F459953

General Info

Members Datasets Scaffolds Average Seq Length
530 220 1060 168

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10216548|Ga0157380_102165483
Length 184
Sequence MTPIDSNSLDDLQDRVIHINRVAKVVKGGRRFSFSALIVVGDGKGHVGVGMGKASEVPEAIRKGNEHARKNLIKVALDGTTIPHRVDGHHGAGRVMLRPASPGTGVIAGGPVRAVVEVAGIRDILTKCIGSNNKINVVKAALDALKQLETTAQVASRRGKPLEELAQKPKQARPPRQVSTRGES

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
52 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
53 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
113 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
114 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
115 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
147 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
148 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
149 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
152 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.83
Metatranscriptomes 17.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.75
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10216548 3300014326 Bacteria 1710
2 Ga0065712_10067999 3300005290 Bacteria 17558
3 Ga0065715_10093268 3300005293 Bacteria 4741
4 Ga0065707_10092246 3300005295 Bacteria 3799
5 Ga0070683_100812937 3300005329 Bacteria 896
6 Ga0070680_100012958 3300005336 Bacteria 6484
7 Ga0070668_100024697 3300005347 Bacteria 4555
8 Ga0070668_100198408 3300005347 Bacteria 1647
9 Ga0070671_100089445 3300005355 Bacteria 2578
10 Ga0070674_100292232 3300005356 Bacteria 1296
11 Ga0070674_100465084 3300005356 Bacteria 1047
12 Ga0070673_101199859 3300005364 Bacteria 711
13 Ga0070659_100278236 3300005366 Unclassified 1392
14 Ga0070667_100934573 3300005367 Bacteria 808
15 Ga0070705_100242348 3300005440 Bacteria 1261
16 Ga0070705_100320339 3300005440 Unclassified 1119
17 Ga0070700_100433272 3300005441 Unclassified 996
18 Ga0070694_100004228 3300005444 Bacteria 8635
19 Ga0070694_101188162 3300005444 Bacteria 639
20 Ga0070708_100032939 3300005445 Bacteria 4499
21 Ga0070708_100349755 3300005445 Bacteria 1393
22 Ga0070708_100466950 3300005445 Bacteria 1191
23 Ga0070662_100026542 3300005457 Bacteria 4013
24 Ga0070681_10006740 3300005458 Bacteria 11177
25 Ga0068867_100653975 3300005459 Bacteria 922
26 Ga0070706_100166232 3300005467 Unclassified 2060
27 Ga0070707_100000343 3300005468 Bacteria 45816
28 Ga0070707_100128353 3300005468 Unclassified 2464
29 Ga0070707_100532426 3300005468 Bacteria 1137
30 Ga0070698_100121184 3300005471 Bacteria 2576
31 Ga0070698_100844324 3300005471 Bacteria 861
32 Ga0070699_100006640 3300005518 Bacteria 10060
33 Ga0070699_100038276 3300005518 Bacteria 4152
34 Ga0070699_100738466 3300005518 Bacteria 900
35 Ga0070679_100006499 3300005530 Bacteria 10898
36 Ga0070697_100006235 3300005536 Bacteria 9233
37 Ga0070697_100135737 3300005536 Bacteria 2066
38 Ga0070697_100156006 3300005536 Bacteria 1927
39 Ga0070697_101069818 3300005536 Bacteria 718
40 Ga0070672_100462451 3300005543 Bacteria 1094
41 Ga0070696_100173845 3300005546 Bacteria 1594
42 Ga0070665_101350906 3300005548 Bacteria 722
43 Ga0070664_101249658 3300005564 Bacteria 701
44 Ga0068854_101222551 3300005578 Bacteria 674
45 Ga0068861_100374512 3300005719 Bacteria 1256
46 Ga0068861_100798197 3300005719 Bacteria 886
47 Ga0068861_101247848 3300005719 Bacteria 721
48 Ga0068860_100071638 3300005843 Bacteria 3293
49 Ga0068860_100182381 3300005843 Bacteria 2029
50 Ga0068860_101084696 3300005843 Bacteria 820
51 Ga0081455_10105121 3300005937 Bacteria 2257
52 Ga0081539_10004359 3300005985 Bacteria 15776
53 Ga0070715_10153569 3300006163 Bacteria 1130
54 Ga0070715_10667899 3300006163 Bacteria 617
55 Ga0070716_100159153 3300006173 Bacteria 1461
56 Ga0075428_100003811 3300006844 Bacteria 16546
57 Ga0075428_100356296 3300006844 Bacteria 1570
58 Ga0075428_100552809 3300006844 Bacteria 1230
59 Ga0075428_101717674 3300006844 Bacteria 655
60 Ga0075430_100166185 3300006846 Bacteria 1836
61 Ga0075430_100576778 3300006846 Bacteria 928
62 Ga0075430_101024592 3300006846 Bacteria 680
63 Ga0075431_100002056 3300006847 Bacteria 19234
64 Ga0075433_10008452 3300006852 Bacteria 8215
65 Ga0075433_10142075 3300006852 Bacteria 2134
66 Ga0075433_10200595 3300006852 Bacteria 1774
67 Ga0075433_10255039 3300006852 Bacteria 1556
68 Ga0075433_10727469 3300006852 Bacteria 868
69 Ga0075434_100059817 3300006871 Bacteria 3788
70 Ga0075429_100002293 3300006880 Bacteria 16053
71 Ga0075429_100504633 3300006880 Bacteria 1060
72 Ga0068865_100791493 3300006881 Bacteria 817
73 Ga0075436_100004891 3300006914 Bacteria 9208
74 Ga0075436_100009051 3300006914 Bacteria 6814
75 Ga0075435_100079032 3300007076 Bacteria 2698
76 Ga0075435_100080749 3300007076 Bacteria 2671
77 Ga0075435_100208490 3300007076 Bacteria 1657
78 Ga0075435_100216884 3300007076 Bacteria 1624
79 Ga0075435_100473072 3300007076 Bacteria 1082
80 Ga0075435_100496157 3300007076 Bacteria 1055
81 Ga0075435_100902219 3300007076 Bacteria 771
82 Ga0111539_10044653 3300009094 Bacteria 5308
83 Ga0111539_10078466 3300009094 Bacteria 3885
84 Ga0111539_10092276 3300009094 Bacteria 3558
85 Ga0111539_10248403 3300009094 Bacteria 2072
86 Ga0105247_10340848 3300009101 Bacteria 1051
87 Ga0114129_10042483 3300009147 Bacteria 6402
88 Ga0114129_11986016 3300009147 Bacteria 704
89 Ga0105243_10028697 3300009148 Bacteria 4273
90 Ga0105242_10253796 3300009176 Unclassified 1586
91 Ga0157325_1003851 3300012485 Bacteria 852
92 Ga0157339_1001132 3300012505 Bacteria 1558
93 Ga0157324_1000720 3300012506 Unclassified 1635
94 Ga0157373_10316107 3300013100 Bacteria 1110
95 Ga0157378_10005119 3300013297 Bacteria 11510
96 Ga0157378_10775057 3300013297 Bacteria 983
97 Ga0163162_10010717 3300013306 Bacteria 8917
98 Ga0163162_12662715 3300013306 Bacteria 576
99 Ga0157375_10609560 3300013308 Bacteria 1250
100 Ga0157375_11761793 3300013308 Bacteria 734
101 Ga0163163_10641837 3300014325 Bacteria 1125
102 Ga0157379_10000101 3300014968 Bacteria 58702
103 Ga0157376_10024093 3300014969 Bacteria 4774
104 Ga0207697_10007801 3300025315 Bacteria 4739
105 Ga0207680_10163824 3300025903 Bacteria 1493
106 Ga0207685_10078303 3300025905 Bacteria 1360
107 Ga0207684_10864542 3300025910 Bacteria 762
108 Ga0207660_10190397 3300025917 Bacteria 1597
109 Ga0207652_10074157 3300025921 Bacteria 2962
110 Ga0207646_10000630 3300025922 Bacteria 45810
111 Ga0207646_10366787 3300025922 Bacteria 1301
112 Ga0207650_10379076 3300025925 Bacteria 1168
113 Ga0207659_10314834 3300025926 Bacteria 1289
114 Ga0207644_10106216 3300025931 Bacteria 2117
115 Ga0207690_10531969 3300025932 Bacteria 954
116 Ga0207706_10279313 3300025933 Bacteria 1457
117 Ga0207686_10838163 3300025934 Bacteria 739
118 Ga0207709_10592040 3300025935 Unclassified 877
119 Ga0207669_10620660 3300025937 Bacteria 881
120 Ga0207665_10026915 3300025939 Bacteria 3799
121 Ga0207665_10128469 3300025939 Unclassified 1797
122 Ga0207665_10757529 3300025939 Bacteria 766
123 Ga0207691_10170328 3300025940 Bacteria 1907
124 Ga0207679_10050778 3300025945 Bacteria 3032
125 Ga0207679_10548150 3300025945 Bacteria 1037
126 Ga0207679_11304073 3300025945 Bacteria 666
127 Ga0207668_10131291 3300025972 Bacteria 1913
128 Ga0207668_10170390 3300025972 Bacteria 1707
129 Ga0207668_10266773 3300025972 Bacteria 1398
130 Ga0207668_10579663 3300025972 Bacteria 975
131 Ga0207640_10692674 3300025981 Bacteria 873
132 Ga0207640_11107394 3300025981 Bacteria 701
133 Ga0207658_10231534 3300025986 Bacteria 1560
134 Ga0207703_10335373 3300026035 Bacteria 1388
135 Ga0207708_10151086 3300026075 Bacteria 1828
136 Ga0207708_10518253 3300026075 Bacteria 1001
137 Ga0207641_10112961 3300026088 Bacteria 2411
138 Ga0207641_10256022 3300026088 Bacteria 1637
139 Ga0207648_10836630 3300026089 Bacteria 858
140 Ga0207675_100813808 3300026118 Bacteria 948
141 Ga0209967_1017188 3300027364 Unclassified 1042
142 Ga0209982_1014642 3300027552 Bacteria 1186
143 Ga0209982_1018411 3300027552 Unclassified 1068
144 Ga0209983_1014516 3300027665 Bacteria 1624
145 Ga0209971_1003075 3300027682 Bacteria 3983
146 Ga0209974_10001539 3300027876 Bacteria 8372
147 Ga0209974_10013120 3300027876 Bacteria 2763
148 Ga0207428_10012286 3300027907 Bacteria 7527
149 Ga0268266_10626424 3300028379 Bacteria 1034
150 Ga0268266_11055797 3300028379 Bacteria 786
151 Ga0268264_10242252 3300028381 Bacteria 1671
152 Ga0265330_10006951 3300031235 Bacteria 5557
153 Ga0265330_10028979 3300031235 Bacteria 2491
154 Ga0265332_10000091 3300031238 Bacteria 79169
155 Ga0265332_10186614 3300031238 Bacteria 863
156 Ga0265328_10014751 3300031239 Bacteria 3071
157 Ga0265320_10020165 3300031240 Bacteria 3623
158 Ga0265320_10079835 3300031240 Bacteria 1528
159 Ga0265325_10010230 3300031241 Bacteria 5443
160 Ga0265325_10170899 3300031241 Bacteria 1017
161 Ga0265339_10106420 3300031249 Bacteria 1455
162 Ga0265331_10000018 3300031250 Bacteria 264804
163 Ga0265327_10001206 3300031251 Bacteria 34837
164 Ga0265327_10003993 3300031251 Bacteria 13449
165 Ga0265327_10071786 3300031251 Bacteria 1731
166 Ga0265327_10084916 3300031251 Bacteria 1555
167 Ga0265327_10182673 3300031251 Bacteria 958
168 Ga0265316_10000221 3300031344 Bacteria 66632
169 Ga0265316_10001953 3300031344 Bacteria 21664
170 Ga0265316_10025549 3300031344 Bacteria 4927
171 Ga0265316_10332654 3300031344 Bacteria 1102
172 Ga0265313_10075705 3300031595 Bacteria 1540
173 Ga0316575_10019346 3300031665 Bacteria 2603
174 Ga0316575_10041242 3300031665 Bacteria 1825
175 Ga0316575_10095669 3300031665 Bacteria 1205
176 Ga0316575_10104377 3300031665 Bacteria 1154
177 Ga0316579_10025097 3300031691 Bacteria 2689
178 Ga0316579_10026608 3300031691 Bacteria 2621
179 Ga0316579_10026781 3300031691 Bacteria 2613
180 Ga0316579_10026962 3300031691 Bacteria 2605
181 Ga0316579_10072375 3300031691 Bacteria 1635
182 Ga0316579_10097307 3300031691 Bacteria 1407
183 Ga0265314_10000116 3300031711 Bacteria 123252
184 Ga0265314_10065490 3300031711 Bacteria 2454
185 Ga0265314_10257894 3300031711 Bacteria 997
186 Ga0265342_10032765 3300031712 Bacteria 3202
187 Ga0316576_10000051 3300031727 Bacteria 36940
188 Ga0316576_10000365 3300031727 Bacteria 20446
189 Ga0316576_10000685 3300031727 Bacteria 16585
190 Ga0316576_10002450 3300031727 Bacteria 10558
191 Ga0316576_10002694 3300031727 Bacteria 10159
192 Ga0316576_10019969 3300031727 Bacteria 4599
193 Ga0316576_10050205 3300031727 Bacteria 3033
194 Ga0316576_10074137 3300031727 Bacteria 2515
195 Ga0316576_10108522 3300031727 Bacteria 2079
196 Ga0316576_10113958 3300031727 Bacteria 2028
197 Ga0316576_10149759 3300031727 Bacteria 1758
198 Ga0316576_10202304 3300031727 Bacteria 1496
199 Ga0316576_10684909 3300031727 Bacteria 744
200 Ga0316576_10790344 3300031727 Bacteria 683
201 Ga0316578_10001214 3300031728 Bacteria 10228
202 Ga0316578_10006563 3300031728 Bacteria 5757
203 Ga0316578_10014712 3300031728 Bacteria 4188
204 Ga0316578_10015694 3300031728 Bacteria 4080
205 Ga0316578_10033675 3300031728 Bacteria 2937
206 Ga0316578_10050016 3300031728 Bacteria 2444
207 Ga0316578_10060913 3300031728 Bacteria 2222
208 Ga0316578_10076685 3300031728 Bacteria 1984
209 Ga0316578_10089235 3300031728 Bacteria 1840
210 Ga0316578_10100173 3300031728 Bacteria 1736
211 Ga0316578_10117005 3300031728 Bacteria 1601
212 Ga0316578_10122295 3300031728 Bacteria 1565
213 Ga0316578_10180655 3300031728 Bacteria 1271
214 Ga0316578_10194084 3300031728 Bacteria 1223
215 Ga0316578_10205203 3300031728 Bacteria 1186
216 Ga0316577_10000967 3300031733 Bacteria 12817
217 Ga0316577_10001071 3300031733 Bacteria 12388
218 Ga0316577_10009675 3300031733 Bacteria 5190
219 Ga0316577_10014473 3300031733 Bacteria 4330
220 Ga0316577_10037572 3300031733 Bacteria 2707
221 Ga0316577_10065768 3300031733 Bacteria 2024
222 Ga0316577_10145271 3300031733 Bacteria 1336
223 Ga0316577_10378169 3300031733 Bacteria 804
224 Ga0316583_10012117 3300032133 Bacteria 3112
225 Ga0316583_10069929 3300032133 Bacteria 1228
226 Ga0316583_10102393 3300032133 Bacteria 998
227 Ga0316583_10116174 3300032133 Bacteria 933
228 Ga0316583_10135968 3300032133 Bacteria 856
229 Ga0316585_10010281 3300032137 Bacteria 2744
230 Ga0316585_10035198 3300032137 Bacteria 1585
231 Ga0316580_10000485 3300032139 Bacteria 9163
232 Ga0316580_10000991 3300032139 Bacteria 7073
233 Ga0316580_10001102 3300032139 Bacteria 6814
234 Ga0316580_10002227 3300032139 Bacteria 5295
235 Ga0316580_10006433 3300032139 Bacteria 3470
236 Ga0316580_10224025 3300032139 Bacteria 580
237 Ga0316593_10000037 3300032168 Bacteria 14308
238 Ga0316593_10000096 3300032168 Bacteria 11298
239 Ga0316593_10000164 3300032168 Bacteria 9718
240 Ga0316593_10000167 3300032168 Bacteria 9674
241 Ga0316593_10000198 3300032168 Bacteria 9333
242 Ga0316593_10000257 3300032168 Bacteria 8797
243 Ga0316593_10000459 3300032168 Bacteria 7485
244 Ga0316593_10000802 3300032168 Bacteria 6281
245 Ga0316593_10000968 3300032168 Bacteria 5933
246 Ga0316593_10001508 3300032168 Bacteria 5159
247 Ga0316593_10001816 3300032168 Bacteria 4873
248 Ga0316593_10001899 3300032168 Bacteria 4793
249 Ga0316593_10003948 3300032168 Bacteria 3748
250 Ga0316593_10004584 3300032168 Bacteria 3563
251 Ga0316593_10004621 3300032168 Bacteria 3550
252 Ga0316593_10004970 3300032168 Bacteria 3465
253 Ga0316593_10005427 3300032168 Bacteria 3361
254 Ga0316593_10005849 3300032168 Bacteria 3279
255 Ga0316593_10005855 3300032168 Bacteria 3279
256 Ga0316593_10006051 3300032168 Bacteria 3241
257 Ga0316593_10009756 3300032168 Bacteria 2725
258 Ga0316593_10011958 3300032168 Bacteria 2537
259 Ga0316593_10013932 3300032168 Bacteria 2389
260 Ga0316593_10017678 3300032168 Bacteria 2178
261 Ga0316593_10017709 3300032168 Bacteria 2176
262 Ga0316593_10019426 3300032168 Bacteria 2100
263 Ga0316593_10042258 3300032168 Bacteria 1520
264 Ga0316593_10067693 3300032168 Bacteria 1231
265 Ga0316593_10072012 3300032168 Bacteria 1196
266 Ga0316593_10084437 3300032168 Bacteria 1112
267 Ga0316593_10130115 3300032168 Bacteria 907
268 Ga0316593_10338618 3300032168 Bacteria 574
269 Ga0316593_10376507 3300032168 Bacteria 546
270 Ga0316592_1000138 3300033524 Bacteria 8013
271 Ga0316592_1000166 3300033524 Bacteria 7627
272 Ga0316592_1000599 3300033524 Bacteria 5204
273 Ga0316592_1000948 3300033524 Bacteria 4447
274 Ga0316592_1001173 3300033524 Bacteria 4133
275 Ga0316592_1001786 3300033524 Bacteria 3582
276 Ga0316592_1003194 3300033524 Bacteria 2925
277 Ga0316592_1006412 3300033524 Bacteria 2266
278 Ga0316592_1006701 3300033524 Bacteria 2228
279 Ga0316592_1016072 3300033524 Bacteria 1562
280 Ga0316592_1018314 3300033524 Bacteria 1474
281 Ga0316592_1029436 3300033524 Bacteria 1192
282 Ga0316592_1062460 3300033524 Bacteria 837
283 Ga0316586_1000062 3300033527 Bacteria 7865
284 Ga0316586_1000064 3300033527 Bacteria 7843
285 Ga0316586_1000110 3300033527 Bacteria 6130
286 Ga0316586_1000334 3300033527 Bacteria 4367
287 Ga0316586_1001253 3300033527 Bacteria 2838
288 Ga0316586_1003876 3300033527 Bacteria 2000
289 Ga0316586_1019748 3300033527 Bacteria 1103
290 Ga0316586_1025607 3300033527 Bacteria 993
291 Ga0316586_1037098 3300033527 Bacteria 849
292 Ga0316586_1050759 3300033527 Bacteria 742
293 Ga0316588_1000073 3300033528 Bacteria 8863
294 Ga0316588_1000372 3300033528 Bacteria 5863
295 Ga0316588_1001645 3300033528 Bacteria 3728
296 Ga0316588_1003250 3300033528 Bacteria 2939
297 Ga0316588_1004514 3300033528 Bacteria 2643
298 Ga0316588_1005083 3300033528 Bacteria 2537
299 Ga0316588_1010647 3300033528 Bacteria 1944
300 Ga0316588_1017361 3300033528 Bacteria 1603
301 Ga0316588_1022517 3300033528 Bacteria 1440
302 Ga0316588_1029306 3300033528 Bacteria 1287
303 Ga0316588_1076024 3300033528 Bacteria 828
304 Ga0316588_1092244 3300033528 Bacteria 755
305 Ga0316588_1119339 3300033528 Bacteria 667
306 Ga0316587_1003201 3300033529 Bacteria 2272
307 Ga0316596_1000017 3300033541 Bacteria 15063
308 Ga0316596_1000028 3300033541 Bacteria 14394
309 Ga0316596_1000073 3300033541 Bacteria 11690
310 Ga0316596_1000123 3300033541 Bacteria 10193
311 Ga0316596_1000324 3300033541 Bacteria 7741
312 Ga0316596_1000530 3300033541 Bacteria 6566
313 Ga0316596_1000650 3300033541 Bacteria 6228
314 Ga0316596_1000731 3300033541 Bacteria 5997
315 Ga0316596_1002127 3300033541 Bacteria 4184
316 Ga0316596_1003773 3300033541 Bacteria 3350
317 Ga0316596_1004056 3300033541 Bacteria 3254
318 Ga0316596_1005873 3300033541 Bacteria 2827
319 Ga0316596_1006033 3300033541 Bacteria 2799
320 Ga0316596_1025792 3300033541 Bacteria 1513
321 Ga0316596_1030267 3300033541 Bacteria 1404
322 Ga0316596_1035317 3300033541 Bacteria 1307
323 Ga0316596_1041278 3300033541 Bacteria 1212
324 Ga0316596_1067302 3300033541 Bacteria 958
325 Ga0316596_1089937 3300033541 Bacteria 827
326 Ga0316596_1092617 3300033541 Bacteria 815
327 Ga0373930_0029224 3300034816 Unclassified 1126
328 Ga0373926_0001122 3300035083 Bacteria 7940
329 Ga0373926_0123711 3300035083 Bacteria 976
330 Ga0373944_0237857 3300035089 Bacteria 669
331 Ga0373923_0077186 3300035111 Bacteria 1440
332 Ga0373932_0131613 3300035112 Unclassified 843
333 Ga0373936_0019799 3300035113 Bacteria 2610
334 Ga0373941_0097930 3300035115 Bacteria 1017
335 Ga0373941_0133403 3300035115 Bacteria 897
336 Ga0373945_0086661 3300035116 Unclassified 1207
337 Ga0373953_0058098 3300035117 Bacteria 1576
338 Ga0373954_0037699 3300035118 Bacteria 2247
339 Ga0373956_0013809 3300035119 Bacteria 3364
340 Ga0373957_0065619 3300035120 Bacteria 1413
341 Ga0373943_0016326 3300035170 Bacteria 3385
342 Ga0373943_0038493 3300035170 Bacteria 2300
343 Ga0373946_0014961 3300035171 Bacteria 2934
344 Ga0373946_0215535 3300035171 Bacteria 925
345 Ga0373962_0067166 3300035242 Bacteria 1064
346 Ga0316574_0000085 3300035398 Bacteria 26529
347 Ga0316574_0003365 3300035398 Bacteria 8235
348 Ga0316574_0041447 3300035398 Bacteria 2838
349 Ga0316574_0044745 3300035398 Bacteria 2739
350 Ga0316574_0064277 3300035398 Bacteria 2309
351 Ga0316574_0097834 3300035398 Bacteria 1876
352 Ga0316574_0231115 3300035398 Bacteria 1183
353 Ga0316574_0278571 3300035398 Bacteria 1066
354 Ga0316574_0309701 3300035398 Bacteria 1003
355 Ga0316574_0404189 3300035398 Bacteria 860
356 Ga0373924_0024199 3300035410 Bacteria 2391
357 Ga0373931_0020257 3300035691 Bacteria 3326
358 Ga0373927_0005589 3300035695 Bacteria 8642
359 Ga0373927_0030341 3300035695 Bacteria 3528
360 Ga0373927_0045346 3300035695 Bacteria 2844
361 Ga0373933_0002611 3300035724 Bacteria 10097
362 Ga0373933_0188695 3300035724 Bacteria 1316
363 Ga0373947_0011070 3300035725 Bacteria 5178
364 Ga0373937_0003223 3300036401 Bacteria 13669
365 Ga0373937_0121995 3300036401 Bacteria 2429
366 Ga0373937_0605677 3300036401 Bacteria 1040
367 Ga0316582_0001712 3300036647 Bacteria 9856
368 Ga0316582_0002224 3300036647 Bacteria 9011
369 Ga0316582_0003997 3300036647 Bacteria 7369
370 Ga0316582_0023680 3300036647 Bacteria 3663
371 Ga0316582_0029566 3300036647 Bacteria 3329
372 Ga0316582_0084010 3300036647 Bacteria 2084
373 Ga0316582_0144604 3300036647 Bacteria 1604
374 Ga0316582_0168164 3300036647 Bacteria 1487
375 Ga0316582_0209274 3300036647 Bacteria 1332
376 Ga0316584_0000010 3300036712 Bacteria 65029
377 Ga0316584_0000609 3300036712 Bacteria 19432
378 Ga0316584_0001578 3300036712 Bacteria 13834
379 Ga0316584_0002355 3300036712 Bacteria 11923
380 Ga0316584_0004833 3300036712 Bacteria 8958
381 Ga0316584_0016792 3300036712 Bacteria 5251
382 Ga0316584_0024511 3300036712 Bacteria 4415
383 Ga0316584_0024637 3300036712 Bacteria 4406
384 Ga0316584_0033780 3300036712 Bacteria 3790
385 Ga0316584_0117956 3300036712 Bacteria 1984
386 Ga0316584_0124550 3300036712 Bacteria 1925
387 Ga0316584_0163155 3300036712 Bacteria 1655
388 Ga0316584_0696980 3300036712 Bacteria 696
389 Ga0373925_0001662 3300037068 Bacteria 18731
390 Ga0373925_0048761 3300037068 Bacteria 3156
391 Ga0400484_26615 3300038725 Bacteria 15410
392 Ga0400484_28932 3300038725 Bacteria 10422
393 Ga0400484_44058 3300038725 Bacteria 9517
394 Ga0400490_07011 3300038726 Bacteria 6579
395 Ga0400490_11910 3300038726 Bacteria 15668
396 Ga0400490_15186 3300038726 Bacteria 5470
397 Ga0400490_20465 3300038726 Bacteria 4754
398 Ga0400490_21945 3300038726 Bacteria 1404
399 Ga0400485_06296 3300038735 Bacteria 1034
400 Ga0400488_44218 3300038741 Bacteria 1256
401 Ga0400483_015579 3300039062 Bacteria 1024
402 Ga0400483_035353 3300039062 Bacteria 8181
403 Ga0400483_073836 3300039062 Bacteria 21552
404 Ga0400483_094137 3300039062 Bacteria 1651
405 Ga0400483_141649 3300039062 Bacteria 8613
406 Ga0400483_153100 3300039062 Bacteria 13456
407 Ga0400483_153527 3300039062 Bacteria 3100
408 Ga0400483_205660 3300039062 Bacteria 9867
409 Ga0400489_08314 3300039093 Bacteria 1203
410 Ga0400489_88546 3300039093 Bacteria 4330
411 Ga0400487_51838 3300039110 Bacteria 3676
412 Ga0436365_1093913 3300039437 Bacteria 705
413 Ga0436365_1643703 3300039437 Bacteria 2607
414 Ga0439436_0090707 3300041404 Bacteria 851
415 Ga0439465_0246715 3300041413 Bacteria 660
416 Ga0451837_1624029 3300041494 Bacteria 1339
417 Ga0439441_008566 3300042001 Bacteria 1674
418 Ga0451577_0012592 3300042876 Bacteria 7940
419 Ga0451577_0168506 3300042876 Unclassified 1973
420 Ga0451577_0359121 3300042876 Bacteria 1321
421 Ga0453684_0044000 3300044712 Bacteria 5986
422 Ga0453684_0104297 3300044712 Bacteria 3462
423 Ga0453684_0243946 3300044712 Bacteria 2067
424 Ga0453684_0372078 3300044712 Bacteria 1606
425 Ga0453684_0589876 3300044712 Unclassified 1219
426 Ga0453684_0740097 3300044712 Bacteria 1065
427 Ga0451576_0000741 3300045051 Bacteria 65303
428 Ga0451576_0368554 3300045051 Bacteria 1505
429 Ga0495653_0345302 3300046463 Bacteria 958
430 Ga0495580_0002023 3300046472 Bacteria 17847
431 Ga0495580_0112518 3300046472 Unclassified 1890
432 Ga0495580_0120863 3300046472 Bacteria 1819
433 Ga0495664_0003262 3300046477 Bacteria 8815
434 Ga0495628_0648763 3300046516 Bacteria 750
435 Ga0495644_0243610 3300046523 Bacteria 697
436 Ga0495665_0188349 3300046531 Bacteria 1071
437 Ga0495586_0151823 3300046535 Bacteria 1303
438 Ga0495598_0063444 3300046537 Bacteria 1146
439 Ga0495622_0248514 3300046557 Bacteria 783
440 Ga0495633_0092819 3300046558 Bacteria 1403
441 Ga0495656_0047444 3300046615 Bacteria 1822
442 Ga0495659_0072680 3300046664 Bacteria 1291
443 Ga0495647_0025070 3300046681 Bacteria 2176
444 Ga0495658_0403178 3300046683 Bacteria 872
445 Ga0495613_0096514 3300046689 Bacteria 2138
446 Ga0495613_0386153 3300046689 Bacteria 957
447 Ga0495624_0025900 3300046690 Bacteria 3848
448 Ga0495604_0275307 3300047317 Bacteria 1139
449 Ga0496104_0138152 3300048907 Unclassified 2342
450 Ga0496109_0792028 3300048912 Unclassified 886
451 Ga0496110_0771170 3300048913 Unclassified 865
452 Ga0496113_0197670 3300048916 Bacteria 1598
453 Ga0501320_018094 3300049536 Bacteria 793
454 Ga0501032_0139287 3300049569 Bacteria 1598
455 Ga0501038_0013339 3300049574 Bacteria 7494
456 Ga0501040_0583670 3300049576 Bacteria 807
457 Ga0501041_0150530 3300049577 Bacteria 1453
458 Ga0501042_0215247 3300049578 Bacteria 1386
459 Ga0501043_0013103 3300049579 Bacteria 6481
460 Ga0501047_0009037 3300049581 Bacteria 9410
461 Ga0501068_0000765 3300049584 Bacteria 16541
462 Ga0501069_0004501 3300049585 Bacteria 7201
463 Ga0501070_0024552 3300049586 Bacteria 5055
464 Ga0501071_0099448 3300049587 Bacteria 2143
465 Ga0501071_0493011 3300049587 Unclassified 939
466 Ga0501071_0504238 3300049587 Bacteria 928
467 Ga0501072_0001660 3300049588 Bacteria 16588
468 Ga0501072_0700134 3300049588 Bacteria 796
469 Ga0501072_0770749 3300049588 Bacteria 754
470 Ga0501073_0011460 3300049589 Bacteria 6485
471 Ga0501074_0011881 3300049590 Bacteria 6330
472 Ga0501074_0013327 3300049590 Bacteria 5980
473 Ga0501074_0369782 3300049590 Bacteria 1017
474 Ga0501075_0135510 3300049591 Bacteria 1876
475 Ga0501075_0764292 3300049591 Bacteria 735
476 Ga0501076_0007762 3300049592 Bacteria 7820
477 Ga0501076_0035031 3300049592 Bacteria 3927
478 Ga0501076_0706471 3300049592 Bacteria 832
479 Ga0501077_0112419 3300049593 Bacteria 1726
480 Ga0501077_0821305 3300049593 Bacteria 598
481 Ga0501079_0002810 3300049741 Bacteria 12693
482 Ga0501079_0025024 3300049741 Bacteria 4580
483 Ga0501080_0313058 3300049742 Bacteria 1422
484 Ga0501080_0344124 3300049742 Bacteria 1347
485 Ga0501080_0941208 3300049742 Bacteria 751
486 Ga0501080_1073107 3300049742 Unclassified 696
487 Ga0501081_0001972 3300049743 Bacteria 12777
488 Ga0501081_0223707 3300049743 Bacteria 1369
489 Ga0501081_0245762 3300049743 Bacteria 1305
490 Ga0501083_0040213 3300049744 Bacteria 3174
491 Ga0501044_0009740 3300049823 Bacteria 10452
492 nmdc:mga05p37_26429_c1 3300050507 Bacteria 7061
493 nmdc:mga05p37_78735_c1 3300050507 Bacteria 4059
494 nmdc:mga05p37_8433_c1 3300050507 Bacteria 12188
495 nmdc:mga09592_10768_c1 3300050508 Bacteria 7435
496 nmdc:mga0qj67_1122310_c1 3300050509 Bacteria 614
497 nmdc:mga06r32_1408344_c1 3300050510 Bacteria 639
498 nmdc:mga06r32_250417_c1 3300050510 Bacteria 1759
499 nmdc:mga06r32_38783_c1 3300050510 Bacteria 4517
500 nmdc:mga08y16_14411_c1 3300050511 Bacteria 8318
501 nmdc:mga08y16_145369_c1 3300050511 Bacteria 2465
502 nmdc:mga08y16_199940_c1 3300050511 Bacteria 2071
503 nmdc:mga08y16_71872_c1 3300050511 Bacteria 3605
504 nmdc:mga0n895_40437_c1 3300050512 Bacteria 4529
505 nmdc:mga0rr50_17888_c1 3300050513 Bacteria 4747
506 nmdc:mga0rr50_188959_c1 3300050513 Bacteria 1687
507 nmdc:mga0rr50_319332_c1 3300050513 Bacteria 1302
508 nmdc:mga0rr50_368812_c1 3300050513 Bacteria 1209
509 nmdc:mga0rr50_57775_c1 3300050513 Bacteria 2904
510 nmdc:mga08x19_14964_c1 3300050514 Bacteria 4711
511 nmdc:mga08x19_420287_c1 3300050514 Bacteria 939
512 nmdc:mga08x19_45552_c1 3300050514 Bacteria 2803
513 nmdc:mga0a205_1252133_c1 3300050515 Bacteria 590
514 nmdc:mga0a205_156539_c1 3300050515 Bacteria 2177
515 nmdc:mga0a205_5525_c2 3300050515 Bacteria 8852
516 nmdc:mga0a205_553_c1 3300050515 Bacteria 29648
517 nmdc:mga0a205_650936_c1 3300050515 Bacteria 905
518 Ga0500594_0042407 3300053118 Bacteria 1251
519 Ga0501084_0001929 3300054114 Bacteria 16542
520 Ga0501084_0264168 3300054114 Bacteria 1453
521 Ga0590071_004029 3300059421 Bacteria 3587
522 Ga0590074_043044 3300059423 Bacteria 816
523 Ga0590075_022744 3300059424 Bacteria 1570
524 Ga0501082_0005249 3300060353 Bacteria 11260
525 Ga0501082_0088312 3300060353 Bacteria 2675
526 Ga0501082_0661392 3300060353 Bacteria 914
527 Ga0501082_0757749 3300060353 Bacteria 850
528 Ga0501082_1274327 3300060353 Bacteria 642
529 Ga0530510_0068465 3300061734 Bacteria 2575
530 Ga0530510_0824979 3300061734 Bacteria 708
531 Ga0157380_10216548
532 Ga0065712_10067999
533 Ga0065715_10093268
534 Ga0065707_10092246
535 Ga0070683_100812937
536 Ga0070680_100012958
537 Ga0070668_100024697
538 Ga0070668_100198408
539 Ga0070671_100089445
540 Ga0070674_100292232
541 Ga0070674_100465084
542 Ga0070673_101199859
543 Ga0070659_100278236
544 Ga0070667_100934573
545 Ga0070705_100242348
546 Ga0070705_100320339
547 Ga0070700_100433272
548 Ga0070694_100004228
549 Ga0070694_101188162
550 Ga0070708_100032939
551 Ga0070708_100349755
552 Ga0070708_100466950
553 Ga0070662_100026542
554 Ga0070681_10006740
555 Ga0068867_100653975
556 Ga0070706_100166232
557 Ga0070707_100000343
558 Ga0070707_100128353
559 Ga0070707_100532426
560 Ga0070698_100121184
561 Ga0070698_100844324
562 Ga0070699_100006640
563 Ga0070699_100038276
564 Ga0070699_100738466
565 Ga0070679_100006499
566 Ga0070697_100006235
567 Ga0070697_100135737
568 Ga0070697_100156006
569 Ga0070697_101069818
570 Ga0070672_100462451
571 Ga0070696_100173845
572 Ga0070665_101350906
573 Ga0070664_101249658
574 Ga0068854_101222551
575 Ga0068861_100374512
576 Ga0068861_100798197
577 Ga0068861_101247848
578 Ga0068860_100071638
579 Ga0068860_100182381
580 Ga0068860_101084696
581 Ga0081455_10105121
582 Ga0081539_10004359
583 Ga0070715_10153569
584 Ga0070715_10667899
585 Ga0070716_100159153
586 Ga0075428_100003811
587 Ga0075428_100356296
588 Ga0075428_100552809
589 Ga0075428_101717674
590 Ga0075430_100166185
591 Ga0075430_100576778
592 Ga0075430_101024592
593 Ga0075431_100002056
594 Ga0075433_10008452
595 Ga0075433_10142075
596 Ga0075433_10200595
597 Ga0075433_10255039
598 Ga0075433_10727469
599 Ga0075434_100059817
600 Ga0075429_100002293
601 Ga0075429_100504633
602 Ga0068865_100791493
603 Ga0075436_100004891
604 Ga0075436_100009051
605 Ga0075435_100079032
606 Ga0075435_100080749
607 Ga0075435_100208490
608 Ga0075435_100216884
609 Ga0075435_100473072
610 Ga0075435_100496157
611 Ga0075435_100902219
612 Ga0111539_10044653
613 Ga0111539_10078466
614 Ga0111539_10092276
615 Ga0111539_10248403
616 Ga0105247_10340848
617 Ga0114129_10042483
618 Ga0114129_11986016
619 Ga0105243_10028697
620 Ga0105242_10253796
621 Ga0157325_1003851
622 Ga0157339_1001132
623 Ga0157324_1000720
624 Ga0157373_10316107
625 Ga0157378_10005119
626 Ga0157378_10775057
627 Ga0163162_10010717
628 Ga0163162_12662715
629 Ga0157375_10609560
630 Ga0157375_11761793
631 Ga0163163_10641837
632 Ga0157379_10000101
633 Ga0157376_10024093
634 Ga0207697_10007801
635 Ga0207680_10163824
636 Ga0207685_10078303
637 Ga0207684_10864542
638 Ga0207660_10190397
639 Ga0207652_10074157
640 Ga0207646_10000630
641 Ga0207646_10366787
642 Ga0207650_10379076
643 Ga0207659_10314834
644 Ga0207644_10106216
645 Ga0207690_10531969
646 Ga0207706_10279313
647 Ga0207686_10838163
648 Ga0207709_10592040
649 Ga0207669_10620660
650 Ga0207665_10026915
651 Ga0207665_10128469
652 Ga0207665_10757529
653 Ga0207691_10170328
654 Ga0207679_10050778
655 Ga0207679_10548150
656 Ga0207679_11304073
657 Ga0207668_10131291
658 Ga0207668_10170390
659 Ga0207668_10266773
660 Ga0207668_10579663
661 Ga0207640_10692674
662 Ga0207640_11107394
663 Ga0207658_10231534
664 Ga0207703_10335373
665 Ga0207708_10151086
666 Ga0207708_10518253
667 Ga0207641_10112961
668 Ga0207641_10256022
669 Ga0207648_10836630
670 Ga0207675_100813808
671 Ga0209967_1017188
672 Ga0209982_1014642
673 Ga0209982_1018411
674 Ga0209983_1014516
675 Ga0209971_1003075
676 Ga0209974_10001539
677 Ga0209974_10013120
678 Ga0207428_10012286
679 Ga0268266_10626424
680 Ga0268266_11055797
681 Ga0268264_10242252
682 Ga0265330_10006951
683 Ga0265330_10028979
684 Ga0265332_10000091
685 Ga0265332_10186614
686 Ga0265328_10014751
687 Ga0265320_10020165
688 Ga0265320_10079835
689 Ga0265325_10010230
690 Ga0265325_10170899
691 Ga0265339_10106420
692 Ga0265331_10000018
693 Ga0265327_10001206
694 Ga0265327_10003993
695 Ga0265327_10071786
696 Ga0265327_10084916
697 Ga0265327_10182673
698 Ga0265316_10000221
699 Ga0265316_10001953
700 Ga0265316_10025549
701 Ga0265316_10332654
702 Ga0265313_10075705
703 Ga0316575_10019346
704 Ga0316575_10041242
705 Ga0316575_10095669
706 Ga0316575_10104377
707 Ga0316579_10025097
708 Ga0316579_10026608
709 Ga0316579_10026781
710 Ga0316579_10026962
711 Ga0316579_10072375
712 Ga0316579_10097307
713 Ga0265314_10000116
714 Ga0265314_10065490
715 Ga0265314_10257894
716 Ga0265342_10032765
717 Ga0316576_10000051
718 Ga0316576_10000365
719 Ga0316576_10000685
720 Ga0316576_10002450
721 Ga0316576_10002694
722 Ga0316576_10019969
723 Ga0316576_10050205
724 Ga0316576_10074137
725 Ga0316576_10108522
726 Ga0316576_10113958
727 Ga0316576_10149759
728 Ga0316576_10202304
729 Ga0316576_10684909
730 Ga0316576_10790344
731 Ga0316578_10001214
732 Ga0316578_10006563
733 Ga0316578_10014712
734 Ga0316578_10015694
735 Ga0316578_10033675
736 Ga0316578_10050016
737 Ga0316578_10060913
738 Ga0316578_10076685
739 Ga0316578_10089235
740 Ga0316578_10100173
741 Ga0316578_10117005
742 Ga0316578_10122295
743 Ga0316578_10180655
744 Ga0316578_10194084
745 Ga0316578_10205203
746 Ga0316577_10000967
747 Ga0316577_10001071
748 Ga0316577_10009675
749 Ga0316577_10014473
750 Ga0316577_10037572
751 Ga0316577_10065768
752 Ga0316577_10145271
753 Ga0316577_10378169
754 Ga0316583_10012117
755 Ga0316583_10069929
756 Ga0316583_10102393
757 Ga0316583_10116174
758 Ga0316583_10135968
759 Ga0316585_10010281
760 Ga0316585_10035198
761 Ga0316580_10000485
762 Ga0316580_10000991
763 Ga0316580_10001102
764 Ga0316580_10002227
765 Ga0316580_10006433
766 Ga0316580_10224025
767 Ga0316593_10000037
768 Ga0316593_10000096
769 Ga0316593_10000164
770 Ga0316593_10000167
771 Ga0316593_10000198
772 Ga0316593_10000257
773 Ga0316593_10000459
774 Ga0316593_10000802
775 Ga0316593_10000968
776 Ga0316593_10001508
777 Ga0316593_10001816
778 Ga0316593_10001899
779 Ga0316593_10003948
780 Ga0316593_10004584
781 Ga0316593_10004621
782 Ga0316593_10004970
783 Ga0316593_10005427
784 Ga0316593_10005849
785 Ga0316593_10005855
786 Ga0316593_10006051
787 Ga0316593_10009756
788 Ga0316593_10011958
789 Ga0316593_10013932
790 Ga0316593_10017678
791 Ga0316593_10017709
792 Ga0316593_10019426
793 Ga0316593_10042258
794 Ga0316593_10067693
795 Ga0316593_10072012
796 Ga0316593_10084437
797 Ga0316593_10130115
798 Ga0316593_10338618
799 Ga0316593_10376507
800 Ga0316592_1000138
801 Ga0316592_1000166
802 Ga0316592_1000599
803 Ga0316592_1000948
804 Ga0316592_1001173
805 Ga0316592_1001786
806 Ga0316592_1003194
807 Ga0316592_1006412
808 Ga0316592_1006701
809 Ga0316592_1016072
810 Ga0316592_1018314
811 Ga0316592_1029436
812 Ga0316592_1062460
813 Ga0316586_1000062
814 Ga0316586_1000064
815 Ga0316586_1000110
816 Ga0316586_1000334
817 Ga0316586_1001253
818 Ga0316586_1003876
819 Ga0316586_1019748
820 Ga0316586_1025607
821 Ga0316586_1037098
822 Ga0316586_1050759
823 Ga0316588_1000073
824 Ga0316588_1000372
825 Ga0316588_1001645
826 Ga0316588_1003250
827 Ga0316588_1004514
828 Ga0316588_1005083
829 Ga0316588_1010647
830 Ga0316588_1017361
831 Ga0316588_1022517
832 Ga0316588_1029306
833 Ga0316588_1076024
834 Ga0316588_1092244
835 Ga0316588_1119339
836 Ga0316587_1003201
837 Ga0316596_1000017
838 Ga0316596_1000028
839 Ga0316596_1000073
840 Ga0316596_1000123
841 Ga0316596_1000324
842 Ga0316596_1000530
843 Ga0316596_1000650
844 Ga0316596_1000731
845 Ga0316596_1002127
846 Ga0316596_1003773
847 Ga0316596_1004056
848 Ga0316596_1005873
849 Ga0316596_1006033
850 Ga0316596_1025792
851 Ga0316596_1030267
852 Ga0316596_1035317
853 Ga0316596_1041278
854 Ga0316596_1067302
855 Ga0316596_1089937
856 Ga0316596_1092617
857 Ga0373930_0029224
858 Ga0373926_0001122
859 Ga0373926_0123711
860 Ga0373944_0237857
861 Ga0373923_0077186
862 Ga0373932_0131613
863 Ga0373936_0019799
864 Ga0373941_0097930
865 Ga0373941_0133403
866 Ga0373945_0086661
867 Ga0373953_0058098
868 Ga0373954_0037699
869 Ga0373956_0013809
870 Ga0373957_0065619
871 Ga0373943_0016326
872 Ga0373943_0038493
873 Ga0373946_0014961
874 Ga0373946_0215535
875 Ga0373962_0067166
876 Ga0316574_0000085
877 Ga0316574_0003365
878 Ga0316574_0041447
879 Ga0316574_0044745
880 Ga0316574_0064277
881 Ga0316574_0097834
882 Ga0316574_0231115
883 Ga0316574_0278571
884 Ga0316574_0309701
885 Ga0316574_0404189
886 Ga0373924_0024199
887 Ga0373931_0020257
888 Ga0373927_0005589
889 Ga0373927_0030341
890 Ga0373927_0045346
891 Ga0373933_0002611
892 Ga0373933_0188695
893 Ga0373947_0011070
894 Ga0373937_0003223
895 Ga0373937_0121995
896 Ga0373937_0605677
897 Ga0316582_0001712
898 Ga0316582_0002224
899 Ga0316582_0003997
900 Ga0316582_0023680
901 Ga0316582_0029566
902 Ga0316582_0084010
903 Ga0316582_0144604
904 Ga0316582_0168164
905 Ga0316582_0209274
906 Ga0316584_0000010
907 Ga0316584_0000609
908 Ga0316584_0001578
909 Ga0316584_0002355
910 Ga0316584_0004833
911 Ga0316584_0016792
912 Ga0316584_0024511
913 Ga0316584_0024637
914 Ga0316584_0033780
915 Ga0316584_0117956
916 Ga0316584_0124550
917 Ga0316584_0163155
918 Ga0316584_0696980
919 Ga0373925_0001662
920 Ga0373925_0048761
921 Ga0400484_26615
922 Ga0400484_28932
923 Ga0400484_44058
924 Ga0400490_07011
925 Ga0400490_11910
926 Ga0400490_15186
927 Ga0400490_20465
928 Ga0400490_21945
929 Ga0400485_06296
930 Ga0400488_44218
931 Ga0400483_015579
932 Ga0400483_035353
933 Ga0400483_073836
934 Ga0400483_094137
935 Ga0400483_141649
936 Ga0400483_153100
937 Ga0400483_153527
938 Ga0400483_205660
939 Ga0400489_08314
940 Ga0400489_88546
941 Ga0400487_51838
942 Ga0436365_1093913
943 Ga0436365_1643703
944 Ga0439436_0090707
945 Ga0439465_0246715
946 Ga0451837_1624029
947 Ga0439441_008566
948 Ga0451577_0012592
949 Ga0451577_0168506
950 Ga0451577_0359121
951 Ga0453684_0044000
952 Ga0453684_0104297
953 Ga0453684_0243946
954 Ga0453684_0372078
955 Ga0453684_0589876
956 Ga0453684_0740097
957 Ga0451576_0000741
958 Ga0451576_0368554
959 Ga0495653_0345302
960 Ga0495580_0002023
961 Ga0495580_0112518
962 Ga0495580_0120863
963 Ga0495664_0003262
964 Ga0495628_0648763
965 Ga0495644_0243610
966 Ga0495665_0188349
967 Ga0495586_0151823
968 Ga0495598_0063444
969 Ga0495622_0248514
970 Ga0495633_0092819
971 Ga0495656_0047444
972 Ga0495659_0072680
973 Ga0495647_0025070
974 Ga0495658_0403178
975 Ga0495613_0096514
976 Ga0495613_0386153
977 Ga0495624_0025900
978 Ga0495604_0275307
979 Ga0496104_0138152
980 Ga0496109_0792028
981 Ga0496110_0771170
982 Ga0496113_0197670
983 Ga0501320_018094
984 Ga0501032_0139287
985 Ga0501038_0013339
986 Ga0501040_0583670
987 Ga0501041_0150530
988 Ga0501042_0215247
989 Ga0501043_0013103
990 Ga0501047_0009037
991 Ga0501068_0000765
992 Ga0501069_0004501
993 Ga0501070_0024552
994 Ga0501071_0099448
995 Ga0501071_0493011
996 Ga0501071_0504238
997 Ga0501072_0001660
998 Ga0501072_0700134
999 Ga0501072_0770749
1000 Ga0501073_0011460
1001 Ga0501074_0011881
1002 Ga0501074_0013327
1003 Ga0501074_0369782
1004 Ga0501075_0135510
1005 Ga0501075_0764292
1006 Ga0501076_0007762
1007 Ga0501076_0035031
1008 Ga0501076_0706471
1009 Ga0501077_0112419
1010 Ga0501077_0821305
1011 Ga0501079_0002810
1012 Ga0501079_0025024
1013 Ga0501080_0313058
1014 Ga0501080_0344124
1015 Ga0501080_0941208
1016 Ga0501080_1073107
1017 Ga0501081_0001972
1018 Ga0501081_0223707
1019 Ga0501081_0245762
1020 Ga0501083_0040213
1021 Ga0501044_0009740
1022 nmdc:mga05p37_26429_c1
1023 nmdc:mga05p37_78735_c1
1024 nmdc:mga05p37_8433_c1
1025 nmdc:mga09592_10768_c1
1026 nmdc:mga0qj67_1122310_c1
1027 nmdc:mga06r32_1408344_c1
1028 nmdc:mga06r32_250417_c1
1029 nmdc:mga06r32_38783_c1
1030 nmdc:mga08y16_14411_c1
1031 nmdc:mga08y16_145369_c1
1032 nmdc:mga08y16_199940_c1
1033 nmdc:mga08y16_71872_c1
1034 nmdc:mga0n895_40437_c1
1035 nmdc:mga0rr50_17888_c1
1036 nmdc:mga0rr50_188959_c1
1037 nmdc:mga0rr50_319332_c1
1038 nmdc:mga0rr50_368812_c1
1039 nmdc:mga0rr50_57775_c1
1040 nmdc:mga08x19_14964_c1
1041 nmdc:mga08x19_420287_c1
1042 nmdc:mga08x19_45552_c1
1043 nmdc:mga0a205_1252133_c1
1044 nmdc:mga0a205_156539_c1
1045 nmdc:mga0a205_5525_c2
1046 nmdc:mga0a205_553_c1
1047 nmdc:mga0a205_650936_c1
1048 Ga0500594_0042407
1049 Ga0501084_0001929
1050 Ga0501084_0264168
1051 Ga0590071_004029
1052 Ga0590074_043044
1053 Ga0590075_022744
1054 Ga0501082_0005249
1055 Ga0501082_0088312
1056 Ga0501082_0661392
1057 Ga0501082_0757749
1058 Ga0501082_1274327
1059 Ga0530510_0068465
1060 Ga0530510_0824979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

12

76

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

88

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4j-assembly1.cif.gz_e structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9784 10 144
5u4j-assembly1.cif.gz_e structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9644 10 144
5x8r-assembly1.cif.gz_e structure of the 30s small subunit of chloroplast ribosome from spinach 0.964 11 158
8cvo-assembly1.cif.gz_E cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map 0.9567 10 72
7pzy-assembly1.cif.gz_D structure of the vacant candida albicans 80s ribosome 0.9544 10 144
ID Description Score Start End Superfamily
af_P54045_5_110_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9971 10 72 3.30.160.20
af_A0A146M1R1_669_734_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9953 10 70 3.30.160.20
af_Q25815_90_159_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9821 11 72 3.30.160.20
af_P93014_138_208_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9775 11 72 3.30.160.20
af_Q10234_225_286_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9747 12 72 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A2V8SB02-F1-model_v4 Small ribosomal subunit protein uS5 (30S ribosomal protein S5) 0.9872 1 150 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7J9YXM3-F1-model_v4 Small ribosomal subunit protein uS5 (30S ribosomal protein S5) 0.983 2 147 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A535U441-F1-model_v4 Small ribosomal subunit protein uS5 0.9829 1 146 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2H0PLS4-F1-model_v4 Small ribosomal subunit protein uS5 0.9794 9 159 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A4Q3NRS5-F1-model_v4 deleted 0.9785 10 148

Map