F460193

General Info

Members Datasets Scaffolds Average Seq Length
531 281 531 112

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_1122703|Ga0501040_1122703_112_459
Length 115
Sequence MRLTMLETGKTRIVLPERIQRGDVVRVQIVVQHPMDTGFFRDANANIIPAWFISDVRVLLNGGEIARFEWTSGISRDPMVAFRLKAETEGTLTVVSKDNRGSEFRGSAEIKFATT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
167 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
221 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
236 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
237 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
238 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
239 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
242 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
243 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
244 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
245 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
246 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
247 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
250 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
251 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
254 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
255 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
256 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
261 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
262 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
263 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
264 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
265 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.17
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4742051 2162886012 Bacteria 1983
2 Ga0058862_11776041 3300004803 Unclassified 594
3 Ga0065715_10010100 3300005293 Unclassified 3582
4 Ga0065715_10255232 3300005293 Bacteria 1154
5 Ga0065715_10863454 3300005293 Unclassified 577
6 Ga0070676_10000689 3300005328 Bacteria 16580
7 Ga0070683_100311457 3300005329 Unclassified 1498
8 Ga0070690_100034372 3300005330 Unclassified 3177
9 Ga0070690_100268539 3300005330 Bacteria 1213
10 Ga0070690_100965893 3300005330 Unclassified 670
11 Ga0070670_101144989 3300005331 Bacteria 710
12 Ga0070677_10891181 3300005333 Unclassified 513
13 Ga0068869_100005324 3300005334 Bacteria 8087
14 Ga0070666_10056084 3300005335 Bacteria 2660
15 Ga0070680_100020954 3300005336 Bacteria 5191
16 Ga0070680_101028649 3300005336 Unclassified 712
17 Ga0070682_100254066 3300005337 Bacteria 1269
18 Ga0070660_100919514 3300005339 Unclassified 738
19 Ga0070691_10016149 3300005341 Bacteria 3431
20 Ga0070691_10506471 3300005341 Bacteria 699
21 Ga0070692_10249134 3300005345 Bacteria 1062
22 Ga0070668_100405644 3300005347 Bacteria 1164
23 Ga0070668_101064042 3300005347 Unclassified 729
24 Ga0070668_101921552 3300005347 Bacteria 545
25 Ga0070669_100121329 3300005353 Bacteria 1994
26 Ga0070675_100321699 3300005354 Bacteria 1366
27 Ga0070671_100956414 3300005355 Unclassified 749
28 Ga0070674_100000437 3300005356 Bacteria 21014
29 Ga0070659_101030725 3300005366 Archaea 723
30 Ga0070659_101069219 3300005366 Bacteria 710
31 Ga0070659_101077493 3300005366 Unclassified 708
32 Ga0070659_101608070 3300005366 Unclassified 580
33 Ga0070709_10633794 3300005434 Unclassified 826
34 Ga0070713_100434924 3300005436 Unclassified 1230
35 Ga0070713_102315657 3300005436 Unclassified 520
36 Ga0070701_11374875 3300005438 Unclassified 507
37 Ga0070705_100008391 3300005440 Bacteria 5117
38 Ga0070705_100108939 3300005440 Bacteria 1765
39 Ga0070705_100163741 3300005440 Bacteria 1490
40 Ga0070700_101130691 3300005441 Unclassified 651
41 Ga0070694_100133889 3300005444 Unclassified 1794
42 Ga0070694_100192432 3300005444 Bacteria 1515
43 Ga0070694_100251359 3300005444 Bacteria 1337
44 Ga0070708_100002723 3300005445 Bacteria 13718
45 Ga0070708_100061914 3300005445 Bacteria 3345
46 Ga0070708_100167838 3300005445 Bacteria 2048
47 Ga0070708_101233343 3300005445 Unclassified 699
48 Ga0070708_102016726 3300005445 Bacteria 534
49 Ga0070663_100033021 3300005455 Bacteria 3572
50 Ga0070663_100280431 3300005455 Unclassified 1328
51 Ga0070678_100013437 3300005456 Bacteria 5134
52 Ga0070678_100857623 3300005456 Unclassified 828
53 Ga0070662_100001184 3300005457 Bacteria 15989
54 Ga0070662_100489014 3300005457 Bacteria 1025
55 Ga0070681_10030120 3300005458 Bacteria 5445
56 Ga0070681_10221528 3300005458 Bacteria 1807
57 Ga0070681_10224415 3300005458 Bacteria 1794
58 Ga0070681_10790468 3300005458 Bacteria 866
59 Ga0068867_100002643 3300005459 Bacteria 12638
60 Ga0070707_100006439 3300005468 Bacteria 10915
61 Ga0070707_100259106 3300005468 Bacteria 1692
62 Ga0070707_100627139 3300005468 Unclassified 1038
63 Ga0070699_100013167 3300005518 Bacteria 7132
64 Ga0070699_100711297 3300005518 Unclassified 918
65 Ga0070699_100950409 3300005518 Unclassified 788
66 Ga0070679_100128767 3300005530 Unclassified 2512
67 Ga0070679_100411145 3300005530 Bacteria 1299
68 Ga0070679_100413384 3300005530 Unclassified 1294
69 Ga0070679_101133272 3300005530 Bacteria 727
70 Ga0070679_101413215 3300005530 Unclassified 642
71 Ga0070697_100198670 3300005536 Bacteria 1704
72 Ga0070697_100361879 3300005536 Bacteria 1254
73 Ga0070697_100594661 3300005536 Unclassified 972
74 Ga0070697_101594364 3300005536 Unclassified 584
75 Ga0068853_100180754 3300005539 Unclassified 1913
76 Ga0068853_100247780 3300005539 Bacteria 1634
77 Ga0070672_100504633 3300005543 Bacteria 1047
78 Ga0070686_100112691 3300005544 Bacteria 1855
79 Ga0070695_100022448 3300005545 Bacteria 3870
80 Ga0070695_100053517 3300005545 Unclassified 2596
81 Ga0070695_101488842 3300005545 Unclassified 563
82 Ga0070696_100003093 3300005546 Bacteria 11069
83 Ga0070696_100076537 3300005546 Bacteria 2363
84 Ga0070696_100192126 3300005546 Bacteria 1520
85 Ga0070696_100486995 3300005546 Unclassified 979
86 Ga0070693_100009180 3300005547 Unclassified 4912
87 Ga0070693_101007807 3300005547 Unclassified 630
88 Ga0070693_101611325 3300005547 Unclassified 510
89 Ga0070704_100006869 3300005549 Bacteria 6740
90 Ga0070704_100021934 3300005549 Bacteria 4148
91 Ga0070704_100658280 3300005549 Unclassified 925
92 Ga0068855_100227642 3300005563 Unclassified 2089
93 Ga0068857_100029068 3300005577 Bacteria 4877
94 Ga0068854_100000862 3300005578 Bacteria 18171
95 Ga0068854_100222897 3300005578 Bacteria 1493
96 Ga0068856_102141134 3300005614 Unclassified 569
97 Ga0070702_100014670 3300005615 Bacteria 3980
98 Ga0070702_100090661 3300005615 Bacteria 1853
99 Ga0070702_100148108 3300005615 Bacteria 1503
100 Ga0070702_101208883 3300005615 Unclassified 609
101 Ga0068852_100092629 3300005616 Bacteria 2707
102 Ga0068852_101243505 3300005616 Unclassified 766
103 Ga0068859_100049602 3300005617 Unclassified 4216
104 Ga0068859_100216805 3300005617 Bacteria 2001
105 Ga0068859_101339601 3300005617 Bacteria 789
106 Ga0068864_100022287 3300005618 Bacteria 5310
107 Ga0068864_100447666 3300005618 Bacteria 1235
108 Ga0068864_100942303 3300005618 Bacteria 854
109 Ga0068864_101356884 3300005618 Unclassified 712
110 Ga0068866_10000042 3300005718 Bacteria 48856
111 Ga0068866_10282113 3300005718 Unclassified 1029
112 Ga0068866_10739080 3300005718 Unclassified 678
113 Ga0068861_100594797 3300005719 Unclassified 1014
114 Ga0068870_10075252 3300005840 Archaea 1852
115 Ga0068863_100279279 3300005841 Bacteria 1618
116 Ga0068863_100827953 3300005841 Unclassified 924
117 Ga0068863_101846522 3300005841 Bacteria 614
118 Ga0068858_100051116 3300005842 Bacteria 3824
119 Ga0068860_101893919 3300005843 Unclassified 618
120 Ga0070715_10110857 3300006163 Bacteria 1294
121 Ga0097621_100058094 3300006237 Bacteria 3165
122 Ga0068871_100269892 3300006358 Bacteria 1486
123 Ga0075428_100061383 3300006844 Bacteria 4117
124 Ga0075428_100779982 3300006844 Unclassified 1016
125 Ga0075430_100011232 3300006846 Bacteria 7595
126 Ga0075430_100577768 3300006846 Unclassified 927
127 Ga0075431_100016224 3300006847 Bacteria 7556
128 Ga0075431_100126054 3300006847 Bacteria 2642
129 Ga0075431_101036867 3300006847 Archaea 786
130 Ga0075433_10036183 3300006852 Bacteria 4251
131 Ga0075433_10072461 3300006852 Bacteria 3029
132 Ga0075433_10694274 3300006852 Bacteria 891
133 Ga0075433_11000036 3300006852 Unclassified 728
134 Ga0075434_100001882 3300006871 Bacteria 18167
135 Ga0075434_100407861 3300006871 Bacteria 1380
136 Ga0075434_100433145 3300006871 Bacteria 1336
137 Ga0075434_100469112 3300006871 Bacteria 1280
138 Ga0075434_101469555 3300006871 Bacteria 691
139 Ga0075429_100058921 3300006880 Bacteria 3345
140 Ga0068865_100002446 3300006881 Bacteria 10983
141 Ga0068865_100395853 3300006881 Bacteria 1130
142 Ga0075436_100010878 3300006914 Bacteria 6243
143 Ga0075436_100041869 3300006914 Bacteria 3160
144 Ga0097620_100049602 3300006931 Unclassified 4216
145 Ga0097620_100216813 3300006931 Bacteria 2001
146 Ga0097620_101339044 3300006931 Bacteria 789
147 Ga0075435_100437488 3300007076 Bacteria 1127
148 Ga0105240_10147722 3300009093 Bacteria 2803
149 Ga0105245_10024899 3300009098 Bacteria 5260
150 Ga0105245_10606438 3300009098 Unclassified 1122
151 Ga0114129_10000461 3300009147 Bacteria 48733
152 Ga0114129_10469381 3300009147 Bacteria 1648
153 Ga0114129_10651154 3300009147 Bacteria 1360
154 Ga0114129_12091829 3300009147 Unclassified 683
155 Ga0105243_10010025 3300009148 Bacteria 7205
156 Ga0105243_10752969 3300009148 Bacteria 955
157 Ga0105241_10116920 3300009174 Unclassified 2142
158 Ga0105242_10000472 3300009176 Bacteria 31922
159 Ga0105242_10147117 3300009176 Unclassified 2050
160 Ga0105242_12168473 3300009176 Unclassified 600
161 Ga0105248_10058552 3300009177 Bacteria 4327
162 Ga0105238_10429765 3300009551 Bacteria 1316
163 Ga0105249_10002206 3300009553 Bacteria 16872
164 Ga0105249_10659365 3300009553 Unclassified 1104
165 Ga0105239_10022475 3300010375 Bacteria 6953
166 Ga0105239_10023621 3300010375 Bacteria 6770
167 Ga0105239_12466405 3300010375 Unclassified 606
168 Ga0105246_10022881 3300011119 Bacteria 4038
169 Ga0157371_10110095 3300013102 Unclassified 1955
170 Ga0157378_10005549 3300013297 Bacteria 11047
171 Ga0163162_10701581 3300013306 Bacteria 1133
172 Ga0163162_11601925 3300013306 Unclassified 743
173 Ga0157372_10049767 3300013307 Bacteria 4661
174 Ga0157372_11062168 3300013307 Bacteria 937
175 Ga0157375_10079347 3300013308 Unclassified 3318
176 Ga0157375_11476830 3300013308 Unclassified 802
177 Ga0157375_12980559 3300013308 Bacteria 565
178 Ga0163163_10050389 3300014325 Bacteria 4100
179 Ga0157380_12880517 3300014326 Unclassified 547
180 Ga0157379_10014099 3300014968 Bacteria 7006
181 Ga0157379_10051284 3300014968 Bacteria 3686
182 Ga0163161_10073131 3300017792 Unclassified 2512
183 Ga0207682_10602478 3300025893 Unclassified 518
184 Ga0207642_10002227 3300025899 Bacteria 6019
185 Ga0207642_10216600 3300025899 Unclassified 1068
186 Ga0207680_10004957 3300025903 Bacteria 6339
187 Ga0207685_10021741 3300025905 Bacteria 2155
188 Ga0207645_10000983 3300025907 Bacteria 23564
189 Ga0207654_10065431 3300025911 Unclassified 2140
190 Ga0207707_10001053 3300025912 Bacteria 26453
191 Ga0207707_10172657 3300025912 Bacteria 1889
192 Ga0207707_11201419 3300025912 Bacteria 614
193 Ga0207695_10154901 3300025913 Unclassified 2227
194 Ga0207660_10045050 3300025917 Unclassified 3106
195 Ga0207660_10378650 3300025917 Unclassified 1137
196 Ga0207657_10810063 3300025919 Unclassified 724
197 Ga0207652_10079391 3300025921 Unclassified 2867
198 Ga0207652_10367384 3300025921 Bacteria 1299
199 Ga0207652_10700042 3300025921 Bacteria 904
200 Ga0207646_10043600 3300025922 Bacteria 4027
201 Ga0207646_10241026 3300025922 Bacteria 1633
202 Ga0207646_10270729 3300025922 Bacteria 1535
203 Ga0207681_10006362 3300025923 Bacteria 7251
204 Ga0207681_10179511 3300025923 Bacteria 1611
205 Ga0207694_10667063 3300025924 Unclassified 876
206 Ga0207694_11423879 3300025924 Bacteria 585
207 Ga0207644_10792730 3300025931 Unclassified 792
208 Ga0207690_10756050 3300025932 Bacteria 801
209 Ga0207706_10000177 3300025933 Bacteria 70870
210 Ga0207706_10670251 3300025933 Bacteria 887
211 Ga0207686_10000606 3300025934 Bacteria 22418
212 Ga0207686_10979786 3300025934 Unclassified 685
213 Ga0207709_10002923 3300025935 Bacteria 10431
214 Ga0207669_10000859 3300025937 Bacteria 12942
215 Ga0207704_10008011 3300025938 Bacteria 5026
216 Ga0207704_10204866 3300025938 Bacteria 1447
217 Ga0207691_10160665 3300025940 Bacteria 1971
218 Ga0207711_10113607 3300025941 Bacteria 2411
219 Ga0207689_10010683 3300025942 Bacteria 7899
220 Ga0207661_10383371 3300025944 Bacteria 1273
221 Ga0207679_10444782 3300025945 Bacteria 1148
222 Ga0207667_11082389 3300025949 Bacteria 785
223 Ga0207712_10003207 3300025961 Bacteria 10397
224 Ga0207668_10129624 3300025972 Unclassified 1924
225 Ga0207640_10001452 3300025981 Bacteria 12818
226 Ga0207658_10089310 3300025986 Bacteria 2385
227 Ga0207677_11298121 3300026023 Bacteria 668
228 Ga0207639_10079724 3300026041 Bacteria 2588
229 Ga0207639_10956457 3300026041 Unclassified 801
230 Ga0207678_10016773 3300026067 Bacteria 6432
231 Ga0207678_10111789 3300026067 Bacteria 2330
232 Ga0207708_10034807 3300026075 Unclassified 3832
233 Ga0207708_10125851 3300026075 Bacteria 2000
234 Ga0207702_10181222 3300026078 Unclassified 1940
235 Ga0207641_10076858 3300026088 Bacteria 2888
236 Ga0207641_10397192 3300026088 Bacteria 1323
237 Ga0207648_10000509 3300026089 Bacteria 43452
238 Ga0207648_10299382 3300026089 Unclassified 1442
239 Ga0207648_10307842 3300026089 Bacteria 1422
240 Ga0207676_10010989 3300026095 Bacteria 6463
241 Ga0207676_10397357 3300026095 Bacteria 1287
242 Ga0207676_10896943 3300026095 Bacteria 869
243 Ga0207674_10030283 3300026116 Bacteria 5692
244 Ga0207675_100616750 3300026118 Unclassified 1089
245 Ga0207683_10061180 3300026121 Bacteria 3313
246 Ga0207683_10862815 3300026121 Bacteria 840
247 Ga0207698_10120020 3300026142 Unclassified 2223
248 Ga0207698_10487671 3300026142 Bacteria 1197
249 Ga0210000_1035545 3300027462 Bacteria 785
250 Ga0209982_1026442 3300027552 Bacteria 905
251 Ga0209974_10020070 3300027876 Bacteria 2215
252 Ga0209974_10023602 3300027876 Unclassified 2035
253 Ga0207428_10599411 3300027907 Unclassified 794
254 Ga0268264_10006168 3300028381 Bacteria 10121
255 Ga0268264_10760732 3300028381 Bacteria 966
256 Ga0316182_1366327 3300030745 Bacteria 576
257 Ga0307408_100013303 3300031548 Bacteria 5462
258 Ga0307408_100050706 3300031548 Bacteria 2986
259 Ga0307408_100068870 3300031548 Bacteria 2607
260 Ga0307408_100952983 3300031548 Bacteria 788
261 Ga0307408_101085817 3300031548 Unclassified 742
262 Ga0307405_10003608 3300031731 Bacteria 7152
263 Ga0307405_10021728 3300031731 Bacteria 3613
264 Ga0307405_10096267 3300031731 Bacteria 1973
265 Ga0307405_10632381 3300031731 Bacteria 878
266 Ga0307413_10003475 3300031824 Bacteria 6636
267 Ga0307413_10020957 3300031824 Bacteria 3488
268 Ga0307413_10141251 3300031824 Unclassified 1664
269 Ga0307413_11001883 3300031824 Bacteria 716
270 Ga0307413_11309505 3300031824 Unclassified 634
271 Ga0307410_10000197 3300031852 Bacteria 22538
272 Ga0307410_10021980 3300031852 Bacteria 3934
273 Ga0307410_10352108 3300031852 Unclassified 1177
274 Ga0307410_10512543 3300031852 Bacteria 988
275 Ga0307406_10017307 3300031901 Bacteria 4197
276 Ga0307406_10055365 3300031901 Unclassified 2535
277 Ga0307406_10097498 3300031901 Bacteria 1994
278 Ga0307406_10146825 3300031901 Unclassified 1677
279 Ga0307406_11683852 3300031901 Unclassified 562
280 Ga0307407_10004864 3300031903 Bacteria 5765
281 Ga0307407_10091603 3300031903 Bacteria 1864
282 Ga0307407_10213586 3300031903 Unclassified 1300
283 Ga0307407_10867184 3300031903 Bacteria 691
284 Ga0307412_10010435 3300031911 Bacteria 5349
285 Ga0307412_10011558 3300031911 Bacteria 5119
286 Ga0307412_10088651 3300031911 Bacteria 2159
287 Ga0307412_10763125 3300031911 Unclassified 836
288 Ga0307409_100000684 3300031995 Bacteria 15063
289 Ga0307409_100007028 3300031995 Bacteria 6692
290 Ga0307409_100031266 3300031995 Unclassified 3839
291 Ga0307409_100124119 3300031995 Bacteria 2193
292 Ga0307409_100585256 3300031995 Unclassified 1101
293 Ga0307409_101774560 3300031995 Bacteria 646
294 Ga0307409_101999019 3300031995 Unclassified 609
295 Ga0307416_100000627 3300032002 Bacteria 18209
296 Ga0307416_100009337 3300032002 Bacteria 6414
297 Ga0307416_100075255 3300032002 Unclassified 2825
298 Ga0307416_100082093 3300032002 Bacteria 2729
299 Ga0307416_100252921 3300032002 Bacteria 1716
300 Ga0307416_100256277 3300032002 Bacteria 1706
301 Ga0307416_100623568 3300032002 Unclassified 1160
302 Ga0307416_101998468 3300032002 Unclassified 682
303 Ga0307416_102067442 3300032002 Unclassified 672
304 Ga0307414_10012618 3300032004 Bacteria 5005
305 Ga0307414_10018619 3300032004 Bacteria 4281
306 Ga0307414_10087816 3300032004 Bacteria 2299
307 Ga0307414_10139257 3300032004 Bacteria 1897
308 Ga0307414_10641624 3300032004 Bacteria 956
309 Ga0307411_10000555 3300032005 Bacteria 13286
310 Ga0307411_10001169 3300032005 Bacteria 10322
311 Ga0307411_10010744 3300032005 Bacteria 4898
312 Ga0307411_10018615 3300032005 Bacteria 3989
313 Ga0307411_10431181 3300032005 Unclassified 1098
314 Ga0307411_10466197 3300032005 Bacteria 1060
315 Ga0307411_10670659 3300032005 Bacteria 900
316 Ga0307415_100000340 3300032126 Bacteria 20087
317 Ga0307415_100034728 3300032126 Unclassified 3287
318 Ga0307415_100075996 3300032126 Bacteria 2379
319 Ga0307415_100133662 3300032126 Bacteria 1882
320 Ga0373930_0019243 3300034816 Bacteria 1320
321 Ga0373950_0027011 3300034818 Unclassified 1045
322 Ga0373929_0048998 3300035085 Bacteria 961
323 Ga0373940_0001797 3300035088 Bacteria 4002
324 Ga0373940_0259448 3300035088 Bacteria 588
325 Ga0373951_0059960 3300035091 Unclassified 951
326 Ga0373939_0015932 3300035114 Unclassified 1975
327 Ga0373941_0056510 3300035115 Bacteria 1264
328 Ga0373961_0037100 3300035241 Unclassified 1391
329 Ga0373961_0092472 3300035241 Bacteria 968
330 Ga0373961_0122326 3300035241 Bacteria 864
331 Ga0373962_0101828 3300035242 Bacteria 897
332 Ga0373931_0028128 3300035691 Bacteria 2875
333 Ga0373931_0061901 3300035691 Bacteria 2019
334 Ga0373931_0067652 3300035691 Unclassified 1942
335 Ga0395900_1544106 3300037418 Unclassified 576
336 Ga0395905_0212938 3300037471 Unclassified 1810
337 Ga0395905_0214595 3300037471 Bacteria 1802
338 Ga0395901_1219445 3300038443 Bacteria 717
339 Ga0395901_1236189 3300038443 Unclassified 711
340 Ga0395901_1436537 3300038443 Unclassified 647
341 Ga0242419_007322 3300038698 Bacteria 813
342 Ga0242420_007453 3300038996 Unclassified 1755
343 Ga0439455_0014514 3300042012 Bacteria 1800
344 Ga0450892_016211 3300042130 Unclassified 700
345 Ga0439434_0309648 3300042435 Bacteria 547
346 Ga0439459_0061961 3300042438 Bacteria 847
347 Ga0439459_0183601 3300042438 Bacteria 563
348 Ga0451577_0051078 3300042876 Bacteria 3691
349 Ga0451577_0682279 3300042876 Unclassified 931
350 Ga0451577_0811326 3300042876 Archaea 845
351 Ga0453683_0190170 3300044673 Bacteria 1302
352 Ga0453683_0568193 3300044673 Unclassified 738
353 Ga0453683_0613038 3300044673 Unclassified 710
354 Ga0453684_0190347 3300044712 Unclassified 2401
355 Ga0453684_0580741 3300044712 Unclassified 1231
356 Ga0453684_0825662 3300044712 Unclassified 998
357 Ga0466957_0389253 3300044842 Bacteria 952
358 Ga0466960_0022324 3300044901 Bacteria 2829
359 Ga0451576_0123606 3300045051 Bacteria 2695
360 Ga0466967_1788657 3300045976 Bacteria 612
361 Ga0495592_0288431 3300046454 Archaea 1071
362 Ga0495603_0050101 3300046455 Unclassified 2484
363 Ga0495641_0058945 3300046461 Archaea 1736
364 Ga0495580_0196061 3300046472 Archaea 1392
365 Ga0495582_0185633 3300046473 Archaea 1185
366 Ga0495664_0013044 3300046477 Unclassified 4712
367 Ga0495594_0004255 3300046499 Bacteria 7352
368 Ga0495594_0091313 3300046499 Unclassified 1707
369 Ga0495618_0010389 3300046514 Bacteria 5630
370 Ga0495628_0372946 3300046516 Archaea 1046
371 Ga0495630_0007057 3300046517 Bacteria 8005
372 Ga0495666_0000404 3300046526 Bacteria 18997
373 Ga0495640_0399855 3300046533 Archaea 843
374 Ga0495586_0001360 3300046535 Bacteria 13586
375 Ga0495622_0393434 3300046557 Unclassified 597
376 Ga0495667_0277855 3300046559 Unclassified 1063
377 Ga0495634_0008473 3300046642 Bacteria 7649
378 Ga0495647_0011250 3300046681 Unclassified 3064
379 Ga0495658_0006683 3300046683 Bacteria 5670
380 Ga0495613_0210036 3300046689 Archaea 1369
381 Ga0495624_0142720 3300046690 Archaea 1466
382 Ga0495636_0030200 3300047318 Unclassified 2215
383 Ga0495674_0162996 3300047319 Unclassified 1864
384 Ga0495680_0015993 3300047322 Bacteria 6454
385 Ga0495684_0442364 3300047471 Unclassified 905
386 Ga0496100_0190307 3300048903 Bacteria 1489
387 Ga0496101_0025057 3300048904 Unclassified 4135
388 Ga0496101_0053904 3300048904 Unclassified 2903
389 Ga0496101_0235448 3300048904 Bacteria 1424
390 Ga0496102_0001806 3300048905 Bacteria 18514
391 Ga0496102_0117164 3300048905 Unclassified 2486
392 Ga0496102_0153040 3300048905 Bacteria 2168
393 Ga0496102_0344019 3300048905 Bacteria 1404
394 Ga0496102_0412806 3300048905 Bacteria 1268
395 Ga0496103_0053656 3300048906 Unclassified 2498
396 Ga0496103_0310355 3300048906 Bacteria 1015
397 Ga0496103_0407032 3300048906 Unclassified 874
398 Ga0496103_0548773 3300048906 Unclassified 738
399 Ga0496104_0025303 3300048907 Bacteria 5471
400 Ga0496104_0070232 3300048907 Bacteria 3329
401 Ga0496104_0489960 3300048907 Bacteria 1140
402 Ga0496104_0640605 3300048907 Bacteria 972
403 Ga0496105_0048571 3300048908 Unclassified 3503
404 Ga0496105_0408979 3300048908 Bacteria 1076
405 Ga0496106_0012688 3300048909 Bacteria 6225
406 Ga0496106_0045619 3300048909 Bacteria 3293
407 Ga0496106_0460779 3300048909 Bacteria 1021
408 Ga0496106_0602440 3300048909 Unclassified 880
409 Ga0496106_0691536 3300048909 Unclassified 813
410 Ga0496106_0827927 3300048909 Unclassified 733
411 Ga0496106_1296335 3300048909 Bacteria 565
412 Ga0496107_0115294 3300048910 Bacteria 1977
413 Ga0496107_0175531 3300048910 Bacteria 1591
414 Ga0496107_0593174 3300048910 Unclassified 819
415 Ga0496108_0001317 3300048911 Bacteria 19520
416 Ga0496108_0002308 3300048911 Bacteria 15273
417 Ga0496108_0006014 3300048911 Bacteria 9826
418 Ga0496109_0000573 3300048912 Bacteria 30760
419 Ga0496109_0011909 3300048912 Bacteria 7488
420 Ga0496109_0150557 3300048912 Bacteria 2178
421 Ga0496110_0000669 3300048913 Bacteria 23519
422 Ga0496110_0078888 3300048913 Unclassified 2931
423 Ga0496110_0108688 3300048913 Bacteria 2490
424 Ga0496110_1065359 3300048913 Bacteria 716
425 Ga0496111_0005561 3300048914 Bacteria 8098
426 Ga0496111_0022841 3300048914 Unclassified 4383
427 Ga0496111_0090292 3300048914 Bacteria 2244
428 Ga0496112_0012360 3300048915 Bacteria 7844
429 Ga0496112_0019324 3300048915 Bacteria 6428
430 Ga0496112_0022236 3300048915 Bacteria 6042
431 Ga0496112_0068157 3300048915 Unclassified 3513
432 Ga0496112_0341723 3300048915 Bacteria 1440
433 Ga0496113_0000810 3300048916 Bacteria 16241
434 Ga0496113_0002211 3300048916 Bacteria 11222
435 Ga0496113_0043812 3300048916 Unclassified 3313
436 Ga0496113_0081143 3300048916 Bacteria 2485
437 Ga0496114_0011337 3300048917 Bacteria 7121
438 Ga0496114_0031155 3300048917 Bacteria 4387
439 Ga0496115_0293709 3300048918 Bacteria 1332
440 Ga0501291_040718 3300049514 Unclassified 816
441 Ga0501292_118445 3300049515 Unclassified 538
442 Ga0501297_012395 3300049520 Unclassified 990
443 Ga0501298_002931 3300049521 Bacteria 2622
444 Ga0501299_060001 3300049522 Unclassified 804
445 Ga0501036_0388272 3300049572 Unclassified 1165
446 Ga0501040_0662889 3300049576 Unclassified 754
447 Ga0501040_0834323 3300049576 Bacteria 667
448 Ga0501040_1122703 3300049576 Unclassified 570
449 Ga0501046_0837049 3300049580 Unclassified 644
450 Ga0501048_0236198 3300049582 Unclassified 1297
451 Ga0501067_0008708 3300049583 Bacteria 5621
452 Ga0501067_0049896 3300049583 Bacteria 2319
453 Ga0501067_0403519 3300049583 Unclassified 762
454 Ga0501068_0124496 3300049584 Bacteria 1609
455 Ga0501068_0843860 3300049584 Unclassified 602
456 Ga0501069_0045851 3300049585 Unclassified 2423
457 Ga0501069_0066741 3300049585 Bacteria 2012
458 Ga0501069_0310492 3300049585 Unclassified 925
459 Ga0501074_0257545 3300049590 Unclassified 1241
460 Ga0501075_1158371 3300049591 Unclassified 587
461 Ga0501076_1278680 3300049592 Unclassified 603
462 Ga0501077_0292830 3300049593 Unclassified 1037
463 Ga0501208_133004 3300049655 Unclassified 556
464 Ga0501209_000383 3300049656 Bacteria 5397
465 Ga0501211_017640 3300049658 Unclassified 730
466 Ga0501214_000874 3300049659 Bacteria 2216
467 Ga0501217_005169 3300049661 Unclassified 2717
468 Ga0501217_073670 3300049661 Bacteria 934
469 Ga0501223_027155 3300049663 Unclassified 1114
470 Ga0501228_042510 3300049666 Unclassified 596
471 Ga0501230_086422 3300049667 Bacteria 662
472 Ga0501235_009347 3300049669 Unclassified 2143
473 Ga0501239_009460 3300049672 Unclassified 1059
474 Ga0501243_042956 3300049675 Bacteria 798
475 Ga0501247_000081 3300049677 Bacteria 5188
476 Ga0501247_045081 3300049677 Unclassified 640
477 Ga0501248_004469 3300049678 Unclassified 1058
478 Ga0501249_003437 3300049679 Bacteria 3179
479 Ga0501249_037825 3300049679 Bacteria 1089
480 Ga0501249_150460 3300049679 Unclassified 585
481 Ga0501253_022437 3300049683 Unclassified 1124
482 Ga0501258_015632 3300049687 Unclassified 851
483 Ga0501259_021258 3300049688 Unclassified 1158
484 Ga0501221_001100 3300049704 Unclassified 4441
485 Ga0501225_0003693 3300049705 Unclassified 4607
486 Ga0501229_026575 3300049706 Bacteria 781
487 Ga0501234_043044 3300049707 Unclassified 742
488 Ga0501245_008780 3300049708 Bacteria 1444
489 Ga0501079_0010843 3300049741 Bacteria 6942
490 Ga0501079_1063015 3300049741 Unclassified 638
491 Ga0501081_0123833 3300049743 Bacteria 1843
492 Ga0501081_0295562 3300049743 Bacteria 1188
493 Ga0501081_1003167 3300049743 Bacteria 631
494 Ga0501083_0766148 3300049744 Bacteria 628
495 Ga0501232_025288 3300049757 Unclassified 793
496 Ga0501262_061761 3300049759 Unclassified 599
497 Ga0501263_000924 3300049760 Unclassified 2547
498 Ga0501268_000867 3300049765 Unclassified 3528
499 Ga0501272_037172 3300049769 Bacteria 639
500 Ga0501276_008999 3300049773 Unclassified 821
501 Ga0501283_004070 3300049779 Unclassified 1960
502 Ga0501283_028885 3300049779 Unclassified 922
503 Ga0501035_0785473 3300049822 Unclassified 762
504 Ga0501045_0557302 3300049824 Unclassified 850
505 Ga0501204_003629 3300049850 Unclassified 1633
506 Ga0501204_073623 3300049850 Unclassified 567
507 nmdc:mga05p37_1864981_c1 3300050507 Unclassified 576
508 nmdc:mga05p37_3567_c1 3300050507 Bacteria 18184
509 nmdc:mga05p37_373312_c1 3300050507 Bacteria 1673
510 nmdc:mga05p37_802255_c1 3300050507 Archaea 1030
511 nmdc:mga09592_787868_c1 3300050508 Unclassified 805
512 nmdc:mga0qj67_201167_c1 3300050509 Unclassified 1618
513 nmdc:mga0qj67_62133_c1 3300050509 Bacteria 2968
514 nmdc:mga06r32_2946_c1 3300050510 Bacteria 15257
515 nmdc:mga06r32_57392_c1 3300050510 Bacteria 3739
516 nmdc:mga06r32_960018_c1 3300050510 Archaea 809
517 nmdc:mga0n895_1237064_c1 3300050512 Unclassified 719
518 nmdc:mga0n895_452121_c1 3300050512 Bacteria 1297
519 nmdc:mga0n895_620238_c1 3300050512 Bacteria 1082
520 nmdc:mga0n895_64843_c1 3300050512 Bacteria 3614
521 nmdc:mga08x19_237539_c1 3300050514 Bacteria 1255
522 nmdc:mga08x19_27931_c1 3300050514 Bacteria 3531
523 nmdc:mga08x19_420790_c1 3300050514 Bacteria 938
524 nmdc:mga0a205_104613_c1 3300050515 Bacteria 2730
525 nmdc:mga0a205_86862_c2 3300050515 Unclassified 2638
526 nmdc:mga0a205_9364_c1 3300050515 Bacteria 8951
527 Ga0495612_0360793 3300053078 Unclassified 657
528 Ga0587128_037996 3300059630 Unclassified 830
529 Ga0587075_028041 3300059644 Bacteria 880
530 Ga0501082_0182200 3300060353 Unclassified 1827
531 Ga0530510_0512143 3300061734 Bacteria 910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100251359 Ga0070694_1002513592 108
2 3300005549 Ga0070704_100658280 Ga0070704_1006582802 108
3 3300030745 Ga0316182_1366327 Ga0316182_13663271 108
4 3300031548 Ga0307408_100050706 Ga0307408_1000507062 108
5 3300031731 Ga0307405_10003608 Ga0307405_100036085 108
6 3300031824 Ga0307413_10020957 Ga0307413_100209574 108
7 3300031852 Ga0307410_10021980 Ga0307410_100219802 108
8 3300031901 Ga0307406_10017307 Ga0307406_100173075 108
9 3300031903 Ga0307407_10091603 Ga0307407_100916032 108
10 3300031911 Ga0307412_10010435 Ga0307412_100104355 108
11 3300031995 Ga0307409_100007028 Ga0307409_1000070283 108
12 3300032002 Ga0307416_100623568 Ga0307416_1006235682 108
13 3300032004 Ga0307414_10018619 Ga0307414_100186192 108
14 3300032005 Ga0307411_10018615 Ga0307411_100186152 108
15 3300032126 Ga0307415_100075996 Ga0307415_1000759962 108
16 3300031911 Ga0307412_10011558 Ga0307412_100115586 109
17 3300032005 Ga0307411_10000555 Ga0307411_100005553 109
18 3300005329 Ga0070683_100311457 Ga0070683_1003114571 110
19 3300005331 Ga0070670_101144989 Ga0070670_1011449892 110
20 3300005347 Ga0070668_101921552 Ga0070668_1019215521 110
21 3300005353 Ga0070669_100121329 Ga0070669_1001213292 110
22 3300005366 Ga0070659_101030725 Ga0070659_1010307252 110
23 3300005434 Ga0070709_10633794 Ga0070709_106337942 110
24 3300005436 Ga0070713_100434924 Ga0070713_1004349242 110
25 3300005436 Ga0070713_102315657 Ga0070713_1023156572 110
26 3300005445 Ga0070708_100061914 Ga0070708_1000619143 110
27 3300005458 Ga0070681_10221528 Ga0070681_102215283 110
28 3300005468 Ga0070707_100259106 Ga0070707_1002591062 110
29 3300005468 Ga0070707_100627139 Ga0070707_1006271392 110
30 3300005518 Ga0070699_100950409 Ga0070699_1009504091 110
31 3300005530 Ga0070679_101133272 Ga0070679_1011332722 110
32 3300005536 Ga0070697_100594661 Ga0070697_1005946612 110
33 3300005547 Ga0070693_101007807 Ga0070693_1010078072 110
34 3300005618 Ga0068864_100447666 Ga0068864_1004476662 110
35 3300005618 Ga0068864_100942303 Ga0068864_1009423031 110
36 3300005841 Ga0068863_100279279 Ga0068863_1002792793 110
37 3300005841 Ga0068863_100827953 Ga0068863_1008279532 110
38 3300005841 Ga0068863_101846522 Ga0068863_1018465221 110
39 3300005843 Ga0068860_101893919 Ga0068860_1018939192 110
40 3300006847 Ga0075431_101036867 Ga0075431_1010368672 110
41 3300006852 Ga0075433_10036183 Ga0075433_100361833 110
42 3300006871 Ga0075434_100469112 Ga0075434_1004691123 110
43 3300006871 Ga0075434_101469555 Ga0075434_1014695552 110
44 3300006914 Ga0075436_100041869 Ga0075436_1000418694 110
45 3300009147 Ga0114129_12091829 Ga0114129_120918291 110
46 3300014325 Ga0163163_10050389 Ga0163163_100503894 110
47 3300014968 Ga0157379_10051284 Ga0157379_100512842 110
48 3300017792 Ga0163161_10073131 Ga0163161_100731312 110
49 3300025921 Ga0207652_10700042 Ga0207652_107000422 110
50 3300025922 Ga0207646_10241026 Ga0207646_102410262 110
51 3300025922 Ga0207646_10270729 Ga0207646_102707292 110
52 3300025945 Ga0207679_10444782 Ga0207679_104447822 110
53 3300026088 Ga0207641_10076858 Ga0207641_100768583 110
54 3300026088 Ga0207641_10397192 Ga0207641_103971923 110
55 3300026095 Ga0207676_10397357 Ga0207676_103973572 110
56 3300026095 Ga0207676_10896943 Ga0207676_108969431 110
57 3300028381 Ga0268264_10760732 Ga0268264_107607322 110
58 3300031548 Ga0307408_100952983 Ga0307408_1009529832 110
59 3300031824 Ga0307413_11001883 Ga0307413_110018832 110
60 3300031901 Ga0307406_10146825 Ga0307406_101468252 110
61 3300031901 Ga0307406_11683852 Ga0307406_116838521 110
62 3300031903 Ga0307407_10867184 Ga0307407_108671842 110
63 3300031995 Ga0307409_100124119 Ga0307409_1001241192 110
64 3300032002 Ga0307416_100082093 Ga0307416_1000820933 110
65 3300032002 Ga0307416_100256277 Ga0307416_1002562772 110
66 3300032002 Ga0307416_102067442 Ga0307416_1020674422 110
67 3300032004 Ga0307414_10139257 Ga0307414_101392572 110
68 3300032004 Ga0307414_10641624 Ga0307414_106416242 110
69 3300034816 Ga0373930_0019243 Ga0373930_0019243_807_1139 110
70 3300035085 Ga0373929_0048998 Ga0373929_0048998_352_684 110
71 3300035088 Ga0373940_0001797 Ga0373940_0001797_261_593 110
72 3300035088 Ga0373940_0259448 Ga0373940_0259448_226_558 110
73 3300035091 Ga0373951_0059960 Ga0373951_0059960_332_664 110
74 3300035114 Ga0373939_0015932 Ga0373939_0015932_869_1201 110
75 3300035241 Ga0373961_0037100 Ga0373961_0037100_841_1173 110
76 3300035241 Ga0373961_0092472 Ga0373961_0092472_168_500 110
77 3300035691 Ga0373931_0061901 Ga0373931_0061901_615_947 110
78 3300037471 Ga0395905_0212938 Ga0395905_0212938_773_1105 110
79 3300037471 Ga0395905_0214595 Ga0395905_0214595_1329_1661 110
80 3300038443 Ga0395901_1219445 Ga0395901_1219445_74_406 110
81 3300038443 Ga0395901_1236189 Ga0395901_1236189_171_503 110
82 3300042438 Ga0439459_0183601 Ga0439459_0183601_36_368 110
83 3300042876 Ga0451577_0811326 Ga0451577_0811326_192_524 110
84 3300044673 Ga0453683_0613038 Ga0453683_0613038_207_539 110
85 3300044712 Ga0453684_0580741 Ga0453684_0580741_718_1050 110
86 3300044712 Ga0453684_0825662 Ga0453684_0825662_54_386 110
87 3300046454 Ga0495592_0288431 Ga0495592_0288431_114_446 110
88 3300046461 Ga0495641_0058945 Ga0495641_0058945_633_965 110
89 3300046472 Ga0495580_0196061 Ga0495580_0196061_643_975 110
90 3300046473 Ga0495582_0185633 Ga0495582_0185633_201_533 110
91 3300046477 Ga0495664_0013044 Ga0495664_0013044_3759_4091 110
92 3300046499 Ga0495594_0004255 Ga0495594_0004255_2406_2738 110
93 3300046514 Ga0495618_0010389 Ga0495618_0010389_662_994 110
94 3300046516 Ga0495628_0372946 Ga0495628_0372946_616_948 110
95 3300046517 Ga0495630_0007057 Ga0495630_0007057_5606_5938 110
96 3300046526 Ga0495666_0000404 Ga0495666_0000404_7921_8253 110
97 3300046533 Ga0495640_0399855 Ga0495640_0399855_418_750 110
98 3300046535 Ga0495586_0001360 Ga0495586_0001360_5429_5761 110
99 3300046559 Ga0495667_0277855 Ga0495667_0277855_673_1005 110
100 3300046642 Ga0495634_0008473 Ga0495634_0008473_7260_7592 110
101 3300046681 Ga0495647_0011250 Ga0495647_0011250_2112_2444 110
102 3300046683 Ga0495658_0006683 Ga0495658_0006683_2142_2474 110
103 3300046689 Ga0495613_0210036 Ga0495613_0210036_596_928 110
104 3300046690 Ga0495624_0142720 Ga0495624_0142720_655_987 110
105 3300047319 Ga0495674_0162996 Ga0495674_0162996_865_1197 110
106 3300047322 Ga0495680_0015993 Ga0495680_0015993_1528_1860 110
107 3300047471 Ga0495684_0442364 Ga0495684_0442364_340_672 110
108 3300048905 Ga0496102_0153040 Ga0496102_0153040_577_909 110
109 3300048905 Ga0496102_0344019 Ga0496102_0344019_609_941 110
110 3300048906 Ga0496103_0548773 Ga0496103_0548773_136_468 110
111 3300048907 Ga0496104_0025303 Ga0496104_0025303_185_517 110
112 3300048907 Ga0496104_0070232 Ga0496104_0070232_1012_1344 110
113 3300048908 Ga0496105_0408979 Ga0496105_0408979_72_404 110
114 3300048909 Ga0496106_0460779 Ga0496106_0460779_207_539 110
115 3300048909 Ga0496106_0691536 Ga0496106_0691536_259_591 110
116 3300048909 Ga0496106_1296335 Ga0496106_1296335_29_361 110
117 3300048910 Ga0496107_0175531 Ga0496107_0175531_727_1059 110
118 3300048911 Ga0496108_0001317 Ga0496108_0001317_11063_11395 110
119 3300048911 Ga0496108_0006014 Ga0496108_0006014_2967_3299 110
120 3300048912 Ga0496109_0150557 Ga0496109_0150557_846_1178 110
121 3300048913 Ga0496110_0078888 Ga0496110_0078888_839_1171 110
122 3300048913 Ga0496110_0108688 Ga0496110_0108688_809_1141 110
123 3300048913 Ga0496110_1065359 Ga0496110_1065359_373_705 110
124 3300048914 Ga0496111_0090292 Ga0496111_0090292_708_1040 110
125 3300048915 Ga0496112_0019324 Ga0496112_0019324_5096_5428 110
126 3300048915 Ga0496112_0341723 Ga0496112_0341723_419_751 110
127 3300048916 Ga0496113_0081143 Ga0496113_0081143_764_1096 110
128 3300049583 Ga0501067_0049896 Ga0501067_0049896_1691_2023 110
129 3300049661 Ga0501217_073670 Ga0501217_073670_511_843 110
130 3300049769 Ga0501272_037172 Ga0501272_037172_133_465 110
131 3300050507 nmdc:mga05p37_802255_c1 nmdc:mga05p37_802255_c1_490_822 110
132 3300050509 nmdc:mga0qj67_201167_c1 nmdc:mga0qj67_201167_c1_776_1108 110
133 3300050510 nmdc:mga06r32_960018_c1 nmdc:mga06r32_960018_c1_216_548 110
134 3300050512 nmdc:mga0n895_1237064_c1 nmdc:mga0n895_1237064_c1_65_397 110
135 3300050512 nmdc:mga0n895_620238_c1 nmdc:mga0n895_620238_c1_235_567 110
136 3300050515 nmdc:mga0a205_9364_c1 nmdc:mga0a205_9364_c1_7517_7849 110
137 3300059630 Ga0587128_037996 Ga0587128_037996_187_519 110
138 3300004803 Ga0058862_11776041 Ga0058862_117760411 111
139 3300005328 Ga0070676_10000689 Ga0070676_100006897 111
140 3300005330 Ga0070690_100268539 Ga0070690_1002685393 111
141 3300005333 Ga0070677_10891181 Ga0070677_108911811 111
142 3300005334 Ga0068869_100005324 Ga0068869_10000532412 111
143 3300005335 Ga0070666_10056084 Ga0070666_100560843 111
144 3300005339 Ga0070660_100919514 Ga0070660_1009195142 111
145 3300005341 Ga0070691_10016149 Ga0070691_100161492 111
146 3300005345 Ga0070692_10249134 Ga0070692_102491342 111
147 3300005347 Ga0070668_100405644 Ga0070668_1004056442 111
148 3300005354 Ga0070675_100321699 Ga0070675_1003216992 111
149 3300005355 Ga0070671_100956414 Ga0070671_1009564142 111
150 3300005356 Ga0070674_100000437 Ga0070674_10000043710 111
151 3300005438 Ga0070701_11374875 Ga0070701_113748751 111
152 3300005440 Ga0070705_100008391 Ga0070705_1000083917 111
153 3300005441 Ga0070700_101130691 Ga0070700_1011306911 111
154 3300005444 Ga0070694_100192432 Ga0070694_1001924323 111
155 3300005445 Ga0070708_101233343 Ga0070708_1012333431 111
156 3300005455 Ga0070663_100033021 Ga0070663_1000330212 111
157 3300005456 Ga0070678_100013437 Ga0070678_1000134371 111
158 3300005457 Ga0070662_100001184 Ga0070662_10000118415 111
159 3300005458 Ga0070681_10790468 Ga0070681_107904682 111
160 3300005459 Ga0068867_100002643 Ga0068867_1000026434 111
161 3300005530 Ga0070679_101413215 Ga0070679_1014132152 111
162 3300005539 Ga0068853_100180754 Ga0068853_1001807543 111
163 3300005543 Ga0070672_100504633 Ga0070672_1005046332 111
164 3300005544 Ga0070686_100112691 Ga0070686_1001126912 111
165 3300005545 Ga0070695_100022448 Ga0070695_1000224482 111
166 3300005546 Ga0070696_100003093 Ga0070696_10000309310 111
167 3300005547 Ga0070693_100009180 Ga0070693_1000091803 111
168 3300005549 Ga0070704_100021934 Ga0070704_1000219347 111
169 3300005563 Ga0068855_100227642 Ga0068855_1002276422 111
170 3300005577 Ga0068857_100029068 Ga0068857_1000290683 111
171 3300005578 Ga0068854_100000862 Ga0068854_10000086212 111
172 3300005614 Ga0068856_102141134 Ga0068856_1021411342 111
173 3300005615 Ga0070702_100014670 Ga0070702_1000146702 111
174 3300005616 Ga0068852_100092629 Ga0068852_1000926293 111
175 3300005617 Ga0068859_100216805 Ga0068859_1002168053 111
176 3300005618 Ga0068864_100022287 Ga0068864_1000222876 111
177 3300005718 Ga0068866_10000042 Ga0068866_1000004237 111
178 3300005840 Ga0068870_10075252 Ga0068870_100752523 111
179 3300005842 Ga0068858_100051116 Ga0068858_1000511162 111
180 3300006237 Ga0097621_100058094 Ga0097621_1000580943 111
181 3300006358 Ga0068871_100269892 Ga0068871_1002698923 111
182 3300006844 Ga0075428_100061383 Ga0075428_1000613834 111
183 3300006846 Ga0075430_100011232 Ga0075430_1000112325 111
184 3300006847 Ga0075431_100016224 Ga0075431_1000162244 111
185 3300006847 Ga0075431_100126054 Ga0075431_1001260544 111
186 3300006852 Ga0075433_10072461 Ga0075433_100724613 111
187 3300006871 Ga0075434_100001882 Ga0075434_1000018826 111
188 3300006880 Ga0075429_100058921 Ga0075429_1000589214 111
189 3300006881 Ga0068865_100002446 Ga0068865_1000024463 111
190 3300006931 Ga0097620_100216813 Ga0097620_1002168132 111
191 3300009093 Ga0105240_10147722 Ga0105240_101477222 111
192 3300009098 Ga0105245_10024899 Ga0105245_100248993 111
193 3300009148 Ga0105243_10010025 Ga0105243_100100252 111
194 3300009174 Ga0105241_10116920 Ga0105241_101169204 111
195 3300009176 Ga0105242_10000472 Ga0105242_1000047214 111
196 3300009177 Ga0105248_10058552 Ga0105248_100585524 111
197 3300009551 Ga0105238_10429765 Ga0105238_104297652 111
198 3300009553 Ga0105249_10002206 Ga0105249_100022067 111
199 3300010375 Ga0105239_10022475 Ga0105239_100224758 111
200 3300011119 Ga0105246_10022881 Ga0105246_100228816 111
201 3300013102 Ga0157371_10110095 Ga0157371_101100953 111
202 3300013297 Ga0157378_10005549 Ga0157378_100055493 111
203 3300013307 Ga0157372_10049767 Ga0157372_100497677 111
204 3300013308 Ga0157375_10079347 Ga0157375_100793472 111
205 3300013308 Ga0157375_11476830 Ga0157375_114768302 111
206 3300014968 Ga0157379_10014099 Ga0157379_100140992 111
207 3300025893 Ga0207682_10602478 Ga0207682_106024782 111
208 3300025899 Ga0207642_10002227 Ga0207642_100022274 111
209 3300025903 Ga0207680_10004957 Ga0207680_100049577 111
210 3300025907 Ga0207645_10000983 Ga0207645_1000098313 111
211 3300025911 Ga0207654_10065431 Ga0207654_100654314 111
212 3300025913 Ga0207695_10154901 Ga0207695_101549013 111
213 3300025923 Ga0207681_10006362 Ga0207681_100063627 111
214 3300025923 Ga0207681_10179511 Ga0207681_101795112 111
215 3300025924 Ga0207694_10667063 Ga0207694_106670632 111
216 3300025931 Ga0207644_10792730 Ga0207644_107927302 111
217 3300025933 Ga0207706_10000177 Ga0207706_1000017748 111
218 3300025934 Ga0207686_10000606 Ga0207686_1000060618 111
219 3300025935 Ga0207709_10002923 Ga0207709_1000292310 111
220 3300025937 Ga0207669_10000859 Ga0207669_1000085912 111
221 3300025938 Ga0207704_10008011 Ga0207704_100080117 111
222 3300025940 Ga0207691_10160665 Ga0207691_101606653 111
223 3300025941 Ga0207711_10113607 Ga0207711_101136074 111
224 3300025942 Ga0207689_10010683 Ga0207689_1001068310 111
225 3300025949 Ga0207667_11082389 Ga0207667_110823892 111
226 3300025961 Ga0207712_10003207 Ga0207712_100032076 111
227 3300025972 Ga0207668_10129624 Ga0207668_101296242 111
228 3300025981 Ga0207640_10001452 Ga0207640_100014527 111
229 3300025986 Ga0207658_10089310 Ga0207658_100893102 111
230 3300026023 Ga0207677_11298121 Ga0207677_112981211 111
231 3300026041 Ga0207639_10079724 Ga0207639_100797243 111
232 3300026067 Ga0207678_10111789 Ga0207678_101117893 111
233 3300026075 Ga0207708_10034807 Ga0207708_100348075 111
234 3300026078 Ga0207702_10181222 Ga0207702_101812222 111
235 3300026089 Ga0207648_10000509 Ga0207648_1000050915 111
236 3300026095 Ga0207676_10010989 Ga0207676_100109897 111
237 3300026116 Ga0207674_10030283 Ga0207674_100302833 111
238 3300026121 Ga0207683_10061180 Ga0207683_100611804 111
239 3300026142 Ga0207698_10120020 Ga0207698_101200202 111
240 3300028381 Ga0268264_10006168 Ga0268264_100061687 111
241 3300032002 Ga0307416_100252921 Ga0307416_1002529212 111
242 3300032005 Ga0307411_10466197 Ga0307411_104661972 111
243 3300035241 Ga0373961_0122326 Ga0373961_0122326_116_451 111
244 3300042876 Ga0451577_0051078 Ga0451577_0051078_2072_2407 111
245 3300044673 Ga0453683_0568193 Ga0453683_0568193_110_445 111
246 3300044712 Ga0453684_0190347 Ga0453684_0190347_798_1133 111
247 3300044901 Ga0466960_0022324 Ga0466960_0022324_746_1081 111
248 3300045051 Ga0451576_0123606 Ga0451576_0123606_2030_2365 111
249 3300046455 Ga0495603_0050101 Ga0495603_0050101_855_1190 111
250 3300046499 Ga0495594_0091313 Ga0495594_0091313_280_615 111
251 3300046557 Ga0495622_0393434 Ga0495622_0393434_225_560 111
252 3300047318 Ga0495636_0030200 Ga0495636_0030200_544_879 111
253 3300048904 Ga0496101_0025057 Ga0496101_0025057_2811_3152 111
254 3300048904 Ga0496101_0235448 Ga0496101_0235448_718_1053 111
255 3300048905 Ga0496102_0412806 Ga0496102_0412806_514_849 111
256 3300048909 Ga0496106_0045619 Ga0496106_0045619_460_795 111
257 3300048909 Ga0496106_0827927 Ga0496106_0827927_346_681 111
258 3300048910 Ga0496107_0593174 Ga0496107_0593174_43_378 111
259 3300048915 Ga0496112_0068157 Ga0496112_0068157_582_917 111
260 3300048916 Ga0496113_0043812 Ga0496113_0043812_252_587 111
261 3300048917 Ga0496114_0011337 Ga0496114_0011337_2886_3221 111
262 3300048917 Ga0496114_0031155 Ga0496114_0031155_895_1236 111
263 3300050507 nmdc:mga05p37_3567_c1 nmdc:mga05p37_3567_c1_15645_15980 111
264 3300050510 nmdc:mga06r32_57392_c1 nmdc:mga06r32_57392_c1_3162_3497 111
265 3300050512 nmdc:mga0n895_64843_c1 nmdc:mga0n895_64843_c1_1199_1534 111
266 3300050515 nmdc:mga0a205_104613_c1 nmdc:mga0a205_104613_c1_554_889 111
267 3300059644 Ga0587075_028041 Ga0587075_028041_473_808 111
268 3300005293 Ga0065715_10863454 Ga0065715_108634541 112
269 3300005336 Ga0070680_100020954 Ga0070680_1000209543 112
270 3300005366 Ga0070659_101608070 Ga0070659_1016080701 112
271 3300005445 Ga0070708_100002723 Ga0070708_1000027236 112
272 3300005445 Ga0070708_100167838 Ga0070708_1001678382 112
273 3300005458 Ga0070681_10030120 Ga0070681_100301205 112
274 3300005468 Ga0070707_100006439 Ga0070707_1000064397 112
275 3300005518 Ga0070699_100013167 Ga0070699_1000131671 112
276 3300005530 Ga0070679_100128767 Ga0070679_1001287673 112
277 3300005530 Ga0070679_100413384 Ga0070679_1004133842 112
278 3300005536 Ga0070697_100198670 Ga0070697_1001986702 112
279 3300005536 Ga0070697_100361879 Ga0070697_1003618792 112
280 3300005545 Ga0070695_101488842 Ga0070695_1014888421 112
281 3300005546 Ga0070696_100192126 Ga0070696_1001921262 112
282 3300005546 Ga0070696_100486995 Ga0070696_1004869952 112
283 3300006163 Ga0070715_10110857 Ga0070715_101108572 112
284 3300006844 Ga0075428_100779982 Ga0075428_1007799822 112
285 3300006846 Ga0075430_100577768 Ga0075430_1005777682 112
286 3300006871 Ga0075434_100407861 Ga0075434_1004078612 112
287 3300006871 Ga0075434_100433145 Ga0075434_1004331452 112
288 3300006914 Ga0075436_100010878 Ga0075436_1000108785 112
289 3300025905 Ga0207685_10021741 Ga0207685_100217412 112
290 3300025912 Ga0207707_10001053 Ga0207707_1000105317 112
291 3300025912 Ga0207707_11201419 Ga0207707_112014192 112
292 3300025917 Ga0207660_10045050 Ga0207660_100450503 112
293 3300025921 Ga0207652_10079391 Ga0207652_100793914 112
294 3300025921 Ga0207652_10367384 Ga0207652_103673842 112
295 3300025922 Ga0207646_10043600 Ga0207646_100436006 112
296 3300026067 Ga0207678_10016773 Ga0207678_100167734 112
297 3300027462 Ga0210000_1035545 Ga0210000_10355452 112
298 3300027552 Ga0209982_1026442 Ga0209982_10264422 112
299 3300027876 Ga0209974_10023602 Ga0209974_100236024 112
300 3300031548 Ga0307408_100068870 Ga0307408_1000688703 112
301 3300031548 Ga0307408_101085817 Ga0307408_1010858172 112
302 3300031731 Ga0307405_10021728 Ga0307405_100217283 112
303 3300031731 Ga0307405_10632381 Ga0307405_106323812 112
304 3300031824 Ga0307413_11309505 Ga0307413_113095051 112
305 3300031901 Ga0307406_10097498 Ga0307406_100974982 112
306 3300031995 Ga0307409_101774560 Ga0307409_1017745602 112
307 3300031995 Ga0307409_101999019 Ga0307409_1019990191 112
308 3300032002 Ga0307416_100075255 Ga0307416_1000752553 112
309 3300032005 Ga0307411_10431181 Ga0307411_104311812 112
310 3300032005 Ga0307411_10670659 Ga0307411_106706591 112
311 3300042130 Ga0450892_016211 Ga0450892_016211_53_391 112
312 3300042435 Ga0439434_0309648 Ga0439434_0309648_165_503 112
313 3300042876 Ga0451577_0682279 Ga0451577_0682279_402_740 112
314 3300044673 Ga0453683_0190170 Ga0453683_0190170_767_1105 112
315 3300048905 Ga0496102_0117164 Ga0496102_0117164_1999_2337 112
316 3300048907 Ga0496104_0640605 Ga0496104_0640605_405_743 112
317 3300049572 Ga0501036_0388272 Ga0501036_0388272_416_754 112
318 3300049576 Ga0501040_0662889 Ga0501040_0662889_180_518 112
319 3300049576 Ga0501040_0834323 Ga0501040_0834323_245_583 112
320 3300049580 Ga0501046_0837049 Ga0501046_0837049_130_468 112
321 3300049582 Ga0501048_0236198 Ga0501048_0236198_80_418 112
322 3300049583 Ga0501067_0403519 Ga0501067_0403519_185_523 112
323 3300049584 Ga0501068_0124496 Ga0501068_0124496_171_509 112
324 3300049584 Ga0501068_0843860 Ga0501068_0843860_37_375 112
325 3300049585 Ga0501069_0045851 Ga0501069_0045851_1441_1779 112
326 3300049590 Ga0501074_0257545 Ga0501074_0257545_278_616 112
327 3300049591 Ga0501075_1158371 Ga0501075_1158371_92_430 112
328 3300049592 Ga0501076_1278680 Ga0501076_1278680_96_434 112
329 3300049593 Ga0501077_0292830 Ga0501077_0292830_434_772 112
330 3300049741 Ga0501079_1063015 Ga0501079_1063015_260_598 112
331 3300049743 Ga0501081_0295562 Ga0501081_0295562_838_1176 112
332 3300049743 Ga0501081_1003167 Ga0501081_1003167_118_456 112
333 3300049759 Ga0501262_061761 Ga0501262_061761_229_567 112
334 3300049822 Ga0501035_0785473 Ga0501035_0785473_70_408 112
335 3300049824 Ga0501045_0557302 Ga0501045_0557302_183_521 112
336 3300050508 nmdc:mga09592_787868_c1 nmdc:mga09592_787868_c1_320_658 112
337 3300050509 nmdc:mga0qj67_62133_c1 nmdc:mga0qj67_62133_c1_1707_2057 112
338 3300050510 nmdc:mga06r32_2946_c1 nmdc:mga06r32_2946_c1_13862_14212 112
339 3300050512 nmdc:mga0n895_452121_c1 nmdc:mga0n895_452121_c1_567_905 112
340 3300050514 nmdc:mga08x19_420790_c1 nmdc:mga08x19_420790_c1_590_928 112
341 3300005330 Ga0070690_100965893 Ga0070690_1009658931 113
342 3300005336 Ga0070680_101028649 Ga0070680_1010286492 113
343 3300005337 Ga0070682_100254066 Ga0070682_1002540662 113
344 3300005341 Ga0070691_10506471 Ga0070691_105064711 113
345 3300005366 Ga0070659_101077493 Ga0070659_1010774932 113
346 3300005440 Ga0070705_100163741 Ga0070705_1001637412 113
347 3300005445 Ga0070708_102016726 Ga0070708_1020167261 113
348 3300005455 Ga0070663_100280431 Ga0070663_1002804312 113
349 3300005456 Ga0070678_100857623 Ga0070678_1008576232 113
350 3300005458 Ga0070681_10224415 Ga0070681_102244152 113
351 3300005530 Ga0070679_100411145 Ga0070679_1004111452 113
352 3300005539 Ga0068853_100247780 Ga0068853_1002477802 113
353 3300005546 Ga0070696_100076537 Ga0070696_1000765373 113
354 3300005547 Ga0070693_101611325 Ga0070693_1016113251 113
355 3300005578 Ga0068854_100222897 Ga0068854_1002228974 113
356 3300005615 Ga0070702_100148108 Ga0070702_1001481083 113
357 3300005615 Ga0070702_101208883 Ga0070702_1012088832 113
358 3300005616 Ga0068852_101243505 Ga0068852_1012435051 113
359 3300005617 Ga0068859_101339601 Ga0068859_1013396012 113
360 3300005718 Ga0068866_10282113 Ga0068866_102821132 113
361 3300006852 Ga0075433_11000036 Ga0075433_110000362 113
362 3300006931 Ga0097620_101339044 Ga0097620_1013390442 113
363 3300009176 Ga0105242_12168473 Ga0105242_121684731 113
364 3300025899 Ga0207642_10216600 Ga0207642_102166002 113
365 3300025912 Ga0207707_10172657 Ga0207707_101726574 113
366 3300025917 Ga0207660_10378650 Ga0207660_103786502 113
367 3300025919 Ga0207657_10810063 Ga0207657_108100632 113
368 3300025924 Ga0207694_11423879 Ga0207694_114238791 113
369 3300025932 Ga0207690_10756050 Ga0207690_107560502 113
370 3300025934 Ga0207686_10979786 Ga0207686_109797861 113
371 3300025944 Ga0207661_10383371 Ga0207661_103833712 113
372 3300026041 Ga0207639_10956457 Ga0207639_109564572 113
373 3300026075 Ga0207708_10125851 Ga0207708_101258514 113
374 3300026089 Ga0207648_10299382 Ga0207648_102993822 113
375 3300026121 Ga0207683_10862815 Ga0207683_108628152 113
376 3300026142 Ga0207698_10487671 Ga0207698_104876712 113
377 3300027876 Ga0209974_10020070 Ga0209974_100200703 113
378 3300027907 Ga0207428_10599411 Ga0207428_105994112 113
379 3300031548 Ga0307408_100013303 Ga0307408_1000133032 113
380 3300031731 Ga0307405_10096267 Ga0307405_100962672 113
381 3300031824 Ga0307413_10003475 Ga0307413_100034754 113
382 3300031824 Ga0307413_10141251 Ga0307413_101412513 113
383 3300031852 Ga0307410_10000197 Ga0307410_100001977 113
384 3300031852 Ga0307410_10352108 Ga0307410_103521082 113
385 3300031852 Ga0307410_10512543 Ga0307410_105125431 113
386 3300031901 Ga0307406_10055365 Ga0307406_100553652 113
387 3300031903 Ga0307407_10004864 Ga0307407_100048646 113
388 3300031903 Ga0307407_10213586 Ga0307407_102135861 113
389 3300031911 Ga0307412_10088651 Ga0307412_100886513 113
390 3300031911 Ga0307412_10763125 Ga0307412_107631251 113
391 3300031995 Ga0307409_100000684 Ga0307409_1000006841 113
392 3300031995 Ga0307409_100031266 Ga0307409_1000312663 113
393 3300031995 Ga0307409_100585256 Ga0307409_1005852562 113
394 3300032002 Ga0307416_100000627 Ga0307416_10000062716 113
395 3300032002 Ga0307416_100009337 Ga0307416_1000093375 113
396 3300032002 Ga0307416_101998468 Ga0307416_1019984681 113
397 3300032004 Ga0307414_10012618 Ga0307414_100126185 113
398 3300032004 Ga0307414_10087816 Ga0307414_100878163 113
399 3300032005 Ga0307411_10001169 Ga0307411_100011697 113
400 3300032005 Ga0307411_10010744 Ga0307411_100107442 113
401 3300032126 Ga0307415_100000340 Ga0307415_1000003402 113
402 3300032126 Ga0307415_100034728 Ga0307415_1000347283 113
403 3300032126 Ga0307415_100133662 Ga0307415_1001336623 113
404 3300034818 Ga0373950_0027011 Ga0373950_0027011_123_464 113
405 3300035115 Ga0373941_0056510 Ga0373941_0056510_583_924 113
406 3300035242 Ga0373962_0101828 Ga0373962_0101828_134_475 113
407 3300035691 Ga0373931_0067652 Ga0373931_0067652_1527_1868 113
408 3300037418 Ga0395900_1544106 Ga0395900_1544106_88_429 113
409 3300038443 Ga0395901_1436537 Ga0395901_1436537_98_439 113
410 3300038698 Ga0242419_007322 Ga0242419_007322_337_678 113
411 3300038996 Ga0242420_007453 Ga0242420_007453_324_665 113
412 3300042438 Ga0439459_0061961 Ga0439459_0061961_158_499 113
413 3300048912 Ga0496109_0011909 Ga0496109_0011909_1983_2324 113
414 3300048914 Ga0496111_0005561 Ga0496111_0005561_199_540 113
415 3300048915 Ga0496112_0012360 Ga0496112_0012360_5510_5851 113
416 3300048916 Ga0496113_0000810 Ga0496113_0000810_8020_8361 113
417 3300049514 Ga0501291_040718 Ga0501291_040718_208_549 113
418 3300049515 Ga0501292_118445 Ga0501292_118445_44_385 113
419 3300049520 Ga0501297_012395 Ga0501297_012395_114_455 113
420 3300049521 Ga0501298_002931 Ga0501298_002931_2056_2397 113
421 3300049522 Ga0501299_060001 Ga0501299_060001_345_686 113
422 3300049583 Ga0501067_0008708 Ga0501067_0008708_181_522 113
423 3300049585 Ga0501069_0066741 Ga0501069_0066741_299_640 113
424 3300049585 Ga0501069_0310492 Ga0501069_0310492_394_735 113
425 3300049655 Ga0501208_133004 Ga0501208_133004_39_380 113
426 3300049656 Ga0501209_000383 Ga0501209_000383_2803_3144 113
427 3300049658 Ga0501211_017640 Ga0501211_017640_324_665 113
428 3300049659 Ga0501214_000874 Ga0501214_000874_960_1301 113
429 3300049661 Ga0501217_005169 Ga0501217_005169_1428_1769 113
430 3300049663 Ga0501223_027155 Ga0501223_027155_495_836 113
431 3300049666 Ga0501228_042510 Ga0501228_042510_169_510 113
432 3300049667 Ga0501230_086422 Ga0501230_086422_70_411 113
433 3300049669 Ga0501235_009347 Ga0501235_009347_1338_1679 113
434 3300049672 Ga0501239_009460 Ga0501239_009460_529_870 113
435 3300049675 Ga0501243_042956 Ga0501243_042956_27_368 113
436 3300049677 Ga0501247_000081 Ga0501247_000081_3596_3937 113
437 3300049678 Ga0501248_004469 Ga0501248_004469_681_1022 113
438 3300049679 Ga0501249_003437 Ga0501249_003437_141_482 113
439 3300049679 Ga0501249_037825 Ga0501249_037825_672_1013 113
440 3300049687 Ga0501258_015632 Ga0501258_015632_286_627 113
441 3300049688 Ga0501259_021258 Ga0501259_021258_192_533 113
442 3300049704 Ga0501221_001100 Ga0501221_001100_1290_1631 113
443 3300049705 Ga0501225_0003693 Ga0501225_0003693_3560_3901 113
444 3300049706 Ga0501229_026575 Ga0501229_026575_308_649 113
445 3300049708 Ga0501245_008780 Ga0501245_008780_598_939 113
446 3300049757 Ga0501232_025288 Ga0501232_025288_218_559 113
447 3300049760 Ga0501263_000924 Ga0501263_000924_859_1200 113
448 3300049765 Ga0501268_000867 Ga0501268_000867_810_1151 113
449 3300049779 Ga0501283_004070 Ga0501283_004070_482_823 113
450 3300049850 Ga0501204_003629 Ga0501204_003629_538_879 113
451 3300050514 nmdc:mga08x19_27931_c1 nmdc:mga08x19_27931_c1_2693_3034 113
452 3300053078 Ga0495612_0360793 Ga0495612_0360793_231_572 113
453 3300061734 Ga0530510_0512143 Ga0530510_0512143_308_649 113
454 3300005518 Ga0070699_100711297 Ga0070699_1007112972 114
455 3300009098 Ga0105245_10606438 Ga0105245_106064382 115
456 3300009147 Ga0114129_10000461 Ga0114129_1000046149 115
457 3300009148 Ga0105243_10752969 Ga0105243_107529692 115
458 3300009176 Ga0105242_10147117 Ga0105242_101471172 115
459 3300009553 Ga0105249_10659365 Ga0105249_106593652 115
460 3300010375 Ga0105239_12466405 Ga0105239_124664052 115
461 3300013306 Ga0163162_11601925 Ga0163162_116019251 115
462 3300013307 Ga0157372_11062168 Ga0157372_110621681 115
463 3300013308 Ga0157375_12980559 Ga0157375_129805591 115
464 3300014326 Ga0157380_12880517 Ga0157380_128805171 115
465 3300042012 Ga0439455_0014514 Ga0439455_0014514_911_1258 115
466 3300044842 Ga0466957_0389253 Ga0466957_0389253_96_443 115
467 3300045976 Ga0466967_1788657 Ga0466967_1788657_139_486 115
468 3300048906 Ga0496103_0407032 Ga0496103_0407032_420_767 115
469 3300048909 Ga0496106_0602440 Ga0496106_0602440_258_605 115
470 3300049576 Ga0501040_1122703 Ga0501040_1122703_112_459 115
471 3300049677 Ga0501247_045081 Ga0501247_045081_129_476 115
472 3300049679 Ga0501249_150460 Ga0501249_150460_154_501 115
473 3300049683 Ga0501253_022437 Ga0501253_022437_528_875 115
474 3300049707 Ga0501234_043044 Ga0501234_043044_45_392 115
475 3300049741 Ga0501079_0010843 Ga0501079_0010843_1504_1851 115
476 3300049743 Ga0501081_0123833 Ga0501081_0123833_155_502 115
477 3300049744 Ga0501083_0766148 Ga0501083_0766148_207_554 115
478 3300049773 Ga0501276_008999 Ga0501276_008999_274_621 115
479 3300049779 Ga0501283_028885 Ga0501283_028885_222_569 115
480 3300049850 Ga0501204_073623 Ga0501204_073623_164_511 115
481 3300060353 Ga0501082_0182200 Ga0501082_0182200_1193_1540 115
482 2162886012 MBSR1b_contig_4742051 MBSR1b_0402.00006470 116
483 3300005293 Ga0065715_10010100 Ga0065715_100101003 116
484 3300005293 Ga0065715_10255232 Ga0065715_102552322 116
485 3300005330 Ga0070690_100034372 Ga0070690_1000343722 116
486 3300005347 Ga0070668_101064042 Ga0070668_1010640421 116
487 3300005366 Ga0070659_101069219 Ga0070659_1010692192 116
488 3300005440 Ga0070705_100108939 Ga0070705_1001089391 116
489 3300005444 Ga0070694_100133889 Ga0070694_1001338893 116
490 3300005457 Ga0070662_100489014 Ga0070662_1004890141 116
491 3300005536 Ga0070697_101594364 Ga0070697_1015943642 116
492 3300005545 Ga0070695_100053517 Ga0070695_1000535171 116
493 3300005549 Ga0070704_100006869 Ga0070704_1000068694 116
494 3300005615 Ga0070702_100090661 Ga0070702_1000906612 116
495 3300005617 Ga0068859_100049602 Ga0068859_1000496024 116
496 3300005618 Ga0068864_101356884 Ga0068864_1013568842 116
497 3300005718 Ga0068866_10739080 Ga0068866_107390802 116
498 3300005719 Ga0068861_100594797 Ga0068861_1005947972 116
499 3300006852 Ga0075433_10694274 Ga0075433_106942742 116
500 3300006881 Ga0068865_100395853 Ga0068865_1003958533 116
501 3300006931 Ga0097620_100049602 Ga0097620_1000496024 116
502 3300007076 Ga0075435_100437488 Ga0075435_1004374882 116
503 3300009147 Ga0114129_10469381 Ga0114129_104693812 116
504 3300009147 Ga0114129_10651154 Ga0114129_106511542 116
505 3300010375 Ga0105239_10023621 Ga0105239_100236214 116
506 3300013306 Ga0163162_10701581 Ga0163162_107015812 116
507 3300025933 Ga0207706_10670251 Ga0207706_106702512 116
508 3300025938 Ga0207704_10204866 Ga0207704_102048662 116
509 3300026089 Ga0207648_10307842 Ga0207648_103078422 116
510 3300026118 Ga0207675_100616750 Ga0207675_1006167502 116
511 3300035691 Ga0373931_0028128 Ga0373931_0028128_683_1033 116
512 3300048903 Ga0496100_0190307 Ga0496100_0190307_710_1060 116
513 3300048904 Ga0496101_0053904 Ga0496101_0053904_2375_2725 116
514 3300048905 Ga0496102_0001806 Ga0496102_0001806_5923_6273 116
515 3300048906 Ga0496103_0053656 Ga0496103_0053656_12_362 116
516 3300048906 Ga0496103_0310355 Ga0496103_0310355_539_892 116
517 3300048907 Ga0496104_0489960 Ga0496104_0489960_618_968 116
518 3300048908 Ga0496105_0048571 Ga0496105_0048571_1850_2200 116
519 3300048909 Ga0496106_0012688 Ga0496106_0012688_5781_6131 116
520 3300048910 Ga0496107_0115294 Ga0496107_0115294_466_816 116
521 3300048911 Ga0496108_0002308 Ga0496108_0002308_2458_2808 116
522 3300048912 Ga0496109_0000573 Ga0496109_0000573_8954_9304 116
523 3300048913 Ga0496110_0000669 Ga0496110_0000669_15432_15782 116
524 3300048914 Ga0496111_0022841 Ga0496111_0022841_2072_2422 116
525 3300048915 Ga0496112_0022236 Ga0496112_0022236_636_986 116
526 3300048916 Ga0496113_0002211 Ga0496113_0002211_5064_5414 116
527 3300048918 Ga0496115_0293709 Ga0496115_0293709_19_369 116
528 3300050507 nmdc:mga05p37_1864981_c1 nmdc:mga05p37_1864981_c1_19_372 116
529 3300050507 nmdc:mga05p37_373312_c1 nmdc:mga05p37_373312_c1_858_1208 116
530 3300050514 nmdc:mga08x19_237539_c1 nmdc:mga08x19_237539_c1_208_558 116
531 3300050515 nmdc:mga0a205_86862_c2 nmdc:mga0a205_86862_c2_235_585 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

13

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8h-assembly1.cif.gz_B crystal structure of tt0351 protein from thermus thermophilus hb8 0.9203 12 111
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.9161 8 112
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9095 10 114
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8925 8 112
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8925 10 114
ID Description Score Start End Superfamily
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9203 12 111 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9095 10 114 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8925 10 114 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8552 12 111 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8403 9 114 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A2V7QCP3-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.975 8 115
AF-A0A259CJK6-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9635 11 115
AF-A0A838NK01-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9624 29 116
AF-A0A1G1H6Y1-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9603 11 114
AF-A0A315CUF7-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9589 12 114

Feature Viewer

pLDDT pTM Quality
89.2 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map