163162_11601925 | 3300013306 | Unclassified | 743 |
| 173 | Ga0157372_10049767 | 3300013307 | Bacteria | 4661 |
| 174 | Ga0157372_11062168 | 3300013307 | Bacteria | 937 |
| 175 | Ga0157375_10079347 | 3300013308 | Unclassified | 3318 |
| 176 | Ga0157375_11476830 | 3300013308 | Unclassified | 802 |
| 177 | Ga0157375_12980559 | 3300013308 | Bacteria | 565 |
| 178 | Ga0163163_10050389 | 3300014325 | Bacteria | 4100 |
| 179 | Ga0157380_12880517 | 3300014326 | Unclassified | 547 |
| 180 | Ga0157379_10014099 | 3300014968 | Bacteria | 7006 |
| 181 | Ga0157379_10051284 | 3300014968 | Bacteria | 3686 |
| 182 | Ga0163161_10073131 | 3300017792 | Unclassified | 2512 |
| 183 | Ga0207682_10602478 | 3300025893 | Unclassified | 518 |
| 184 | Ga0207642_10002227 | 3300025899 | Bacteria | 6019 |
| 185 | Ga0207642_10216600 | 3300025899 | Unclassified | 1068 |
| 186 | Ga0207680_10004957 | 3300025903 | Bacteria | 6339 |
| 187 | Ga0207685_10021741 | 3300025905 | Bacteria | 2155 |
| 188 | Ga0207645_10000983 | 3300025907 | Bacteria | 23564 |
| 189 | Ga0207654_10065431 | 3300025911 | Unclassified | 2140 |
| 190 | Ga0207707_10001053 | 3300025912 | Bacteria | 26453 |
| 191 | Ga0207707_10172657 | 3300025912 | Bacteria | 1889 |
| 192 | Ga0207707_11201419 | 3300025912 | Bacteria | 614 |
| 193 | Ga0207695_10154901 | 3300025913 | Unclassified | 2227 |
| 194 | Ga0207660_10045050 | 3300025917 | Unclassified | 3106 |
| 195 | Ga0207660_10378650 | 3300025917 | Unclassified | 1137 |
| 196 | Ga0207657_10810063 | 3300025919 | Unclassified | 724 |
| 197 | Ga0207652_10079391 | 3300025921 | Unclassified | 2867 |
| 198 | Ga0207652_10367384 | 3300025921 | Bacteria | 1299 |
| 199 | Ga0207652_10700042 | 3300025921 | Bacteria | 904 |
| 200 | Ga0207646_10043600 | 3300025922 | Bacteria | 4027 |
| 201 | Ga0207646_10241026 | 3300025922 | Bacteria | 1633 |
| 202 | Ga0207646_10270729 | 3300025922 | Bacteria | 1535 |
| 203 | Ga0207681_10006362 | 3300025923 | Bacteria | 7251 |
| 204 | Ga0207681_10179511 | 3300025923 | Bacteria | 1611 |
| 205 | Ga0207694_10667063 | 3300025924 | Unclassified | 876 |
| 206 | Ga0207694_11423879 | 3300025924 | Bacteria | 585 |
| 207 | Ga0207644_10792730 | 3300025931 | Unclassified | 792 |
| 208 | Ga0207690_10756050 | 3300025932 | Bacteria | 801 |
| 209 | Ga0207706_10000177 | 3300025933 | Bacteria | 70870 |
| 210 | Ga0207706_10670251 | 3300025933 | Bacteria | 887 |
| 211 | Ga0207686_10000606 | 3300025934 | Bacteria | 22418 |
| 212 | Ga0207686_10979786 | 3300025934 | Unclassified | 685 |
| 213 | Ga0207709_10002923 | 3300025935 | Bacteria | 10431 |
| 214 | Ga0207669_10000859 | 3300025937 | Bacteria | 12942 |
| 215 | Ga0207704_10008011 | 3300025938 | Bacteria | 5026 |
| 216 | Ga0207704_10204866 | 3300025938 | Bacteria | 1447 |
| 217 | Ga0207691_10160665 | 3300025940 | Bacteria | 1971 |
| 218 | Ga0207711_10113607 | 3300025941 | Bacteria | 2411 |
| 219 | Ga0207689_10010683 | 3300025942 | Bacteria | 7899 |
| 220 | Ga0207661_10383371 | 3300025944 | Bacteria | 1273 |
| 221 | Ga0207679_10444782 | 3300025945 | Bacteria | 1148 |
| 222 | Ga0207667_11082389 | 3300025949 | Bacteria | 785 |
| 223 | Ga0207712_10003207 | 3300025961 | Bacteria | 10397 |
| 224 | Ga0207668_10129624 | 3300025972 | Unclassified | 1924 |
| 225 | Ga0207640_10001452 | 3300025981 | Bacteria | 12818 |
| 226 | Ga0207658_10089310 | 3300025986 | Bacteria | 2385 |
| 227 | Ga0207677_11298121 | 3300026023 | Bacteria | 668 |
| 228 | Ga0207639_10079724 | 3300026041 | Bacteria | 2588 |
| 229 | Ga0207639_10956457 | 3300026041 | Unclassified | 801 |
| 230 | Ga0207678_10016773 | 3300026067 | Bacteria | 6432 |
| 231 | Ga0207678_10111789 | 3300026067 | Bacteria | 2330 |
| 232 | Ga0207708_10034807 | 3300026075 | Unclassified | 3832 |
| 233 | Ga0207708_10125851 | 3300026075 | Bacteria | 2000 |
| 234 | Ga0207702_10181222 | 3300026078 | Unclassified | 1940 |
| 235 | Ga0207641_10076858 | 3300026088 | Bacteria | 2888 |
| 236 | Ga0207641_10397192 | 3300026088 | Bacteria | 1323 |
| 237 | Ga0207648_10000509 | 3300026089 | Bacteria | 43452 |
| 238 | Ga0207648_10299382 | 3300026089 | Unclassified | 1442 |
| 239 | Ga0207648_10307842 | 3300026089 | Bacteria | 1422 |
| 240 | Ga0207676_10010989 | 3300026095 | Bacteria | 6463 |
| 241 | Ga0207676_10397357 | 3300026095 | Bacteria | 1287 |
| 242 | Ga0207676_10896943 | 3300026095 | Bacteria | 869 |
| 243 | Ga0207674_10030283 | 3300026116 | Bacteria | 5692 |
| 244 | Ga0207675_100616750 | 3300026118 | Unclassified | 1089 |
| 245 | Ga0207683_10061180 | 3300026121 | Bacteria | 3313 |
| 246 | Ga0207683_10862815 | 3300026121 | Bacteria | 840 |
| 247 | Ga0207698_10120020 | 3300026142 | Unclassified | 2223 |
| 248 | Ga0207698_10487671 | 3300026142 | Bacteria | 1197 |
| 249 | Ga0210000_1035545 | 3300027462 | Bacteria | 785 |
| 250 | Ga0209982_1026442 | 3300027552 | Bacteria | 905 |
| 251 | Ga0209974_10020070 | 3300027876 | Bacteria | 2215 |
| 252 | Ga0209974_10023602 | 3300027876 | Unclassified | 2035 |
| 253 | Ga0207428_10599411 | 3300027907 | Unclassified | 794 |
| 254 | Ga0268264_10006168 | 3300028381 | Bacteria | 10121 |
| 255 | Ga0268264_10760732 | 3300028381 | Bacteria | 966 |
| 256 | Ga0316182_1366327 | 3300030745 | Bacteria | 576 |
| 257 | Ga0307408_100013303 | 3300031548 | Bacteria | 5462 |
| 258 | Ga0307408_100050706 | 3300031548 | Bacteria | 2986 |
| 259 | Ga0307408_100068870 | 3300031548 | Bacteria | 2607 |
| 260 | Ga0307408_100952983 | 3300031548 | Bacteria | 788 |
| 261 | Ga0307408_101085817 | 3300031548 | Unclassified | 742 |
| 262 | Ga0307405_10003608 | 3300031731 | Bacteria | 7152 |
| 263 | Ga0307405_10021728 | 3300031731 | Bacteria | 3613 |
| 264 | Ga0307405_10096267 | 3300031731 | Bacteria | 1973 |
| 265 | Ga0307405_10632381 | 3300031731 | Bacteria | 878 |
| 266 | Ga0307413_10003475 | 3300031824 | Bacteria | 6636 |
| 267 | Ga0307413_10020957 | 3300031824 | Bacteria | 3488 |
| 268 | Ga0307413_10141251 | 3300031824 | Unclassified | 1664 |
| 269 | Ga0307413_11001883 | 3300031824 | Bacteria | 716 |
| 270 | Ga0307413_11309505 | 3300031824 | Unclassified | 634 |
| 271 | Ga0307410_10000197 | 3300031852 | Bacteria | 22538 |
| 272 | Ga0307410_10021980 | 3300031852 | Bacteria | 3934 |
| 273 | Ga0307410_10352108 | 3300031852 | Unclassified | 1177 |
| 274 | Ga0307410_10512543 | 3300031852 | Bacteria | 988 |
| 275 | Ga0307406_10017307 | 3300031901 | Bacteria | 4197 |
| 276 | Ga0307406_10055365 | 3300031901 | Unclassified | 2535 |
| 277 | Ga0307406_10097498 | 3300031901 | Bacteria | 1994 |
| 278 | Ga0307406_10146825 | 3300031901 | Unclassified | 1677 |
| 279 | Ga0307406_11683852 | 3300031901 | Unclassified | 562 |
| 280 | Ga0307407_10004864 | 3300031903 | Bacteria | 5765 |
| 281 | Ga0307407_10091603 | 3300031903 | Bacteria | 1864 |
| 282 | Ga0307407_10213586 | 3300031903 | Unclassified | 1300 |
| 283 | Ga0307407_10867184 | 3300031903 | Bacteria | 691 |
| 284 | Ga0307412_10010435 | 3300031911 | Bacteria | 5349 |
| 285 | Ga0307412_10011558 | 3300031911 | Bacteria | 5119 |
| 286 | Ga0307412_10088651 | 3300031911 | Bacteria | 2159 |
| 287 | Ga0307412_10763125 | 3300031911 | Unclassified | 836 |
| 288 | Ga0307409_100000684 | 3300031995 | Bacteria | 15063 |
| 289 | Ga0307409_100007028 | 3300031995 | Bacteria | 6692 |
| 290 | Ga0307409_100031266 | 3300031995 | Unclassified | 3839 |
| 291 | Ga0307409_100124119 | 3300031995 | Bacteria | 2193 |
| 292 | Ga0307409_100585256 | 3300031995 | Unclassified | 1101 |
| 293 | Ga0307409_101774560 | 3300031995 | Bacteria | 646 |
| 294 | Ga0307409_101999019 | 3300031995 | Unclassified | 609 |
| 295 | Ga0307416_100000627 | 3300032002 | Bacteria | 18209 |
| 296 | Ga0307416_100009337 | 3300032002 | Bacteria | 6414 |
| 297 | Ga0307416_100075255 | 3300032002 | Unclassified | 2825 |
| 298 | Ga0307416_100082093 | 3300032002 | Bacteria | 2729 |
| 299 | Ga0307416_100252921 | 3300032002 | Bacteria | 1716 |
| 300 | Ga0307416_100256277 | 3300032002 | Bacteria | 1706 |
| 301 | Ga0307416_100623568 | 3300032002 | Unclassified | 1160 |
| 302 | Ga0307416_101998468 | 3300032002 | Unclassified | 682 |
| 303 | Ga0307416_102067442 | 3300032002 | Unclassified | 672 |
| 304 | Ga0307414_10012618 | 3300032004 | Bacteria | 5005 |
| 305 | Ga0307414_10018619 | 3300032004 | Bacteria | 4281 |
| 306 | Ga0307414_10087816 | 3300032004 | Bacteria | 2299 |
| 307 | Ga0307414_10139257 | 3300032004 | Bacteria | 1897 |
| 308 | Ga0307414_10641624 | 3300032004 | Bacteria | 956 |
| 309 | Ga0307411_10000555 | 3300032005 | Bacteria | 13286 |
| 310 | Ga0307411_10001169 | 3300032005 | Bacteria | 10322 |
| 311 | Ga0307411_10010744 | 3300032005 | Bacteria | 4898 |
| 312 | Ga0307411_10018615 | 3300032005 | Bacteria | 3989 |
| 313 | Ga0307411_10431181 | 3300032005 | Unclassified | 1098 |
| 314 | Ga0307411_10466197 | 3300032005 | Bacteria | 1060 |
| 315 | Ga0307411_10670659 | 3300032005 | Bacteria | 900 |
| 316 | Ga0307415_100000340 | 3300032126 | Bacteria | 20087 |
| 317 | Ga0307415_100034728 | 3300032126 | Unclassified | 3287 |
| 318 | Ga0307415_100075996 | 3300032126 | Bacteria | 2379 |
| 319 | Ga0307415_100133662 | 3300032126 | Bacteria | 1882 |
| 320 | Ga0373930_0019243 | 3300034816 | Bacteria | 1320 |
| 321 | Ga0373950_0027011 | 3300034818 | Unclassified | 1045 |
| 322 | Ga0373929_0048998 | 3300035085 | Bacteria | 961 |
| 323 | Ga0373940_0001797 | 3300035088 | Bacteria | 4002 |
| 324 | Ga0373940_0259448 | 3300035088 | Bacteria | 588 |
| 325 | Ga0373951_0059960 | 3300035091 | Unclassified | 951 |
| 326 | Ga0373939_0015932 | 3300035114 | Unclassified | 1975 |
| 327 | Ga0373941_0056510 | 3300035115 | Bacteria | 1264 |
| 328 | Ga0373961_0037100 | 3300035241 | Unclassified | 1391 |
| 329 | Ga0373961_0092472 | 3300035241 | Bacteria | 968 |
| 330 | Ga0373961_0122326 | 3300035241 | Bacteria | 864 |
| 331 | Ga0373962_0101828 | 3300035242 | Bacteria | 897 |
| 332 | Ga0373931_0028128 | 3300035691 | Bacteria | 2875 |
| 333 | Ga0373931_0061901 | 3300035691 | Bacteria | 2019 |
| 334 | Ga0373931_0067652 | 3300035691 | Unclassified | 1942 |
| 335 | Ga0395900_1544106 | 3300037418 | Unclassified | 576 |
| 336 | Ga0395905_0212938 | 3300037471 | Unclassified | 1810 |
| 337 | Ga0395905_0214595 | 3300037471 | Bacteria | 1802 |
| 338 | Ga0395901_1219445 | 3300038443 | Bacteria | 717 |
| 339 | Ga0395901_1236189 | 3300038443 | Unclassified | 711 |
| 340 | Ga0395901_1436537 | 3300038443 | Unclassified | 647 |
| 341 | Ga0242419_007322 | 3300038698 | Bacteria | 813 |
| 342 | Ga0242420_007453 | 3300038996 | Unclassified | 1755 |
| 343 | Ga0439455_0014514 | 3300042012 | Bacteria | 1800 |
| 344 | Ga0450892_016211 | 3300042130 | Unclassified | 700 |
| 345 | Ga0439434_0309648 | 3300042435 | Bacteria | 547 |
| 346 | Ga0439459_0061961 | 3300042438 | Bacteria | 847 |
| 347 | Ga0439459_0183601 | 3300042438 | Bacteria | 563 |
| 348 | Ga0451577_0051078 | 3300042876 | Bacteria | 3691 |
| 349 | Ga0451577_0682279 | 3300042876 | Unclassified | 931 |
| 350 | Ga0451577_0811326 | 3300042876 | Archaea | 845 |
| 351 | Ga0453683_0190170 | 3300044673 | Bacteria | 1302 |
| 352 | Ga0453683_0568193 | 3300044673 | Unclassified | 738 |
| 353 | Ga0453683_0613038 | 3300044673 | Unclassified | 710 |
| 354 | Ga0453684_0190347 | 3300044712 | Unclassified | 2401 |
| 355 | Ga0453684_0580741 | 3300044712 | Unclassified | 1231 |
| 356 | Ga0453684_0825662 | 3300044712 | Unclassified | 998 |
| 357 | Ga0466957_0389253 | 3300044842 | Bacteria | 952 |
| 358 | Ga0466960_0022324 | 3300044901 | Bacteria | 2829 |
| 359 | Ga0451576_0123606 | 3300045051 | Bacteria | 2695 |
| 360 | Ga0466967_1788657 | 3300045976 | Bacteria | 612 |
| 361 | Ga0495592_0288431 | 3300046454 | Archaea | 1071 |
| 362 | Ga0495603_0050101 | 3300046455 | Unclassified | 2484 |
| 363 | Ga0495641_0058945 | 3300046461 | Archaea | 1736 |
| 364 | Ga0495580_0196061 | 3300046472 | Archaea | 1392 |
| 365 | Ga0495582_0185633 | 3300046473 | Archaea | 1185 |
| 366 | Ga0495664_0013044 | 3300046477 | Unclassified | 4712 |
| 367 | Ga0495594_0004255 | 3300046499 | Bacteria | 7352 |
| 368 | Ga0495594_0091313 | 3300046499 | Unclassified | 1707 |
| 369 | Ga0495618_0010389 | 3300046514 | Bacteria | 5630 |
| 370 | Ga0495628_0372946 | 3300046516 | Archaea | 1046 |
| 371 | Ga0495630_0007057 | 3300046517 | Bacteria | 8005 |
| 372 | Ga0495666_0000404 | 3300046526 | Bacteria | 18997 |
| 373 | Ga0495640_0399855 | 3300046533 | Archaea | 843 |
| 374 | Ga0495586_0001360 | 3300046535 | Bacteria | 13586 |
| 375 | Ga0495622_0393434 | 3300046557 | Unclassified | 597 |
| 376 | Ga0495667_0277855 | 3300046559 | Unclassified | 1063 |
| 377 | Ga0495634_0008473 | 3300046642 | Bacteria | 7649 |
| 378 | Ga0495647_0011250 | 3300046681 | Unclassified | 3064 |
| 379 | Ga0495658_0006683 | 3300046683 | Bacteria | 5670 |
| 380 | Ga0495613_0210036 | 3300046689 | Archaea | 1369 |
| 381 | Ga0495624_0142720 | 3300046690 | Archaea | 1466 |
| 382 | Ga0495636_0030200 | 3300047318 | Unclassified | 2215 |
| 383 | Ga0495674_0162996 | 3300047319 | Unclassified | 1864 |
| 384 | Ga0495680_0015993 | 3300047322 | Bacteria | 6454 |
| 385 | Ga0495684_0442364 | 3300047471 | Unclassified | 905 |
| 386 | Ga0496100_0190307 | 3300048903 | Bacteria | 1489 |
| 387 | Ga0496101_0025057 | 3300048904 | Unclassified | 4135 |
| 388 | Ga0496101_0053904 | 3300048904 | Unclassified | 2903 |
| 389 | Ga0496101_0235448 | 3300048904 | Bacteria | 1424 |
| 390 | Ga0496102_0001806 | 3300048905 | Bacteria | 18514 |
| 391 | Ga0496102_0117164 | 3300048905 | Unclassified | 2486 |
| 392 | Ga0496102_0153040 | 3300048905 | Bacteria | 2168 |
| 393 | Ga0496102_0344019 | 3300048905 | Bacteria | 1404 |
| 394 | Ga0496102_0412806 | 3300048905 | Bacteria | 1268 |
| 395 | Ga0496103_0053656 | 3300048906 | Unclassified | 2498 |
| 396 | Ga0496103_0310355 | 3300048906 | Bacteria | 1015 |
| 397 | Ga0496103_0407032 | 3300048906 | Unclassified | 874 |
| 398 | Ga0496103_0548773 | 3300048906 | Unclassified | 738 |
| 399 | Ga0496104_0025303 | 3300048907 | Bacteria | 5471 |
| 400 | Ga0496104_0070232 | 3300048907 | Bacteria | 3329 |
| 401 | Ga0496104_0489960 | 3300048907 | Bacteria | 1140 |
| 402 | Ga0496104_0640605 | 3300048907 | Bacteria | 972 |
| 403 | Ga0496105_0048571 | 3300048908 | Unclassified | 3503 |
| 404 | Ga0496105_0408979 | 3300048908 | Bacteria | 1076 |
| 405 | Ga0496106_0012688 | 3300048909 | Bacteria | 6225 |
| 406 | Ga0496106_0045619 | 3300048909 | Bacteria | 3293 |
| 407 | Ga0496106_0460779 | 3300048909 | Bacteria | 1021 |
| 408 | Ga0496106_0602440 | 3300048909 | Unclassified | 880 |
| 409 | Ga0496106_0691536 | 3300048909 | Unclassified | 813 |
| 410 | Ga0496106_0827927 | 3300048909 | Unclassified | 733 |
| 411 | Ga0496106_1296335 | 3300048909 | Bacteria | 565 |
| 412 | Ga0496107_0115294 | 3300048910 | Bacteria | 1977 |
| 413 | Ga0496107_0175531 | 3300048910 | Bacteria | 1591 |
| 414 | Ga0496107_0593174 | 3300048910 | Unclassified | 819 |
| 415 | Ga0496108_0001317 | 3300048911 | Bacteria | 19520 |
| 416 | Ga0496108_0002308 | 3300048911 | Bacteria | 15273 |
| 417 | Ga0496108_0006014 | 3300048911 | Bacteria | 9826 |
| 418 | Ga0496109_0000573 | 3300048912 | Bacteria | 30760 |
| 419 | Ga0496109_0011909 | 3300048912 | Bacteria | 7488 |
| 420 | Ga0496109_0150557 | 3300048912 | Bacteria | 2178 |
| 421 | Ga0496110_0000669 | 3300048913 | Bacteria | 23519 |
| 422 | Ga0496110_0078888 | 3300048913 | Unclassified | 2931 |
| 423 | Ga0496110_0108688 | 3300048913 | Bacteria | 2490 |
| 424 | Ga0496110_1065359 | 3300048913 | Bacteria | 716 |
| 425 | Ga0496111_0005561 | 3300048914 | Bacteria | 8098 |
| 426 | Ga0496111_0022841 | 3300048914 | Unclassified | 4383 |
| 427 | Ga0496111_0090292 | 3300048914 | Bacteria | 2244 |
| 428 | Ga0496112_0012360 | 3300048915 | Bacteria | 7844 |
| 429 | Ga0496112_0019324 | 3300048915 | Bacteria | 6428 |
| 430 | Ga0496112_0022236 | 3300048915 | Bacteria | 6042 |
| 431 | Ga0496112_0068157 | 3300048915 | Unclassified | 3513 |
| 432 | Ga0496112_0341723 | 3300048915 | Bacteria | 1440 |
| 433 | Ga0496113_0000810 | 3300048916 | Bacteria | 16241 |
| 434 | Ga0496113_0002211 | 3300048916 | Bacteria | 11222 |
| 435 | Ga0496113_0043812 | 3300048916 | Unclassified | 3313 |
| 436 | Ga0496113_0081143 | 3300048916 | Bacteria | 2485 |
| 437 | Ga0496114_0011337 | 3300048917 | Bacteria | 7121 |
| 438 | Ga0496114_0031155 | 3300048917 | Bacteria | 4387 |
| 439 | Ga0496115_0293709 | 3300048918 | Bacteria | 1332 |
| 440 | Ga0501291_040718 | 3300049514 | Unclassified | 816 |
| 441 | Ga0501292_118445 | 3300049515 | Unclassified | 538 |
| 442 | Ga0501297_012395 | 3300049520 | Unclassified | 990 |
| 443 | Ga0501298_002931 | 3300049521 | Bacteria | 2622 |
| 444 | Ga0501299_060001 | 3300049522 | Unclassified | 804 |
| 445 | Ga0501036_0388272 | 3300049572 | Unclassified | 1165 |
| 446 | Ga0501040_0662889 | 3300049576 | Unclassified | 754 |
| 447 | Ga0501040_0834323 | 3300049576 | Bacteria | 667 |
| 448 | Ga0501040_1122703 | 3300049576 | Unclassified | 570 |
| 449 | Ga0501046_0837049 | 3300049580 | Unclassified | 644 |
| 450 | Ga0501048_0236198 | 3300049582 | Unclassified | 1297 |
| 451 | Ga0501067_0008708 | 3300049583 | Bacteria | 5621 |
| 452 | Ga0501067_0049896 | 3300049583 | Bacteria | 2319 |
| 453 | Ga0501067_0403519 | 3300049583 | Unclassified | 762 |
| 454 | Ga0501068_0124496 | 3300049584 | Bacteria | 1609 |
| 455 | Ga0501068_0843860 | 3300049584 | Unclassified | 602 |
| 456 | Ga0501069_0045851 | 3300049585 | Unclassified | 2423 |
| 457 | Ga0501069_0066741 | 3300049585 | Bacteria | 2012 |
| 458 | Ga0501069_0310492 | 3300049585 | Unclassified | 925 |
| 459 | Ga0501074_0257545 | 3300049590 | Unclassified | 1241 |
| 460 | Ga0501075_1158371 | 3300049591 | Unclassified | 587 |
| 461 | Ga0501076_1278680 | 3300049592 | Unclassified | 603 |
| 462 | Ga0501077_0292830 | 3300049593 | Unclassified | 1037 |
| 463 | Ga0501208_133004 | 3300049655 | Unclassified | 556 |
| 464 | Ga0501209_000383 | 3300049656 | Bacteria | 5397 |
| 465 | Ga0501211_017640 | 3300049658 | Unclassified | 730 |
| 466 | Ga0501214_000874 | 3300049659 | Bacteria | 2216 |
| 467 | Ga0501217_005169 | 3300049661 | Unclassified | 2717 |
| 468 | Ga0501217_073670 | 3300049661 | Bacteria | 934 |
| 469 | Ga0501223_027155 | 3300049663 | Unclassified | 1114 |
| 470 | Ga0501228_042510 | 3300049666 | Unclassified | 596 |
| 471 | Ga0501230_086422 | 3300049667 | Bacteria | 662 |
| 472 | Ga0501235_009347 | 3300049669 | Unclassified | 2143 |
| 473 | Ga0501239_009460 | 3300049672 | Unclassified | 1059 |
| 474 | Ga0501243_042956 | 3300049675 | Bacteria | 798 |
| 475 | Ga0501247_000081 | 3300049677 | Bacteria | 5188 |
| 476 | Ga0501247_045081 | 3300049677 | Unclassified | 640 |
| 477 | Ga0501248_004469 | 3300049678 | Unclassified | 1058 |
| 478 | Ga0501249_003437 | 3300049679 | Bacteria | 3179 |
| 479 | Ga0501249_037825 | 3300049679 | Bacteria | 1089 |
| 480 | Ga0501249_150460 | 3300049679 | Unclassified | 585 |
| 481 | Ga0501253_022437 | 3300049683 | Unclassified | 1124 |
| 482 | Ga0501258_015632 | 3300049687 | Unclassified | 851 |
| 483 | Ga0501259_021258 | 3300049688 | Unclassified | 1158 |
| 484 | Ga0501221_001100 | 3300049704 | Unclassified | 4441 |
| 485 | Ga0501225_0003693 | 3300049705 | Unclassified | 4607 |
| 486 | Ga0501229_026575 | 3300049706 | Bacteria | 781 |
| 487 | Ga0501234_043044 | 3300049707 | Unclassified | 742 |
| 488 | Ga0501245_008780 | 3300049708 | Bacteria | 1444 |
| 489 | Ga0501079_0010843 | 3300049741 | Bacteria | 6942 |
| 490 | Ga0501079_1063015 | 3300049741 | Unclassified | 638 |
| 491 | Ga0501081_0123833 | 3300049743 | Bacteria | 1843 |
| 492 | Ga0501081_0295562 | 3300049743 | Bacteria | 1188 |
| 493 | Ga0501081_1003167 | 3300049743 | Bacteria | 631 |
| 494 | Ga0501083_0766148 | 3300049744 | Bacteria | 628 |
| 495 | Ga0501232_025288 | 3300049757 | Unclassified | 793 |
| 496 | Ga0501262_061761 | 3300049759 | Unclassified | 599 |
| 497 | Ga0501263_000924 | 3300049760 | Unclassified | 2547 |
| 498 | Ga0501268_000867 | 3300049765 | Unclassified | 3528 |
| 499 | Ga0501272_037172 | 3300049769 | Bacteria | 639 |
| 500 | Ga0501276_008999 | 3300049773 | Unclassified | 821 |
| 501 | Ga0501283_004070 | 3300049779 | Unclassified | 1960 |
| 502 | Ga0501283_028885 | 3300049779 | Unclassified | 922 |
| 503 | Ga0501035_0785473 | 3300049822 | Unclassified | 762 |
| 504 | Ga0501045_0557302 | 3300049824 | Unclassified | 850 |
| 505 | Ga0501204_003629 | 3300049850 | Unclassified | 1633 |
| 506 | Ga0501204_073623 | 3300049850 | Unclassified | 567 |
| 507 | nmdc:mga05p37_1864981_c1 | 3300050507 | Unclassified | 576 |
| 508 | nmdc:mga05p37_3567_c1 | 3300050507 | Bacteria | 18184 |
| 509 | nmdc:mga05p37_373312_c1 | 3300050507 | Bacteria | 1673 |
| 510 | nmdc:mga05p37_802255_c1 | 3300050507 | Archaea | 1030 |
| 511 | nmdc:mga09592_787868_c1 | 3300050508 | Unclassified | 805 |
| 512 | nmdc:mga0qj67_201167_c1 | 3300050509 | Unclassified | 1618 |
| 513 | nmdc:mga0qj67_62133_c1 | 3300050509 | Bacteria | 2968 |
| 514 | nmdc:mga06r32_2946_c1 | 3300050510 | Bacteria | 15257 |
| 515 | nmdc:mga06r32_57392_c1 | 3300050510 | Bacteria | 3739 |
| 516 | nmdc:mga06r32_960018_c1 | 3300050510 | Archaea | 809 |
| 517 | nmdc:mga0n895_1237064_c1 | 3300050512 | Unclassified | 719 |
| 518 | nmdc:mga0n895_452121_c1 | 3300050512 | Bacteria | 1297 |
| 519 | nmdc:mga0n895_620238_c1 | 3300050512 | Bacteria | 1082 |
| 520 | nmdc:mga0n895_64843_c1 | 3300050512 | Bacteria | 3614 |
| 521 | nmdc:mga08x19_237539_c1 | 3300050514 | Bacteria | 1255 |
| 522 | nmdc:mga08x19_27931_c1 | 3300050514 | Bacteria | 3531 |
| 523 | nmdc:mga08x19_420790_c1 | 3300050514 | Bacteria | 938 |
| 524 | nmdc:mga0a205_104613_c1 | 3300050515 | Bacteria | 2730 |
| 525 | nmdc:mga0a205_86862_c2 | 3300050515 | Unclassified | 2638 |
| 526 | nmdc:mga0a205_9364_c1 | 3300050515 | Bacteria | 8951 |
| 527 | Ga0495612_0360793 | 3300053078 | Unclassified | 657 |
| 528 | Ga0587128_037996 | 3300059630 | Unclassified | 830 |
| 529 | Ga0587075_028041 | 3300059644 | Bacteria | 880 |
| 530 | Ga0501082_0182200 | 3300060353 | Unclassified | 1827 |
| 531 | Ga0530510_0512143 | 3300061734 | Bacteria | 910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_100251359 | Ga0070694_1002513592 | 108 |
| 2 | 3300005549 | Ga0070704_100658280 | Ga0070704_1006582802 | 108 |
| 3 | 3300030745 | Ga0316182_1366327 | Ga0316182_13663271 | 108 |
| 4 | 3300031548 | Ga0307408_100050706 | Ga0307408_1000507062 | 108 |
| 5 | 3300031731 | Ga0307405_10003608 | Ga0307405_100036085 | 108 |
| 6 | 3300031824 | Ga0307413_10020957 | Ga0307413_100209574 | 108 |
| 7 | 3300031852 | Ga0307410_10021980 | Ga0307410_100219802 | 108 |
| 8 | 3300031901 | Ga0307406_10017307 | Ga0307406_100173075 | 108 |
| 9 | 3300031903 | Ga0307407_10091603 | Ga0307407_100916032 | 108 |
| 10 | 3300031911 | Ga0307412_10010435 | Ga0307412_100104355 | 108 |
| 11 | 3300031995 | Ga0307409_100007028 | Ga0307409_1000070283 | 108 |
| 12 | 3300032002 | Ga0307416_100623568 | Ga0307416_1006235682 | 108 |
| 13 | 3300032004 | Ga0307414_10018619 | Ga0307414_100186192 | 108 |
| 14 | 3300032005 | Ga0307411_10018615 | Ga0307411_100186152 | 108 |
| 15 | 3300032126 | Ga0307415_100075996 | Ga0307415_1000759962 | 108 |
| 16 | 3300031911 | Ga0307412_10011558 | Ga0307412_100115586 | 109 |
| 17 | 3300032005 | Ga0307411_10000555 | Ga0307411_100005553 | 109 |
| 18 | 3300005329 | Ga0070683_100311457 | Ga0070683_1003114571 | 110 |
| 19 | 3300005331 | Ga0070670_101144989 | Ga0070670_1011449892 | 110 |
| 20 | 3300005347 | Ga0070668_101921552 | Ga0070668_1019215521 | 110 |
| 21 | 3300005353 | Ga0070669_100121329 | Ga0070669_1001213292 | 110 |
| 22 | 3300005366 | Ga0070659_101030725 | Ga0070659_1010307252 | 110 |
| 23 | 3300005434 | Ga0070709_10633794 | Ga0070709_106337942 | 110 |
| 24 | 3300005436 | Ga0070713_100434924 | Ga0070713_1004349242 | 110 |
| 25 | 3300005436 | Ga0070713_102315657 | Ga0070713_1023156572 | 110 |
| 26 | 3300005445 | Ga0070708_100061914 | Ga0070708_1000619143 | 110 |
| 27 | 3300005458 | Ga0070681_10221528 | Ga0070681_102215283 | 110 |
| 28 | 3300005468 | Ga0070707_100259106 | Ga0070707_1002591062 | 110 |
| 29 | 3300005468 | Ga0070707_100627139 | Ga0070707_1006271392 | 110 |
| 30 | 3300005518 | Ga0070699_100950409 | Ga0070699_1009504091 | 110 |
| 31 | 3300005530 | Ga0070679_101133272 | Ga0070679_1011332722 | 110 |
| 32 | 3300005536 | Ga0070697_100594661 | Ga0070697_1005946612 | 110 |
| 33 | 3300005547 | Ga0070693_101007807 | Ga0070693_1010078072 | 110 |
| 34 | 3300005618 | Ga0068864_100447666 | Ga0068864_1004476662 | 110 |
| 35 | 3300005618 | Ga0068864_100942303 | Ga0068864_1009423031 | 110 |
| 36 | 3300005841 | Ga0068863_100279279 | Ga0068863_1002792793 | 110 |
| 37 | 3300005841 | Ga0068863_100827953 | Ga0068863_1008279532 | 110 |
| 38 | 3300005841 | Ga0068863_101846522 | Ga0068863_1018465221 | 110 |
| 39 | 3300005843 | Ga0068860_101893919 | Ga0068860_1018939192 | 110 |
| 40 | 3300006847 | Ga0075431_101036867 | Ga0075431_1010368672 | 110 |
| 41 | 3300006852 | Ga0075433_10036183 | Ga0075433_100361833 | 110 |
| 42 | 3300006871 | Ga0075434_100469112 | Ga0075434_1004691123 | 110 |
| 43 | 3300006871 | Ga0075434_101469555 | Ga0075434_1014695552 | 110 |
| 44 | 3300006914 | Ga0075436_100041869 | Ga0075436_1000418694 | 110 |
| 45 | 3300009147 | Ga0114129_12091829 | Ga0114129_120918291 | 110 |
| 46 | 3300014325 | Ga0163163_10050389 | Ga0163163_100503894 | 110 |
| 47 | 3300014968 | Ga0157379_10051284 | Ga0157379_100512842 | 110 |
| 48 | 3300017792 | Ga0163161_10073131 | Ga0163161_100731312 | 110 |
| 49 | 3300025921 | Ga0207652_10700042 | Ga0207652_107000422 | 110 |
| 50 | 3300025922 | Ga0207646_10241026 | Ga0207646_102410262 | 110 |
| 51 | 3300025922 | Ga0207646_10270729 | Ga0207646_102707292 | 110 |
| 52 | 3300025945 | Ga0207679_10444782 | Ga0207679_104447822 | 110 |
| 53 | 3300026088 | Ga0207641_10076858 | Ga0207641_100768583 | 110 |
| 54 | 3300026088 | Ga0207641_10397192 | Ga0207641_103971923 | 110 |
| 55 | 3300026095 | Ga0207676_10397357 | Ga0207676_103973572 | 110 |
| 56 | 3300026095 | Ga0207676_10896943 | Ga0207676_108969431 | 110 |
| 57 | 3300028381 | Ga0268264_10760732 | Ga0268264_107607322 | 110 |
| 58 | 3300031548 | Ga0307408_100952983 | Ga0307408_1009529832 | 110 |
| 59 | 3300031824 | Ga0307413_11001883 | Ga0307413_110018832 | 110 |
| 60 | 3300031901 | Ga0307406_10146825 | Ga0307406_101468252 | 110 |
| 61 | 3300031901 | Ga0307406_11683852 | Ga0307406_116838521 | 110 |
| 62 | 3300031903 | Ga0307407_10867184 | Ga0307407_108671842 | 110 |
| 63 | 3300031995 | Ga0307409_100124119 | Ga0307409_1001241192 | 110 |
| 64 | 3300032002 | Ga0307416_100082093 | Ga0307416_1000820933 | 110 |
| 65 | 3300032002 | Ga0307416_100256277 | Ga0307416_1002562772 | 110 |
| 66 | 3300032002 | Ga0307416_102067442 | Ga0307416_1020674422 | 110 |
| 67 | 3300032004 | Ga0307414_10139257 | Ga0307414_101392572 | 110 |
| 68 | 3300032004 | Ga0307414_10641624 | Ga0307414_106416242 | 110 |
| 69 | 3300034816 | Ga0373930_0019243 | Ga0373930_0019243_807_1139 | 110 |
| 70 | 3300035085 | Ga0373929_0048998 | Ga0373929_0048998_352_684 | 110 |
| 71 | 3300035088 | Ga0373940_0001797 | Ga0373940_0001797_261_593 | 110 |
| 72 | 3300035088 | Ga0373940_0259448 | Ga0373940_0259448_226_558 | 110 |
| 73 | 3300035091 | Ga0373951_0059960 | Ga0373951_0059960_332_664 | 110 |
| 74 | 3300035114 | Ga0373939_0015932 | Ga0373939_0015932_869_1201 | 110 |
| 75 | 3300035241 | Ga0373961_0037100 | Ga0373961_0037100_841_1173 | 110 |
| 76 | 3300035241 | Ga0373961_0092472 | Ga0373961_0092472_168_500 | 110 |
| 77 | 3300035691 | Ga0373931_0061901 | Ga0373931_0061901_615_947 | 110 |
| 78 | 3300037471 | Ga0395905_0212938 | Ga0395905_0212938_773_1105 | 110 |
| 79 | 3300037471 | Ga0395905_0214595 | Ga0395905_0214595_1329_1661 | 110 |
| 80 | 3300038443 | Ga0395901_1219445 | Ga0395901_1219445_74_406 | 110 |
| 81 | 3300038443 | Ga0395901_1236189 | Ga0395901_1236189_171_503 | 110 |
| 82 | 3300042438 | Ga0439459_0183601 | Ga0439459_0183601_36_368 | 110 |
| 83 | 3300042876 | Ga0451577_0811326 | Ga0451577_0811326_192_524 | 110 |
| 84 | 3300044673 | Ga0453683_0613038 | Ga0453683_0613038_207_539 | 110 |
| 85 | 3300044712 | Ga0453684_0580741 | Ga0453684_0580741_718_1050 | 110 |
| 86 | 3300044712 | Ga0453684_0825662 | Ga0453684_0825662_54_386 | 110 |
| 87 | 3300046454 | Ga0495592_0288431 | Ga0495592_0288431_114_446 | 110 |
| 88 | 3300046461 | Ga0495641_0058945 | Ga0495641_0058945_633_965 | 110 |
| 89 | 3300046472 | Ga0495580_0196061 | Ga0495580_0196061_643_975 | 110 |
| 90 | 3300046473 | Ga0495582_0185633 | Ga0495582_0185633_201_533 | 110 |
| 91 | 3300046477 | Ga0495664_0013044 | Ga0495664_0013044_3759_4091 | 110 |
| 92 | 3300046499 | Ga0495594_0004255 | Ga0495594_0004255_2406_2738 | 110 |
| 93 | 3300046514 | Ga0495618_0010389 | Ga0495618_0010389_662_994 | 110 |
| 94 | 3300046516 | Ga0495628_0372946 | Ga0495628_0372946_616_948 | 110 |
| 95 | 3300046517 | Ga0495630_0007057 | Ga0495630_0007057_5606_5938 | 110 |
| 96 | 3300046526 | Ga0495666_0000404 | Ga0495666_0000404_7921_8253 | 110 |
| 97 | 3300046533 | Ga0495640_0399855 | Ga0495640_0399855_418_750 | 110 |
| 98 | 3300046535 | Ga0495586_0001360 | Ga0495586_0001360_5429_5761 | 110 |
| 99 | 3300046559 | Ga0495667_0277855 | Ga0495667_0277855_673_1005 | 110 |
| 100 | 3300046642 | Ga0495634_0008473 | Ga0495634_0008473_7260_7592 | 110 |
| 101 | 3300046681 | Ga0495647_0011250 | Ga0495647_0011250_2112_2444 | 110 |
| 102 | 3300046683 | Ga0495658_0006683 | Ga0495658_0006683_2142_2474 | 110 |
| 103 | 3300046689 | Ga0495613_0210036 | Ga0495613_0210036_596_928 | 110 |
| 104 | 3300046690 | Ga0495624_0142720 | Ga0495624_0142720_655_987 | 110 |
| 105 | 3300047319 | Ga0495674_0162996 | Ga0495674_0162996_865_1197 | 110 |
| 106 | 3300047322 | Ga0495680_0015993 | Ga0495680_0015993_1528_1860 | 110 |
| 107 | 3300047471 | Ga0495684_0442364 | Ga0495684_0442364_340_672 | 110 |
| 108 | 3300048905 | Ga0496102_0153040 | Ga0496102_0153040_577_909 | 110 |
| 109 | 3300048905 | Ga0496102_0344019 | Ga0496102_0344019_609_941 | 110 |
| 110 | 3300048906 | Ga0496103_0548773 | Ga0496103_0548773_136_468 | 110 |
| 111 | 3300048907 | Ga0496104_0025303 | Ga0496104_0025303_185_517 | 110 |
| 112 | 3300048907 | Ga0496104_0070232 | Ga0496104_0070232_1012_1344 | 110 |
| 113 | 3300048908 | Ga0496105_0408979 | Ga0496105_0408979_72_404 | 110 |
| 114 | 3300048909 | Ga0496106_0460779 | Ga0496106_0460779_207_539 | 110 |
| 115 | 3300048909 | Ga0496106_0691536 | Ga0496106_0691536_259_591 | 110 |
| 116 | 3300048909 | Ga0496106_1296335 | Ga0496106_1296335_29_361 | 110 |
| 117 | 3300048910 | Ga0496107_0175531 | Ga0496107_0175531_727_1059 | 110 |
| 118 | 3300048911 | Ga0496108_0001317 | Ga0496108_0001317_11063_11395 | 110 |
| 119 | 3300048911 | Ga0496108_0006014 | Ga0496108_0006014_2967_3299 | 110 |
| 120 | 3300048912 | Ga0496109_0150557 | Ga0496109_0150557_846_1178 | 110 |
| 121 | 3300048913 | Ga0496110_0078888 | Ga0496110_0078888_839_1171 | 110 |
| 122 | 3300048913 | Ga0496110_0108688 | Ga0496110_0108688_809_1141 | 110 |
| 123 | 3300048913 | Ga0496110_1065359 | Ga0496110_1065359_373_705 | 110 |
| 124 | 3300048914 | Ga0496111_0090292 | Ga0496111_0090292_708_1040 | 110 |
| 125 | 3300048915 | Ga0496112_0019324 | Ga0496112_0019324_5096_5428 | 110 |
| 126 | 3300048915 | Ga0496112_0341723 | Ga0496112_0341723_419_751 | 110 |
| 127 | 3300048916 | Ga0496113_0081143 | Ga0496113_0081143_764_1096 | 110 |
| 128 | 3300049583 | Ga0501067_0049896 | Ga0501067_0049896_1691_2023 | 110 |
| 129 | 3300049661 | Ga0501217_073670 | Ga0501217_073670_511_843 | 110 |
| 130 | 3300049769 | Ga0501272_037172 | Ga0501272_037172_133_465 | 110 |
| 131 | 3300050507 | nmdc:mga05p37_802255_c1 | nmdc:mga05p37_802255_c1_490_822 | 110 |
| 132 | 3300050509 | nmdc:mga0qj67_201167_c1 | nmdc:mga0qj67_201167_c1_776_1108 | 110 |
| 133 | 3300050510 | nmdc:mga06r32_960018_c1 | nmdc:mga06r32_960018_c1_216_548 | 110 |
| 134 | 3300050512 | nmdc:mga0n895_1237064_c1 | nmdc:mga0n895_1237064_c1_65_397 | 110 |
| 135 | 3300050512 | nmdc:mga0n895_620238_c1 | nmdc:mga0n895_620238_c1_235_567 | 110 |
| 136 | 3300050515 | nmdc:mga0a205_9364_c1 | nmdc:mga0a205_9364_c1_7517_7849 | 110 |
| 137 | 3300059630 | Ga0587128_037996 | Ga0587128_037996_187_519 | 110 |
| 138 | 3300004803 | Ga0058862_11776041 | Ga0058862_117760411 | 111 |
| 139 | 3300005328 | Ga0070676_10000689 | Ga0070676_100006897 | 111 |
| 140 | 3300005330 | Ga0070690_100268539 | Ga0070690_1002685393 | 111 |
| 141 | 3300005333 | Ga0070677_10891181 | Ga0070677_108911811 | 111 |
| 142 | 3300005334 | Ga0068869_100005324 | Ga0068869_10000532412 | 111 |
| 143 | 3300005335 | Ga0070666_10056084 | Ga0070666_100560843 | 111 |
| 144 | 3300005339 | Ga0070660_100919514 | Ga0070660_1009195142 | 111 |
| 145 | 3300005341 | Ga0070691_10016149 | Ga0070691_100161492 | 111 |
| 146 | 3300005345 | Ga0070692_10249134 | Ga0070692_102491342 | 111 |
| 147 | 3300005347 | Ga0070668_100405644 | Ga0070668_1004056442 | 111 |
| 148 | 3300005354 | Ga0070675_100321699 | Ga0070675_1003216992 | 111 |
| 149 | 3300005355 | Ga0070671_100956414 | Ga0070671_1009564142 | 111 |
| 150 | 3300005356 | Ga0070674_100000437 | Ga0070674_10000043710 | 111 |
| 151 | 3300005438 | Ga0070701_11374875 | Ga0070701_113748751 | 111 |
| 152 | 3300005440 | Ga0070705_100008391 | Ga0070705_1000083917 | 111 |
| 153 | 3300005441 | Ga0070700_101130691 | Ga0070700_1011306911 | 111 |
| 154 | 3300005444 | Ga0070694_100192432 | Ga0070694_1001924323 | 111 |
| 155 | 3300005445 | Ga0070708_101233343 | Ga0070708_1012333431 | 111 |
| 156 | 3300005455 | Ga0070663_100033021 | Ga0070663_1000330212 | 111 |
| 157 | 3300005456 | Ga0070678_100013437 | Ga0070678_1000134371 | 111 |
| 158 | 3300005457 | Ga0070662_100001184 | Ga0070662_10000118415 | 111 |
| 159 | 3300005458 | Ga0070681_10790468 | Ga0070681_107904682 | 111 |
| 160 | 3300005459 | Ga0068867_100002643 | Ga0068867_1000026434 | 111 |
| 161 | 3300005530 | Ga0070679_101413215 | Ga0070679_1014132152 | 111 |
| 162 | 3300005539 | Ga0068853_100180754 | Ga0068853_1001807543 | 111 |
| 163 | 3300005543 | Ga0070672_100504633 | Ga0070672_1005046332 | 111 |
| 164 | 3300005544 | Ga0070686_100112691 | Ga0070686_1001126912 | 111 |
| 165 | 3300005545 | Ga0070695_100022448 | Ga0070695_1000224482 | 111 |
| 166 | 3300005546 | Ga0070696_100003093 | Ga0070696_10000309310 | 111 |
| 167 | 3300005547 | Ga0070693_100009180 | Ga0070693_1000091803 | 111 |
| 168 | 3300005549 | Ga0070704_100021934 | Ga0070704_1000219347 | 111 |
| 169 | 3300005563 | Ga0068855_100227642 | Ga0068855_1002276422 | 111 |
| 170 | 3300005577 | Ga0068857_100029068 | Ga0068857_1000290683 | 111 |
| 171 | 3300005578 | Ga0068854_100000862 | Ga0068854_10000086212 | 111 |
| 172 | 3300005614 | Ga0068856_102141134 | Ga0068856_1021411342 | 111 |
| 173 | 3300005615 | Ga0070702_100014670 | Ga0070702_1000146702 | 111 |
| 174 | 3300005616 | Ga0068852_100092629 | Ga0068852_1000926293 | 111 |
| 175 | 3300005617 | Ga0068859_100216805 | Ga0068859_1002168053 | 111 |
| 176 | 3300005618 | Ga0068864_100022287 | Ga0068864_1000222876 | 111 |
| 177 | 3300005718 | Ga0068866_10000042 | Ga0068866_1000004237 | 111 |
| 178 | 3300005840 | Ga0068870_10075252 | Ga0068870_100752523 | 111 |
| 179 | 3300005842 | Ga0068858_100051116 | Ga0068858_1000511162 | 111 |
| 180 | 3300006237 | Ga0097621_100058094 | Ga0097621_1000580943 | 111 |
| 181 | 3300006358 | Ga0068871_100269892 | Ga0068871_1002698923 | 111 |
| 182 | 3300006844 | Ga0075428_100061383 | Ga0075428_1000613834 | 111 |
| 183 | 3300006846 | Ga0075430_100011232 | Ga0075430_1000112325 | 111 |
| 184 | 3300006847 | Ga0075431_100016224 | Ga0075431_1000162244 | 111 |
| 185 | 3300006847 | Ga0075431_100126054 | Ga0075431_1001260544 | 111 |
| 186 | 3300006852 | Ga0075433_10072461 | Ga0075433_100724613 | 111 |
| 187 | 3300006871 | Ga0075434_100001882 | Ga0075434_1000018826 | 111 |
| 188 | 3300006880 | Ga0075429_100058921 | Ga0075429_1000589214 | 111 |
| 189 | 3300006881 | Ga0068865_100002446 | Ga0068865_1000024463 | 111 |
| 190 | 3300006931 | Ga0097620_100216813 | Ga0097620_1002168132 | 111 |
| 191 | 3300009093 | Ga0105240_10147722 | Ga0105240_101477222 | 111 |
| 192 | 3300009098 | Ga0105245_10024899 | Ga0105245_100248993 | 111 |
| 193 | 3300009148 | Ga0105243_10010025 | Ga0105243_100100252 | 111 |
| 194 | 3300009174 | Ga0105241_10116920 | Ga0105241_101169204 | 111 |
| 195 | 3300009176 | Ga0105242_10000472 | Ga0105242_1000047214 | 111 |
| 196 | 3300009177 | Ga0105248_10058552 | Ga0105248_100585524 | 111 |
| 197 | 3300009551 | Ga0105238_10429765 | Ga0105238_104297652 | 111 |
| 198 | 3300009553 | Ga0105249_10002206 | Ga0105249_100022067 | 111 |
| 199 | 3300010375 | Ga0105239_10022475 | Ga0105239_100224758 | 111 |
| 200 | 3300011119 | Ga0105246_10022881 | Ga0105246_100228816 | 111 |
| 201 | 3300013102 | Ga0157371_10110095 | Ga0157371_101100953 | 111 |
| 202 | 3300013297 | Ga0157378_10005549 | Ga0157378_100055493 | 111 |
| 203 | 3300013307 | Ga0157372_10049767 | Ga0157372_100497677 | 111 |
| 204 | 3300013308 | Ga0157375_10079347 | Ga0157375_100793472 | 111 |
| 205 | 3300013308 | Ga0157375_11476830 | Ga0157375_114768302 | 111 |
| 206 | 3300014968 | Ga0157379_10014099 | Ga0157379_100140992 | 111 |
| 207 | 3300025893 | Ga0207682_10602478 | Ga0207682_106024782 | 111 |
| 208 | 3300025899 | Ga0207642_10002227 | Ga0207642_100022274 | 111 |
| 209 | 3300025903 | Ga0207680_10004957 | Ga0207680_100049577 | 111 |
| 210 | 3300025907 | Ga0207645_10000983 | Ga0207645_1000098313 | 111 |
| 211 | 3300025911 | Ga0207654_10065431 | Ga0207654_100654314 | 111 |
| 212 | 3300025913 | Ga0207695_10154901 | Ga0207695_101549013 | 111 |
| 213 | 3300025923 | Ga0207681_10006362 | Ga0207681_100063627 | 111 |
| 214 | 3300025923 | Ga0207681_10179511 | Ga0207681_101795112 | 111 |
| 215 | 3300025924 | Ga0207694_10667063 | Ga0207694_106670632 | 111 |
| 216 | 3300025931 | Ga0207644_10792730 | Ga0207644_107927302 | 111 |
| 217 | 3300025933 | Ga0207706_10000177 | Ga0207706_1000017748 | 111 |
| 218 | 3300025934 | Ga0207686_10000606 | Ga0207686_1000060618 | 111 |
| 219 | 3300025935 | Ga0207709_10002923 | Ga0207709_1000292310 | 111 |
| 220 | 3300025937 | Ga0207669_10000859 | Ga0207669_1000085912 | 111 |
| 221 | 3300025938 | Ga0207704_10008011 | Ga0207704_100080117 | 111 |
| 222 | 3300025940 | Ga0207691_10160665 | Ga0207691_101606653 | 111 |
| 223 | 3300025941 | Ga0207711_10113607 | Ga0207711_101136074 | 111 |
| 224 | 3300025942 | Ga0207689_10010683 | Ga0207689_1001068310 | 111 |
| 225 | 3300025949 | Ga0207667_11082389 | Ga0207667_110823892 | 111 |
| 226 | 3300025961 | Ga0207712_10003207 | Ga0207712_100032076 | 111 |
| 227 | 3300025972 | Ga0207668_10129624 | Ga0207668_101296242 | 111 |
| 228 | 3300025981 | Ga0207640_10001452 | Ga0207640_100014527 | 111 |
| 229 | 3300025986 | Ga0207658_10089310 | Ga0207658_100893102 | 111 |
| 230 | 3300026023 | Ga0207677_11298121 | Ga0207677_112981211 | 111 |
| 231 | 3300026041 | Ga0207639_10079724 | Ga0207639_100797243 | 111 |
| 232 | 3300026067 | Ga0207678_10111789 | Ga0207678_101117893 | 111 |
| 233 | 3300026075 | Ga0207708_10034807 | Ga0207708_100348075 | 111 |
| 234 | 3300026078 | Ga0207702_10181222 | Ga0207702_101812222 | 111 |
| 235 | 3300026089 | Ga0207648_10000509 | Ga0207648_1000050915 | 111 |
| 236 | 3300026095 | Ga0207676_10010989 | Ga0207676_100109897 | 111 |
| 237 | 3300026116 | Ga0207674_10030283 | Ga0207674_100302833 | 111 |
| 238 | 3300026121 | Ga0207683_10061180 | Ga0207683_100611804 | 111 |
| 239 | 3300026142 | Ga0207698_10120020 | Ga0207698_101200202 | 111 |
| 240 | 3300028381 | Ga0268264_10006168 | Ga0268264_100061687 | 111 |
| 241 | 3300032002 | Ga0307416_100252921 | Ga0307416_1002529212 | 111 |
| 242 | 3300032005 | Ga0307411_10466197 | Ga0307411_104661972 | 111 |
| 243 | 3300035241 | Ga0373961_0122326 | Ga0373961_0122326_116_451 | 111 |
| 244 | 3300042876 | Ga0451577_0051078 | Ga0451577_0051078_2072_2407 | 111 |
| 245 | 3300044673 | Ga0453683_0568193 | Ga0453683_0568193_110_445 | 111 |
| 246 | 3300044712 | Ga0453684_0190347 | Ga0453684_0190347_798_1133 | 111 |
| 247 | 3300044901 | Ga0466960_0022324 | Ga0466960_0022324_746_1081 | 111 |
| 248 | 3300045051 | Ga0451576_0123606 | Ga0451576_0123606_2030_2365 | 111 |
| 249 | 3300046455 | Ga0495603_0050101 | Ga0495603_0050101_855_1190 | 111 |
| 250 | 3300046499 | Ga0495594_0091313 | Ga0495594_0091313_280_615 | 111 |
| 251 | 3300046557 | Ga0495622_0393434 | Ga0495622_0393434_225_560 | 111 |
| 252 | 3300047318 | Ga0495636_0030200 | Ga0495636_0030200_544_879 | 111 |
| 253 | 3300048904 | Ga0496101_0025057 | Ga0496101_0025057_2811_3152 | 111 |
| 254 | 3300048904 | Ga0496101_0235448 | Ga0496101_0235448_718_1053 | 111 |
| 255 | 3300048905 | Ga0496102_0412806 | Ga0496102_0412806_514_849 | 111 |
| 256 | 3300048909 | Ga0496106_0045619 | Ga0496106_0045619_460_795 | 111 |
| 257 | 3300048909 | Ga0496106_0827927 | Ga0496106_0827927_346_681 | 111 |
| 258 | 3300048910 | Ga0496107_0593174 | Ga0496107_0593174_43_378 | 111 |
| 259 | 3300048915 | Ga0496112_0068157 | Ga0496112_0068157_582_917 | 111 |
| 260 | 3300048916 | Ga0496113_0043812 | Ga0496113_0043812_252_587 | 111 |
| 261 | 3300048917 | Ga0496114_0011337 | Ga0496114_0011337_2886_3221 | 111 |
| 262 | 3300048917 | Ga0496114_0031155 | Ga0496114_0031155_895_1236 | 111 |
| 263 | 3300050507 | nmdc:mga05p37_3567_c1 | nmdc:mga05p37_3567_c1_15645_15980 | 111 |
| 264 | 3300050510 | nmdc:mga06r32_57392_c1 | nmdc:mga06r32_57392_c1_3162_3497 | 111 |
| 265 | 3300050512 | nmdc:mga0n895_64843_c1 | nmdc:mga0n895_64843_c1_1199_1534 | 111 |
| 266 | 3300050515 | nmdc:mga0a205_104613_c1 | nmdc:mga0a205_104613_c1_554_889 | 111 |
| 267 | 3300059644 | Ga0587075_028041 | Ga0587075_028041_473_808 | 111 |
| 268 | 3300005293 | Ga0065715_10863454 | Ga0065715_108634541 | 112 |
| 269 | 3300005336 | Ga0070680_100020954 | Ga0070680_1000209543 | 112 |
| 270 | 3300005366 | Ga0070659_101608070 | Ga0070659_1016080701 | 112 |
| 271 | 3300005445 | Ga0070708_100002723 | Ga0070708_1000027236 | 112 |
| 272 | 3300005445 | Ga0070708_100167838 | Ga0070708_1001678382 | 112 |
| 273 | 3300005458 | Ga0070681_10030120 | Ga0070681_100301205 | 112 |
| 274 | 3300005468 | Ga0070707_100006439 | Ga0070707_1000064397 | 112 |
| 275 | 3300005518 | Ga0070699_100013167 | Ga0070699_1000131671 | 112 |
| 276 | 3300005530 | Ga0070679_100128767 | Ga0070679_1001287673 | 112 |
| 277 | 3300005530 | Ga0070679_100413384 | Ga0070679_1004133842 | 112 |
| 278 | 3300005536 | Ga0070697_100198670 | Ga0070697_1001986702 | 112 |
| 279 | 3300005536 | Ga0070697_100361879 | Ga0070697_1003618792 | 112 |
| 280 | 3300005545 | Ga0070695_101488842 | Ga0070695_1014888421 | 112 |
| 281 | 3300005546 | Ga0070696_100192126 | Ga0070696_1001921262 | 112 |
| 282 | 3300005546 | Ga0070696_100486995 | Ga0070696_1004869952 | 112 |
| 283 | 3300006163 | Ga0070715_10110857 | Ga0070715_101108572 | 112 |
| 284 | 3300006844 | Ga0075428_100779982 | Ga0075428_1007799822 | 112 |
| 285 | 3300006846 | Ga0075430_100577768 | Ga0075430_1005777682 | 112 |
| 286 | 3300006871 | Ga0075434_100407861 | Ga0075434_1004078612 | 112 |
| 287 | 3300006871 | Ga0075434_100433145 | Ga0075434_1004331452 | 112 |
| 288 | 3300006914 | Ga0075436_100010878 | Ga0075436_1000108785 | 112 |
| 289 | 3300025905 | Ga0207685_10021741 | Ga0207685_100217412 | 112 |
| 290 | 3300025912 | Ga0207707_10001053 | Ga0207707_1000105317 | 112 |
| 291 | 3300025912 | Ga0207707_11201419 | Ga0207707_112014192 | 112 |
| 292 | 3300025917 | Ga0207660_10045050 | Ga0207660_100450503 | 112 |
| 293 | 3300025921 | Ga0207652_10079391 | Ga0207652_100793914 | 112 |
| 294 | 3300025921 | Ga0207652_10367384 | Ga0207652_103673842 | 112 |
| 295 | 3300025922 | Ga0207646_10043600 | Ga0207646_100436006 | 112 |
| 296 | 3300026067 | Ga0207678_10016773 | Ga0207678_100167734 | 112 |
| 297 | 3300027462 | Ga0210000_1035545 | Ga0210000_10355452 | 112 |
| 298 | 3300027552 | Ga0209982_1026442 | Ga0209982_10264422 | 112 |
| 299 | 3300027876 | Ga0209974_10023602 | Ga0209974_100236024 | 112 |
| 300 | 3300031548 | Ga0307408_100068870 | Ga0307408_1000688703 | 112 |
| 301 | 3300031548 | Ga0307408_101085817 | Ga0307408_1010858172 | 112 |
| 302 | 3300031731 | Ga0307405_10021728 | Ga0307405_100217283 | 112 |
| 303 | 3300031731 | Ga0307405_10632381 | Ga0307405_106323812 | 112 |
| 304 | 3300031824 | Ga0307413_11309505 | Ga0307413_113095051 | 112 |
| 305 | 3300031901 | Ga0307406_10097498 | Ga0307406_100974982 | 112 |
| 306 | 3300031995 | Ga0307409_101774560 | Ga0307409_1017745602 | 112 |
| 307 | 3300031995 | Ga0307409_101999019 | Ga0307409_1019990191 | 112 |
| 308 | 3300032002 | Ga0307416_100075255 | Ga0307416_1000752553 | 112 |
| 309 | 3300032005 | Ga0307411_10431181 | Ga0307411_104311812 | 112 |
| 310 | 3300032005 | Ga0307411_10670659 | Ga0307411_106706591 | 112 |
| 311 | 3300042130 | Ga0450892_016211 | Ga0450892_016211_53_391 | 112 |
| 312 | 3300042435 | Ga0439434_0309648 | Ga0439434_0309648_165_503 | 112 |
| 313 | 3300042876 | Ga0451577_0682279 | Ga0451577_0682279_402_740 | 112 |
| 314 | 3300044673 | Ga0453683_0190170 | Ga0453683_0190170_767_1105 | 112 |
| 315 | 3300048905 | Ga0496102_0117164 | Ga0496102_0117164_1999_2337 | 112 |
| 316 | 3300048907 | Ga0496104_0640605 | Ga0496104_0640605_405_743 | 112 |
| 317 | 3300049572 | Ga0501036_0388272 | Ga0501036_0388272_416_754 | 112 |
| 318 | 3300049576 | Ga0501040_0662889 | Ga0501040_0662889_180_518 | 112 |
| 319 | 3300049576 | Ga0501040_0834323 | Ga0501040_0834323_245_583 | 112 |
| 320 | 3300049580 | Ga0501046_0837049 | Ga0501046_0837049_130_468 | 112 |
| 321 | 3300049582 | Ga0501048_0236198 | Ga0501048_0236198_80_418 | 112 |
| 322 | 3300049583 | Ga0501067_0403519 | Ga0501067_0403519_185_523 | 112 |
| 323 | 3300049584 | Ga0501068_0124496 | Ga0501068_0124496_171_509 | 112 |
| 324 | 3300049584 | Ga0501068_0843860 | Ga0501068_0843860_37_375 | 112 |
| 325 | 3300049585 | Ga0501069_0045851 | Ga0501069_0045851_1441_1779 | 112 |
| 326 | 3300049590 | Ga0501074_0257545 | Ga0501074_0257545_278_616 | 112 |
| 327 | 3300049591 | Ga0501075_1158371 | Ga0501075_1158371_92_430 | 112 |
| 328 | 3300049592 | Ga0501076_1278680 | Ga0501076_1278680_96_434 | 112 |
| 329 | 3300049593 | Ga0501077_0292830 | Ga0501077_0292830_434_772 | 112 |
| 330 | 3300049741 | Ga0501079_1063015 | Ga0501079_1063015_260_598 | 112 |
| 331 | 3300049743 | Ga0501081_0295562 | Ga0501081_0295562_838_1176 | 112 |
| 332 | 3300049743 | Ga0501081_1003167 | Ga0501081_1003167_118_456 | 112 |
| 333 | 3300049759 | Ga0501262_061761 | Ga0501262_061761_229_567 | 112 |
| 334 | 3300049822 | Ga0501035_0785473 | Ga0501035_0785473_70_408 | 112 |
| 335 | 3300049824 | Ga0501045_0557302 | Ga0501045_0557302_183_521 | 112 |
| 336 | 3300050508 | nmdc:mga09592_787868_c1 | nmdc:mga09592_787868_c1_320_658 | 112 |
| 337 | 3300050509 | nmdc:mga0qj67_62133_c1 | nmdc:mga0qj67_62133_c1_1707_2057 | 112 |
| 338 | 3300050510 | nmdc:mga06r32_2946_c1 | nmdc:mga06r32_2946_c1_13862_14212 | 112 |
| 339 | 3300050512 | nmdc:mga0n895_452121_c1 | nmdc:mga0n895_452121_c1_567_905 | 112 |
| 340 | 3300050514 | nmdc:mga08x19_420790_c1 | nmdc:mga08x19_420790_c1_590_928 | 112 |
| 341 | 3300005330 | Ga0070690_100965893 | Ga0070690_1009658931 | 113 |
| 342 | 3300005336 | Ga0070680_101028649 | Ga0070680_1010286492 | 113 |
| 343 | 3300005337 | Ga0070682_100254066 | Ga0070682_1002540662 | 113 |
| 344 | 3300005341 | Ga0070691_10506471 | Ga0070691_105064711 | 113 |
| 345 | 3300005366 | Ga0070659_101077493 | Ga0070659_1010774932 | 113 |
| 346 | 3300005440 | Ga0070705_100163741 | Ga0070705_1001637412 | 113 |
| 347 | 3300005445 | Ga0070708_102016726 | Ga0070708_1020167261 | 113 |
| 348 | 3300005455 | Ga0070663_100280431 | Ga0070663_1002804312 | 113 |
| 349 | 3300005456 | Ga0070678_100857623 | Ga0070678_1008576232 | 113 |
| 350 | 3300005458 | Ga0070681_10224415 | Ga0070681_102244152 | 113 |
| 351 | 3300005530 | Ga0070679_100411145 | Ga0070679_1004111452 | 113 |
| 352 | 3300005539 | Ga0068853_100247780 | Ga0068853_1002477802 | 113 |
| 353 | 3300005546 | Ga0070696_100076537 | Ga0070696_1000765373 | 113 |
| 354 | 3300005547 | Ga0070693_101611325 | Ga0070693_1016113251 | 113 |
| 355 | 3300005578 | Ga0068854_100222897 | Ga0068854_1002228974 | 113 |
| 356 | 3300005615 | Ga0070702_100148108 | Ga0070702_1001481083 | 113 |
| 357 | 3300005615 | Ga0070702_101208883 | Ga0070702_1012088832 | 113 |
| 358 | 3300005616 | Ga0068852_101243505 | Ga0068852_1012435051 | 113 |
| 359 | 3300005617 | Ga0068859_101339601 | Ga0068859_1013396012 | 113 |
| 360 | 3300005718 | Ga0068866_10282113 | Ga0068866_102821132 | 113 |
| 361 | 3300006852 | Ga0075433_11000036 | Ga0075433_110000362 | 113 |
| 362 | 3300006931 | Ga0097620_101339044 | Ga0097620_1013390442 | 113 |
| 363 | 3300009176 | Ga0105242_12168473 | Ga0105242_121684731 | 113 |
| 364 | 3300025899 | Ga0207642_10216600 | Ga0207642_102166002 | 113 |
| 365 | 3300025912 | Ga0207707_10172657 | Ga0207707_101726574 | 113 |
| 366 | 3300025917 | Ga0207660_10378650 | Ga0207660_103786502 | 113 |
| 367 | 3300025919 | Ga0207657_10810063 | Ga0207657_108100632 | 113 |
| 368 | 3300025924 | Ga0207694_11423879 | Ga0207694_114238791 | 113 |
| 369 | 3300025932 | Ga0207690_10756050 | Ga0207690_107560502 | 113 |
| 370 | 3300025934 | Ga0207686_10979786 | Ga0207686_109797861 | 113 |
| 371 | 3300025944 | Ga0207661_10383371 | Ga0207661_103833712 | 113 |
| 372 | 3300026041 | Ga0207639_10956457 | Ga0207639_109564572 | 113 |
| 373 | 3300026075 | Ga0207708_10125851 | Ga0207708_101258514 | 113 |
| 374 | 3300026089 | Ga0207648_10299382 | Ga0207648_102993822 | 113 |
| 375 | 3300026121 | Ga0207683_10862815 | Ga0207683_108628152 | 113 |
| 376 | 3300026142 | Ga0207698_10487671 | Ga0207698_104876712 | 113 |
| 377 | 3300027876 | Ga0209974_10020070 | Ga0209974_100200703 | 113 |
| 378 | 3300027907 | Ga0207428_10599411 | Ga0207428_105994112 | 113 |
| 379 | 3300031548 | Ga0307408_100013303 | Ga0307408_1000133032 | 113 |
| 380 | 3300031731 | Ga0307405_10096267 | Ga0307405_100962672 | 113 |
| 381 | 3300031824 | Ga0307413_10003475 | Ga0307413_100034754 | 113 |
| 382 | 3300031824 | Ga0307413_10141251 | Ga0307413_101412513 | 113 |
| 383 | 3300031852 | Ga0307410_10000197 | Ga0307410_100001977 | 113 |
| 384 | 3300031852 | Ga0307410_10352108 | Ga0307410_103521082 | 113 |
| 385 | 3300031852 | Ga0307410_10512543 | Ga0307410_105125431 | 113 |
| 386 | 3300031901 | Ga0307406_10055365 | Ga0307406_100553652 | 113 |
| 387 | 3300031903 | Ga0307407_10004864 | Ga0307407_100048646 | 113 |
| 388 | 3300031903 | Ga0307407_10213586 | Ga0307407_102135861 | 113 |
| 389 | 3300031911 | Ga0307412_10088651 | Ga0307412_100886513 | 113 |
| 390 | 3300031911 | Ga0307412_10763125 | Ga0307412_107631251 | 113 |
| 391 | 3300031995 | Ga0307409_100000684 | Ga0307409_1000006841 | 113 |
| 392 | 3300031995 | Ga0307409_100031266 | Ga0307409_1000312663 | 113 |
| 393 | 3300031995 | Ga0307409_100585256 | Ga0307409_1005852562 | 113 |
| 394 | 3300032002 | Ga0307416_100000627 | Ga0307416_10000062716 | 113 |
| 395 | 3300032002 | Ga0307416_100009337 | Ga0307416_1000093375 | 113 |
| 396 | 3300032002 | Ga0307416_101998468 | Ga0307416_1019984681 | 113 |
| 397 | 3300032004 | Ga0307414_10012618 | Ga0307414_100126185 | 113 |
| 398 | 3300032004 | Ga0307414_10087816 | Ga0307414_100878163 | 113 |
| 399 | 3300032005 | Ga0307411_10001169 | Ga0307411_100011697 | 113 |
| 400 | 3300032005 | Ga0307411_10010744 | Ga0307411_100107442 | 113 |
| 401 | 3300032126 | Ga0307415_100000340 | Ga0307415_1000003402 | 113 |
| 402 | 3300032126 | Ga0307415_100034728 | Ga0307415_1000347283 | 113 |
| 403 | 3300032126 | Ga0307415_100133662 | Ga0307415_1001336623 | 113 |
| 404 | 3300034818 | Ga0373950_0027011 | Ga0373950_0027011_123_464 | 113 |
| 405 | 3300035115 | Ga0373941_0056510 | Ga0373941_0056510_583_924 | 113 |
| 406 | 3300035242 | Ga0373962_0101828 | Ga0373962_0101828_134_475 | 113 |
| 407 | 3300035691 | Ga0373931_0067652 | Ga0373931_0067652_1527_1868 | 113 |
| 408 | 3300037418 | Ga0395900_1544106 | Ga0395900_1544106_88_429 | 113 |
| 409 | 3300038443 | Ga0395901_1436537 | Ga0395901_1436537_98_439 | 113 |
| 410 | 3300038698 | Ga0242419_007322 | Ga0242419_007322_337_678 | 113 |
| 411 | 3300038996 | Ga0242420_007453 | Ga0242420_007453_324_665 | 113 |
| 412 | 3300042438 | Ga0439459_0061961 | Ga0439459_0061961_158_499 | 113 |
| 413 | 3300048912 | Ga0496109_0011909 | Ga0496109_0011909_1983_2324 | 113 |
| 414 | 3300048914 | Ga0496111_0005561 | Ga0496111_0005561_199_540 | 113 |
| 415 | 3300048915 | Ga0496112_0012360 | Ga0496112_0012360_5510_5851 | 113 |
| 416 | 3300048916 | Ga0496113_0000810 | Ga0496113_0000810_8020_8361 | 113 |
| 417 | 3300049514 | Ga0501291_040718 | Ga0501291_040718_208_549 | 113 |
| 418 | 3300049515 | Ga0501292_118445 | Ga0501292_118445_44_385 | 113 |
| 419 | 3300049520 | Ga0501297_012395 | Ga0501297_012395_114_455 | 113 |
| 420 | 3300049521 | Ga0501298_002931 | Ga0501298_002931_2056_2397 | 113 |
| 421 | 3300049522 | Ga0501299_060001 | Ga0501299_060001_345_686 | 113 |
| 422 | 3300049583 | Ga0501067_0008708 | Ga0501067_0008708_181_522 | 113 |
| 423 | 3300049585 | Ga0501069_0066741 | Ga0501069_0066741_299_640 | 113 |
| 424 | 3300049585 | Ga0501069_0310492 | Ga0501069_0310492_394_735 | 113 |
| 425 | 3300049655 | Ga0501208_133004 | Ga0501208_133004_39_380 | 113 |
| 426 | 3300049656 | Ga0501209_000383 | Ga0501209_000383_2803_3144 | 113 |
| 427 | 3300049658 | Ga0501211_017640 | Ga0501211_017640_324_665 | 113 |
| 428 | 3300049659 | Ga0501214_000874 | Ga0501214_000874_960_1301 | 113 |
| 429 | 3300049661 | Ga0501217_005169 | Ga0501217_005169_1428_1769 | 113 |
| 430 | 3300049663 | Ga0501223_027155 | Ga0501223_027155_495_836 | 113 |
| 431 | 3300049666 | Ga0501228_042510 | Ga0501228_042510_169_510 | 113 |
| 432 | 3300049667 | Ga0501230_086422 | Ga0501230_086422_70_411 | 113 |
| 433 | 3300049669 | Ga0501235_009347 | Ga0501235_009347_1338_1679 | 113 |
| 434 | 3300049672 | Ga0501239_009460 | Ga0501239_009460_529_870 | 113 |
| 435 | 3300049675 | Ga0501243_042956 | Ga0501243_042956_27_368 | 113 |
| 436 | 3300049677 | Ga0501247_000081 | Ga0501247_000081_3596_3937 | 113 |
| 437 | 3300049678 | Ga0501248_004469 | Ga0501248_004469_681_1022 | 113 |
| 438 | 3300049679 | Ga0501249_003437 | Ga0501249_003437_141_482 | 113 |
| 439 | 3300049679 | Ga0501249_037825 | Ga0501249_037825_672_1013 | 113 |
| 440 | 3300049687 | Ga0501258_015632 | Ga0501258_015632_286_627 | 113 |
| 441 | 3300049688 | Ga0501259_021258 | Ga0501259_021258_192_533 | 113 |
| 442 | 3300049704 | Ga0501221_001100 | Ga0501221_001100_1290_1631 | 113 |
| 443 | 3300049705 | Ga0501225_0003693 | Ga0501225_0003693_3560_3901 | 113 |
| 444 | 3300049706 | Ga0501229_026575 | Ga0501229_026575_308_649 | 113 |
| 445 | 3300049708 | Ga0501245_008780 | Ga0501245_008780_598_939 | 113 |
| 446 | 3300049757 | Ga0501232_025288 | Ga0501232_025288_218_559 | 113 |
| 447 | 3300049760 | Ga0501263_000924 | Ga0501263_000924_859_1200 | 113 |
| 448 | 3300049765 | Ga0501268_000867 | Ga0501268_000867_810_1151 | 113 |
| 449 | 3300049779 | Ga0501283_004070 | Ga0501283_004070_482_823 | 113 |
| 450 | 3300049850 | Ga0501204_003629 | Ga0501204_003629_538_879 | 113 |
| 451 | 3300050514 | nmdc:mga08x19_27931_c1 | nmdc:mga08x19_27931_c1_2693_3034 | 113 |
| 452 | 3300053078 | Ga0495612_0360793 | Ga0495612_0360793_231_572 | 113 |
| 453 | 3300061734 | Ga0530510_0512143 | Ga0530510_0512143_308_649 | 113 |
| 454 | 3300005518 | Ga0070699_100711297 | Ga0070699_1007112972 | 114 |
| 455 | 3300009098 | Ga0105245_10606438 | Ga0105245_106064382 | 115 |
| 456 | 3300009147 | Ga0114129_10000461 | Ga0114129_1000046149 | 115 |
| 457 | 3300009148 | Ga0105243_10752969 | Ga0105243_107529692 | 115 |
| 458 | 3300009176 | Ga0105242_10147117 | Ga0105242_101471172 | 115 |
| 459 | 3300009553 | Ga0105249_10659365 | Ga0105249_106593652 | 115 |
| 460 | 3300010375 | Ga0105239_12466405 | Ga0105239_124664052 | 115 |
| 461 | 3300013306 | Ga0163162_11601925 | Ga0163162_116019251 | 115 |
| 462 | 3300013307 | Ga0157372_11062168 | Ga0157372_110621681 | 115 |
| 463 | 3300013308 | Ga0157375_12980559 | Ga0157375_129805591 | 115 |
| 464 | 3300014326 | Ga0157380_12880517 | Ga0157380_128805171 | 115 |
| 465 | 3300042012 | Ga0439455_0014514 | Ga0439455_0014514_911_1258 | 115 |
| 466 | 3300044842 | Ga0466957_0389253 | Ga0466957_0389253_96_443 | 115 |
| 467 | 3300045976 | Ga0466967_1788657 | Ga0466967_1788657_139_486 | 115 |
| 468 | 3300048906 | Ga0496103_0407032 | Ga0496103_0407032_420_767 | 115 |
| 469 | 3300048909 | Ga0496106_0602440 | Ga0496106_0602440_258_605 | 115 |
| 470 | 3300049576 | Ga0501040_1122703 | Ga0501040_1122703_112_459 | 115 |
| 471 | 3300049677 | Ga0501247_045081 | Ga0501247_045081_129_476 | 115 |
| 472 | 3300049679 | Ga0501249_150460 | Ga0501249_150460_154_501 | 115 |
| 473 | 3300049683 | Ga0501253_022437 | Ga0501253_022437_528_875 | 115 |
| 474 | 3300049707 | Ga0501234_043044 | Ga0501234_043044_45_392 | 115 |
| 475 | 3300049741 | Ga0501079_0010843 | Ga0501079_0010843_1504_1851 | 115 |
| 476 | 3300049743 | Ga0501081_0123833 | Ga0501081_0123833_155_502 | 115 |
| 477 | 3300049744 | Ga0501083_0766148 | Ga0501083_0766148_207_554 | 115 |
| 478 | 3300049773 | Ga0501276_008999 | Ga0501276_008999_274_621 | 115 |
| 479 | 3300049779 | Ga0501283_028885 | Ga0501283_028885_222_569 | 115 |
| 480 | 3300049850 | Ga0501204_073623 | Ga0501204_073623_164_511 | 115 |
| 481 | 3300060353 | Ga0501082_0182200 | Ga0501082_0182200_1193_1540 | 115 |
| 482 | 2162886012 | MBSR1b_contig_4742051 | MBSR1b_0402.00006470 | 116 |
| 483 | 3300005293 | Ga0065715_10010100 | Ga0065715_100101003 | 116 |
| 484 | 3300005293 | Ga0065715_10255232 | Ga0065715_102552322 | 116 |
| 485 | 3300005330 | Ga0070690_100034372 | Ga0070690_1000343722 | 116 |
| 486 | 3300005347 | Ga0070668_101064042 | Ga0070668_1010640421 | 116 |
| 487 | 3300005366 | Ga0070659_101069219 | Ga0070659_1010692192 | 116 |
| 488 | 3300005440 | Ga0070705_100108939 | Ga0070705_1001089391 | 116 |
| 489 | 3300005444 | Ga0070694_100133889 | Ga0070694_1001338893 | 116 |
| 490 | 3300005457 | Ga0070662_100489014 | Ga0070662_1004890141 | 116 |
| 491 | 3300005536 | Ga0070697_101594364 | Ga0070697_1015943642 | 116 |
| 492 | 3300005545 | Ga0070695_100053517 | Ga0070695_1000535171 | 116 |
| 493 | 3300005549 | Ga0070704_100006869 | Ga0070704_1000068694 | 116 |
| 494 | 3300005615 | Ga0070702_100090661 | Ga0070702_1000906612 | 116 |
| 495 | 3300005617 | Ga0068859_100049602 | Ga0068859_1000496024 | 116 |
| 496 | 3300005618 | Ga0068864_101356884 | Ga0068864_1013568842 | 116 |
| 497 | 3300005718 | Ga0068866_10739080 | Ga0068866_107390802 | 116 |
| 498 | 3300005719 | Ga0068861_100594797 | Ga0068861_1005947972 | 116 |
| 499 | 3300006852 | Ga0075433_10694274 | Ga0075433_106942742 | 116 |
| 500 | 3300006881 | Ga0068865_100395853 | Ga0068865_1003958533 | 116 |
| 501 | 3300006931 | Ga0097620_100049602 | Ga0097620_1000496024 | 116 |
| 502 | 3300007076 | Ga0075435_100437488 | Ga0075435_1004374882 | 116 |
| 503 | 3300009147 | Ga0114129_10469381 | Ga0114129_104693812 | 116 |
| 504 | 3300009147 | Ga0114129_10651154 | Ga0114129_106511542 | 116 |
| 505 | 3300010375 | Ga0105239_10023621 | Ga0105239_100236214 | 116 |
| 506 | 3300013306 | Ga0163162_10701581 | Ga0163162_107015812 | 116 |
| 507 | 3300025933 | Ga0207706_10670251 | Ga0207706_106702512 | 116 |
| 508 | 3300025938 | Ga0207704_10204866 | Ga0207704_102048662 | 116 |
| 509 | 3300026089 | Ga0207648_10307842 | Ga0207648_103078422 | 116 |
| 510 | 3300026118 | Ga0207675_100616750 | Ga0207675_1006167502 | 116 |
| 511 | 3300035691 | Ga0373931_0028128 | Ga0373931_0028128_683_1033 | 116 |
| 512 | 3300048903 | Ga0496100_0190307 | Ga0496100_0190307_710_1060 | 116 |
| 513 | 3300048904 | Ga0496101_0053904 | Ga0496101_0053904_2375_2725 | 116 |
| 514 | 3300048905 | Ga0496102_0001806 | Ga0496102_0001806_5923_6273 | 116 |
| 515 | 3300048906 | Ga0496103_0053656 | Ga0496103_0053656_12_362 | 116 |
| 516 | 3300048906 | Ga0496103_0310355 | Ga0496103_0310355_539_892 | 116 |
| 517 | 3300048907 | Ga0496104_0489960 | Ga0496104_0489960_618_968 | 116 |
| 518 | 3300048908 | Ga0496105_0048571 | Ga0496105_0048571_1850_2200 | 116 |
| 519 | 3300048909 | Ga0496106_0012688 | Ga0496106_0012688_5781_6131 | 116 |
| 520 | 3300048910 | Ga0496107_0115294 | Ga0496107_0115294_466_816 | 116 |
| 521 | 3300048911 | Ga0496108_0002308 | Ga0496108_0002308_2458_2808 | 116 |
| 522 | 3300048912 | Ga0496109_0000573 | Ga0496109_0000573_8954_9304 | 116 |
| 523 | 3300048913 | Ga0496110_0000669 | Ga0496110_0000669_15432_15782 | 116 |
| 524 | 3300048914 | Ga0496111_0022841 | Ga0496111_0022841_2072_2422 | 116 |
| 525 | 3300048915 | Ga0496112_0022236 | Ga0496112_0022236_636_986 | 116 |
| 526 | 3300048916 | Ga0496113_0002211 | Ga0496113_0002211_5064_5414 | 116 |
| 527 | 3300048918 | Ga0496115_0293709 | Ga0496115_0293709_19_369 | 116 |
| 528 | 3300050507 | nmdc:mga05p37_1864981_c1 | nmdc:mga05p37_1864981_c1_19_372 | 116 |
| 529 | 3300050507 | nmdc:mga05p37_373312_c1 | nmdc:mga05p37_373312_c1_858_1208 | 116 |
| 530 | 3300050514 | nmdc:mga08x19_237539_c1 | nmdc:mga08x19_237539_c1_208_558 | 116 |
| 531 | 3300050515 | nmdc:mga0a205_86862_c2 | nmdc:mga0a205_86862_c2_235_585 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8h-assembly1.cif.gz_B | crystal structure of tt0351 protein from thermus thermophilus hb8 | 0.9203 | 12 | 111 |
| 2oxh-assembly1.cif.gz_Z | the soxyz complex of paracoccus pantotrophus | 0.9161 | 8 | 112 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.9095 | 10 | 114 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8925 | 8 | 112 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8925 | 10 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9203 | 12 | 111 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9095 | 10 | 114 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8925 | 10 | 114 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8552 | 12 | 111 | 2.60.40.10 |
| af_Q58151_5_116_2.60.40.730 | Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain | 0.8403 | 9 | 114 | 2.60.40.730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7QCP3-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.975 | 8 | 115 |
|
| AF-A0A259CJK6-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9635 | 11 | 115 |
|
| AF-A0A838NK01-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9624 | 29 | 116 |
|
| AF-A0A1G1H6Y1-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9603 | 11 | 114 |
|
| AF-A0A315CUF7-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9589 | 12 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar