F459446

General Info

Members Datasets Scaffolds Average Seq Length
526 298 522 220

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0260721|Ga0466969_0260721_26_763
Length 245
Sequence MKEAVMAIVLVGRKAGMTRVFTDAGETVPCTVIEVLPNRVTQVKTQEKDGYRAVQVTYGTRRPQLYSKAVAGHYAKANVAPGKALVEFRLAPTDKAEVAAGAELKVDLFKVGQKVDVTGTTIGKGYAGGMKRHGFGGLPATHGVSVSHRSIGSIGMRQTPGRVFKGRRMSGHMGVDRVTTENLKVVEIDTARNLILIRGAVPGAEGGQVIIRPGLKAARLALRKTTAPTKSGSGPSKDPAKQGKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
3 2952252522 Salinicola sp. DM10 Isolate Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
185 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
186 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
187 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
197 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
198 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
199 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
200 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
201 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
202 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
203 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
204 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
288 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
298 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 7.98
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 5.89
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1679528 2162886007 Unclassified 4851
2 Ga0058863_11858572 3300004799 Bacteria 1229
3 Ga0058861_11936056 3300004800 Unclassified 1108
4 Ga0058861_12059673 3300004800 Bacteria 1459
5 Ga0058862_10147900 3300004803 Unclassified 1080
6 Ga0065704_10070877 3300005289 Bacteria 15122
7 Ga0070670_100542929 3300005331 Bacteria 1037
8 Ga0070666_10001446 3300005335 Bacteria 14396
9 Ga0070666_10040531 3300005335 Bacteria 3108
10 Ga0070666_10129460 3300005335 Bacteria 1753
11 Ga0070680_100006614 3300005336 Bacteria 8813
12 Ga0070680_100014132 3300005336 Bacteria 6235
13 Ga0070689_100059541 3300005340 Bacteria 2969
14 Ga0070692_10120310 3300005345 Bacteria 1464
15 Ga0070668_100332068 3300005347 Bacteria 1282
16 Ga0070669_100006485 3300005353 Bacteria 8426
17 Ga0070669_100036309 3300005353 Bacteria 3570
18 Ga0070675_100156400 3300005354 Bacteria 1957
19 Ga0070671_100003161 3300005355 Bacteria 12839
20 Ga0070671_100005400 3300005355 Bacteria 10190
21 Ga0070671_100149605 3300005355 Bacteria 1971
22 Ga0070674_100372781 3300005356 Bacteria 1159
23 Ga0070673_100077547 3300005364 Bacteria 2685
24 Ga0070673_100269144 3300005364 Bacteria 1491
25 Ga0070659_100494874 3300005366 Bacteria 1041
26 Ga0070667_100002601 3300005367 Bacteria 15672
27 Ga0070667_100014275 3300005367 Bacteria 6561
28 Ga0070667_100025221 3300005367 Bacteria 4942
29 Ga0070667_100090124 3300005367 Bacteria 2635
30 Ga0070709_10036484 3300005434 Bacteria 2995
31 Ga0070709_10131918 3300005434 Bacteria 1707
32 Ga0070714_100037919 3300005435 Bacteria 4052
33 Ga0070713_100001795 3300005436 Bacteria 13831
34 Ga0070713_100006105 3300005436 Bacteria 8311
35 Ga0070713_100834383 3300005436 Bacteria 884
36 Ga0070710_10031164 3300005437 Bacteria 2875
37 Ga0070710_10054813 3300005437 Bacteria 2250
38 Ga0070711_100460469 3300005439 Bacteria 1042
39 Ga0070700_100133180 3300005441 Bacteria 1680
40 Ga0070694_100402780 3300005444 Bacteria 1071
41 Ga0070662_100068780 3300005457 Bacteria 2604
42 Ga0070681_10001074 3300005458 Bacteria 23281
43 Ga0070681_10054348 3300005458 Bacteria 3990
44 Ga0070681_10166379 3300005458 Bacteria 2128
45 Ga0070681_10172191 3300005458 Bacteria 2087
46 Ga0068867_100025266 3300005459 Bacteria 4262
47 Ga0068867_100184337 3300005459 Bacteria 1661
48 Ga0068867_100199434 3300005459 Bacteria 1601
49 Ga0068867_100257860 3300005459 Bacteria 1420
50 Ga0070679_100240910 3300005530 Bacteria 1766
51 Ga0070684_100194565 3300005535 Bacteria 1846
52 Ga0070672_100194982 3300005543 Bacteria 1692
53 Ga0070686_100296172 3300005544 Bacteria 1198
54 Ga0070695_100002554 3300005545 Bacteria 10512
55 Ga0070665_100005442 3300005548 Bacteria 13132
56 Ga0070665_100020767 3300005548 Bacteria 6599
57 Ga0070665_100039130 3300005548 Bacteria 4769
58 Ga0070665_100056051 3300005548 Bacteria 3952
59 Ga0070665_100072878 3300005548 Bacteria 3442
60 Ga0070665_100090458 3300005548 Bacteria 3066
61 Ga0070704_100763508 3300005549 Bacteria 862
62 Ga0068855_100162407 3300005563 Bacteria 2534
63 Ga0068855_100233788 3300005563 Bacteria 2056
64 Ga0068855_100831227 3300005563 Bacteria 980
65 Ga0070664_100160685 3300005564 Bacteria 1988
66 Ga0068857_100333296 3300005577 Bacteria 1403
67 Ga0068857_100494317 3300005577 Bacteria 1147
68 Ga0068854_100369790 3300005578 Unclassified 1178
69 Ga0068856_100006458 3300005614 Bacteria 11500
70 Ga0068852_100473234 3300005616 Bacteria 1244
71 Ga0068859_100000641 3300005617 Bacteria 34946
72 Ga0068859_100094378 3300005617 Bacteria 3044
73 Ga0068859_100124584 3300005617 Bacteria 2645
74 Ga0068859_100199475 3300005617 Bacteria 2085
75 Ga0068864_100007914 3300005618 Bacteria 8759
76 Ga0068864_100076450 3300005618 Bacteria 2926
77 Ga0068866_10054670 3300005718 Bacteria 2047
78 Ga0068851_10044653 3300005834 Bacteria 2238
79 Ga0068863_100007442 3300005841 Bacteria 10714
80 Ga0068863_100074617 3300005841 Bacteria 3209
81 Ga0068863_100543284 3300005841 Bacteria 1147
82 Ga0068858_100000125 3300005842 Bacteria 79795
83 Ga0068858_100037896 3300005842 Bacteria 4471
84 Ga0068858_100186119 3300005842 Bacteria 1961
85 Ga0068858_100250658 3300005842 Bacteria 1682
86 Ga0068860_100009263 3300005843 Bacteria 9789
87 Ga0068860_100027680 3300005843 Bacteria 5458
88 Ga0068860_100038900 3300005843 Bacteria 4550
89 Ga0068860_100078629 3300005843 Bacteria 3136
90 Ga0068862_100046942 3300005844 Bacteria 3684
91 Ga0070717_10016779 3300006028 Bacteria 5684
92 Ga0070715_10004582 3300006163 Bacteria 4553
93 Ga0070716_100003910 3300006173 Bacteria 7076
94 Ga0070716_100104267 3300006173 Bacteria 1745
95 Ga0070716_100136660 3300006173 Bacteria 1557
96 Ga0070712_100001456 3300006175 Bacteria 14428
97 Ga0070712_100048988 3300006175 Bacteria 2931
98 Ga0070712_100165383 3300006175 Bacteria 1712
99 Ga0097621_100058060 3300006237 Bacteria 3166
100 Ga0097621_100380426 3300006237 Bacteria 1261
101 Ga0068871_100058952 3300006358 Bacteria 3127
102 Ga0068871_100159060 3300006358 Bacteria 1931
103 Ga0075428_100100570 3300006844 Bacteria 3152
104 Ga0068865_100001214 3300006881 Bacteria 15025
105 Ga0068865_100418722 3300006881 Bacteria 1101
106 Ga0097620_100000641 3300006931 Bacteria 34946
107 Ga0097620_100094378 3300006931 Bacteria 3044
108 Ga0097620_100124582 3300006931 Bacteria 2645
109 Ga0097620_100199474 3300006931 Bacteria 2085
110 Ga0097620_100872411 3300006931 Bacteria 985
111 Ga0099795_10036139 3300007788 Bacteria 1732
112 Ga0105240_10010598 3300009093 Bacteria 12954
113 Ga0105240_10050500 3300009093 Bacteria 5242
114 Ga0105240_10078712 3300009093 Bacteria 4059
115 Ga0105240_10090660 3300009093 Bacteria 3736
116 Ga0105240_10121093 3300009093 Bacteria 3150
117 Ga0105240_10121608 3300009093 Bacteria 3143
118 Ga0105240_10520512 3300009093 Bacteria 1320
119 Ga0105245_10002714 3300009098 Bacteria 15935
120 Ga0105245_10011368 3300009098 Bacteria 7751
121 Ga0105247_10002466 3300009101 Bacteria 12578
122 Ga0105247_10016819 3300009101 Bacteria 4385
123 Ga0105247_10410520 3300009101 Bacteria 967
124 Ga0105241_10037721 3300009174 Bacteria 3640
125 Ga0105241_10741304 3300009174 Bacteria 900
126 Ga0105242_10026778 3300009176 Bacteria 4572
127 Ga0105242_10051158 3300009176 Bacteria 3366
128 Ga0105242_10383798 3300009176 Bacteria 1307
129 Ga0105248_10003146 3300009177 Bacteria 18265
130 Ga0105248_10006447 3300009177 Bacteria 12878
131 Ga0105248_10039978 3300009177 Bacteria 5257
132 Ga0105237_10031936 3300009545 Bacteria 5332
133 Ga0105237_10181875 3300009545 Bacteria 2103
134 Ga0105237_10284030 3300009545 Bacteria 1658
135 Ga0105238_10048429 3300009551 Bacteria 4284
136 Ga0105238_10114714 3300009551 Bacteria 2673
137 Ga0105238_10232549 3300009551 Bacteria 1820
138 Ga0105238_10470562 3300009551 Bacteria 1255
139 Ga0105249_10048373 3300009553 Bacteria 3877
140 Ga0105249_10073064 3300009553 Bacteria 3172
141 Ga0105030_100588 3300009987 Bacteria 3249
142 Ga0099796_10022473 3300010159 Bacteria 1957
143 Ga0105239_10057866 3300010375 Bacteria 4252
144 Ga0105239_10101214 3300010375 Bacteria 3187
145 Ga0105239_10108235 3300010375 Bacteria 3080
146 Ga0105239_11574296 3300010375 Bacteria 760
147 Ga0157369_10015323 3300013105 Bacteria 8645
148 Ga0157369_10124992 3300013105 Bacteria 2728
149 Ga0157369_10556663 3300013105 Bacteria 1185
150 Ga0157374_10009580 3300013296 Bacteria 8319
151 Ga0157374_10024385 3300013296 Bacteria 5423
152 Ga0157374_10201081 3300013296 Bacteria 1951
153 Ga0157378_10004652 3300013297 Bacteria 12033
154 Ga0157378_10006374 3300013297 Bacteria 10319
155 Ga0163162_10006236 3300013306 Bacteria 11558
156 Ga0163162_10007547 3300013306 Bacteria 10591
157 Ga0163162_10057607 3300013306 Bacteria 3914
158 Ga0163162_10293535 3300013306 Bacteria 1757
159 Ga0163162_10823013 3300013306 Bacteria 1045
160 Ga0157372_10146281 3300013307 Bacteria 2725
161 Ga0157372_10225941 3300013307 Bacteria 2170
162 Ga0157372_10256411 3300013307 Bacteria 2030
163 Ga0157372_10667019 3300013307 Bacteria 1211
164 Ga0157375_10003225 3300013308 Bacteria 14154
165 Ga0157375_10039845 3300013308 Bacteria 4524
166 Ga0157375_10224546 3300013308 Bacteria 2037
167 Ga0157375_10362616 3300013308 Bacteria 1615
168 Ga0157375_10511845 3300013308 Bacteria 1364
169 Ga0163163_10059072 3300014325 Bacteria 3792
170 Ga0163163_10092410 3300014325 Bacteria 3041
171 Ga0157380_10032693 3300014326 Bacteria 4004
172 Ga0157380_10034739 3300014326 Bacteria 3890
173 Ga0157380_10065115 3300014326 Bacteria 2928
174 Ga0157379_10021790 3300014968 Bacteria 5677
175 Ga0157379_10041785 3300014968 Bacteria 4092
176 Ga0157379_10073756 3300014968 Bacteria 3055
177 Ga0157379_10136446 3300014968 Bacteria 2210
178 Ga0157376_10029700 3300014969 Bacteria 4357
179 Ga0157376_10093347 3300014969 Bacteria 2612
180 Ga0163161_10229375 3300017792 Bacteria 1441
181 Ga0206356_11287737 3300020070 Bacteria 988
182 Ga0206356_11866678 3300020070 Bacteria 1043
183 Ga0206355_1038196 3300020076 Bacteria 1447
184 Ga0213872_10188334 3300021361 Bacteria 889
185 Ga0213874_10062026 3300021377 Bacteria 1173
186 Ga0213871_10001968 3300021441 Bacteria 3648
187 Ga0224712_10092194 3300022467 Bacteria 1271
188 Ga0224712_10104730 3300022467 Bacteria 1205
189 Ga0224712_10115888 3300022467 Bacteria 1155
190 Ga0207692_10031480 3300025898 Bacteria 2541
191 Ga0207692_10163605 3300025898 Bacteria 1284
192 Ga0207710_10005001 3300025900 Bacteria 5741
193 Ga0207710_10011141 3300025900 Bacteria 3786
194 Ga0207680_10081154 3300025903 Bacteria 2038
195 Ga0207680_10143707 3300025903 Bacteria 1584
196 Ga0207680_10199309 3300025903 Bacteria 1363
197 Ga0207647_10089543 3300025904 Bacteria 1836
198 Ga0207685_10024333 3300025905 Bacteria 2075
199 Ga0207699_10017117 3300025906 Bacteria 3806
200 Ga0207699_10275281 3300025906 Bacteria 1168
201 Ga0207643_10067620 3300025908 Bacteria 2051
202 Ga0207643_10219438 3300025908 Bacteria 1163
203 Ga0207654_10191202 3300025911 Bacteria 1342
204 Ga0207707_10027138 3300025912 Bacteria 5007
205 Ga0207707_10032067 3300025912 Bacteria 4600
206 Ga0207707_10069599 3300025912 Bacteria 3067
207 Ga0207707_10090231 3300025912 Bacteria 2678
208 Ga0207707_10120685 3300025912 Bacteria 2292
209 Ga0207707_10294481 3300025912 Bacteria 1404
210 Ga0207695_10030776 3300025913 Bacteria 5905
211 Ga0207695_10037866 3300025913 Bacteria 5201
212 Ga0207695_10059336 3300025913 Bacteria 3968
213 Ga0207695_10087344 3300025913 Bacteria 3141
214 Ga0207671_10075016 3300025914 Bacteria 2529
215 Ga0207671_10202974 3300025914 Bacteria 1549
216 Ga0207671_10254490 3300025914 Bacteria 1381
217 Ga0207693_10000448 3300025915 Bacteria 37696
218 Ga0207693_10163089 3300025915 Bacteria 1754
219 Ga0207663_10074257 3300025916 Bacteria 2203
220 Ga0207660_10023662 3300025917 Bacteria 4151
221 Ga0207657_10427464 3300025919 Bacteria 1041
222 Ga0207652_10105226 3300025921 Bacteria 2497
223 Ga0207652_10159759 3300025921 Bacteria 2020
224 Ga0207681_10042404 3300025923 Bacteria 3039
225 Ga0207694_10173145 3300025924 Bacteria 1748
226 Ga0207694_10185946 3300025924 Bacteria 1686
227 Ga0207659_10024731 3300025926 Bacteria 4028
228 Ga0207687_10316600 3300025927 Bacteria 1262
229 Ga0207700_10078177 3300025928 Bacteria 2573
230 Ga0207664_10102147 3300025929 Bacteria 2370
231 Ga0207664_10211583 3300025929 Bacteria 1678
232 Ga0207644_10000428 3300025931 Bacteria 27319
233 Ga0207644_10022460 3300025931 Bacteria 4310
234 Ga0207706_10043777 3300025933 Bacteria 3967
235 Ga0207686_10063556 3300025934 Bacteria 2348
236 Ga0207686_10437371 3300025934 Bacteria 1004
237 Ga0207704_10004775 3300025938 Bacteria 6223
238 Ga0207704_10156059 3300025938 Bacteria 1618
239 Ga0207665_10057059 3300025939 Bacteria 2637
240 Ga0207691_10107136 3300025940 Bacteria 2488
241 Ga0207711_10002222 3300025941 Bacteria 17420
242 Ga0207711_10205483 3300025941 Bacteria 1798
243 Ga0207711_10333190 3300025941 Bacteria 1404
244 Ga0207689_10212625 3300025942 Bacteria 1598
245 Ga0207661_10114061 3300025944 Bacteria 2291
246 Ga0207667_10014085 3300025949 Bacteria 9130
247 Ga0207667_10014175 3300025949 Bacteria 9098
248 Ga0207667_10741364 3300025949 Bacteria 982
249 Ga0207651_10105994 3300025960 Bacteria 2098
250 Ga0207712_10068569 3300025961 Bacteria 2542
251 Ga0207712_10216517 3300025961 Bacteria 1529
252 Ga0207712_10821165 3300025961 Bacteria 818
253 Ga0207668_10381544 3300025972 Bacteria 1186
254 Ga0207640_10353669 3300025981 Bacteria 1181
255 Ga0207658_10000131 3300025986 Bacteria 80909
256 Ga0207658_10011254 3300025986 Bacteria 6095
257 Ga0207658_10019790 3300025986 Bacteria 4657
258 Ga0207703_10001524 3300026035 Bacteria 21042
259 Ga0207703_10105984 3300026035 Bacteria 2390
260 Ga0207703_10114419 3300026035 Bacteria 2307
261 Ga0207703_10180083 3300026035 Bacteria 1865
262 Ga0207639_10105218 3300026041 Bacteria 2289
263 Ga0207678_10034632 3300026067 Bacteria 4398
264 Ga0207678_10611247 3300026067 Bacteria 956
265 Ga0207641_10002325 3300026088 Bacteria 17632
266 Ga0207641_10043349 3300026088 Bacteria 3778
267 Ga0207641_10194858 3300026088 Bacteria 1864
268 Ga0207641_10315214 3300026088 Bacteria 1481
269 Ga0207641_10484636 3300026088 Bacteria 1199
270 Ga0207676_10061162 3300026095 Bacteria 2981
271 Ga0207674_10527105 3300026116 Bacteria 1141
272 Ga0207683_10002499 3300026121 Bacteria 16042
273 Ga0210002_1001714 3300027617 Bacteria 3127
274 Ga0210002_1009747 3300027617 Bacteria 1468
275 Ga0209983_1002487 3300027665 Bacteria 4031
276 Ga0209971_1001640 3300027682 Bacteria 5538
277 Ga0268266_10000943 3300028379 Bacteria 37110
278 Ga0268266_10011246 3300028379 Bacteria 7790
279 Ga0268266_10013564 3300028379 Bacteria 7018
280 Ga0268266_10485147 3300028379 Bacteria 1178
281 Ga0268265_10009976 3300028380 Bacteria 6411
282 Ga0268264_10000102 3300028381 Bacteria 222526
283 Ga0268264_10038276 3300028381 Bacteria 3957
284 Ga0268264_10141591 3300028381 Bacteria 2145
285 Ga0307515_10034640 3300028794 Bacteria 8252
286 Ga0307511_10000235 3300030521 Bacteria 56564
287 Ga0265763_1004784 3300030763 Bacteria 1118
288 Ga0265760_10006072 3300031090 Bacteria 3451
289 Ga0265330_10028535 3300031235 Bacteria 2514
290 Ga0265327_10000005 3300031251 Bacteria 790146
291 Ga0307513_10184273 3300031456 Bacteria 1947
292 Ga0307509_10000987 3300031507 Bacteria 48811
293 Ga0307408_100016409 3300031548 Bacteria 4943
294 Ga0316575_10014365 3300031665 Bacteria 2972
295 Ga0316579_10222058 3300031691 Bacteria 914
296 Ga0316576_10009279 3300031727 Bacteria 6342
297 Ga0316576_10022704 3300031727 Bacteria 4361
298 Ga0316576_10064356 3300031727 Bacteria 2693
299 Ga0316576_10096325 3300031727 Bacteria 2208
300 Ga0316578_10167747 3300031728 Bacteria 1323
301 Ga0316578_10324898 3300031728 Bacteria 918
302 Ga0307405_10174028 3300031731 Bacteria 1538
303 Ga0307413_10476480 3300031824 Bacteria 996
304 Ga0307406_10074342 3300031901 Bacteria 2237
305 Ga0307409_100435532 3300031995 Bacteria 1261
306 Ga0307415_100021375 3300032126 Bacteria 3975
307 Ga0316593_10000028 3300032168 Bacteria 15385
308 Ga0316593_10000325 3300032168 Bacteria 8199
309 Ga0316593_10026106 3300032168 Bacteria 1865
310 Ga0316593_10072059 3300032168 Bacteria 1196
311 Ga0316593_10090714 3300032168 Bacteria 1076
312 Ga0307510_10000006 3300033180 Bacteria 566474
313 Ga0307510_10153566 3300033180 Bacteria 1914
314 Ga0316592_1000006 3300033524 Bacteria 14706
315 Ga0316592_1001885 3300033524 Bacteria 3511
316 Ga0316592_1009411 3300033524 Bacteria 1955
317 Ga0316592_1010690 3300033524 Bacteria 1855
318 Ga0316592_1022795 3300033524 Bacteria 1341
319 Ga0316586_1000040 3300033527 Bacteria 8841
320 Ga0316586_1000370 3300033527 Bacteria 4227
321 Ga0316586_1000884 3300033527 Bacteria 3162
322 Ga0316588_1001236 3300033528 Bacteria 4108
323 Ga0316588_1031795 3300033528 Bacteria 1240
324 Ga0316587_1000021 3300033529 Bacteria 9386
325 Ga0316587_1000022 3300033529 Bacteria 9239
326 Ga0316587_1017202 3300033529 Bacteria 1210
327 Ga0316587_1020058 3300033529 Bacteria 1133
328 Ga0316596_1000016 3300033541 Bacteria 15149
329 Ga0316596_1000026 3300033541 Bacteria 14495
330 Ga0316596_1007663 3300033541 Bacteria 2556
331 Ga0316596_1008172 3300033541 Bacteria 2488
332 Ga0316596_1009566 3300033541 Bacteria 2327
333 Ga0316596_1009806 3300033541 Bacteria 2303
334 Ga0316596_1036926 3300033541 Bacteria 1278
335 Ga0316596_1062126 3300033541 Bacteria 996
336 Ga0373934_0086450 3300035086 Bacteria 1262
337 Ga0373936_0012383 3300035113 Bacteria 3244
338 Ga0373936_0113659 3300035113 Bacteria 1151
339 Ga0373945_0041920 3300035116 Bacteria 1657
340 Ga0373953_0148332 3300035117 Bacteria 1005
341 Ga0373943_0015875 3300035170 Bacteria 3426
342 Ga0373955_0011455 3300035172 Bacteria 4228
343 Ga0373955_0095895 3300035172 Bacteria 1697
344 Ga0316574_0055313 3300035398 Bacteria 2480
345 Ga0316574_0211189 3300035398 Bacteria 1245
346 Ga0373924_0229154 3300035410 Bacteria 821
347 Ga0373927_0047414 3300035695 Bacteria 2779
348 Ga0373933_0039288 3300035724 Bacteria 2784
349 Ga0373947_0161552 3300035725 Bacteria 1449
350 Ga0373937_0001807 3300036401 Bacteria 17957
351 Ga0373937_0109265 3300036401 Bacteria 2571
352 Ga0316582_0611842 3300036647 Bacteria 750
353 Ga0316584_0052488 3300036712 Bacteria 3049
354 Ga0316584_0066465 3300036712 Bacteria 2702
355 Ga0316584_0072965 3300036712 Bacteria 2572
356 Ga0316584_0138191 3300036712 Bacteria 1818
357 Ga0373925_0230527 3300037068 Bacteria 1481
358 Ga0395899_0438450 3300037312 Bacteria 858
359 Ga0395900_0684668 3300037418 Bacteria 960
360 Ga0395898_0081820 3300037466 Bacteria 3113
361 Ga0395898_0206094 3300037466 Bacteria 1876
362 Ga0395898_0631487 3300037466 Bacteria 1014
363 Ga0400490_00437 3300038726 Bacteria 17578
364 Ga0400490_39901 3300038726 Bacteria 15663
365 Ga0400491_03590 3300038727 Bacteria 1419
366 Ga0400488_58342 3300038741 Bacteria 2007
367 Ga0400487_33558 3300039110 Bacteria 1049
368 Ga0400487_66163 3300039110 Bacteria 6500
369 Ga0436365_0602380 3300039437 Bacteria 1236
370 Ga0436365_1354175 3300039437 Bacteria 1645
371 Ga0436360_0362694 3300039438 Bacteria 3842
372 Ga0436360_0561928 3300039438 Bacteria 3033
373 Ga0436360_0908003 3300039438 Bacteria 5627
374 Ga0436361_1033248 3300039447 Bacteria 1017
375 Ga0436363_0556173 3300039450 Bacteria 5699
376 Ga0436363_1105124 3300039450 Bacteria 718
377 Ga0436362_0845588 3300039453 Bacteria 2759
378 Ga0439439_0006907 3300041406 Bacteria 2635
379 Ga0439431_0013051 3300041997 Bacteria 1914
380 Ga0439433_0013255 3300041999 Bacteria 1809
381 Ga0439441_025217 3300042001 Bacteria 1121
382 Ga0450920_008609 3300042122 Bacteria 1868
383 Ga0450921_002224 3300042123 Bacteria 1269
384 Ga0450923_007844 3300042125 Bacteria 1819
385 Ga0450923_007882 3300042125 Bacteria 1816
386 Ga0450895_000997 3300042132 Bacteria 1855
387 Ga0450896_000981 3300042133 Bacteria 3318
388 Ga0450898_009537 3300042134 Bacteria 1555
389 Ga0450899_009972 3300042135 Bacteria 1050
390 Ga0450910_002509 3300042147 Bacteria 2411
391 Ga0439446_0010521 3300042156 Bacteria 2493
392 Ga0450908_001700 3300042184 Bacteria 4283
393 Ga0439434_0055903 3300042435 Bacteria 1229
394 Ga0439435_0006321 3300042436 Bacteria 2657
395 Ga0439460_0001652 3300042461 Bacteria 5282
396 Ga0450893_0017941 3300042532 Bacteria 1204
397 Ga0451577_0008152 3300042876 Bacteria 10217
398 Ga0466969_0002476 3300044656 Bacteria 9861
399 Ga0466969_0260721 3300044656 Bacteria 785
400 Ga0453683_0005334 3300044673 Bacteria 8982
401 Ga0466966_0002570 3300044684 Bacteria 11886
402 Ga0466966_0220128 3300044684 Bacteria 1146
403 Ga0466961_0016727 3300044693 Bacteria 4715
404 Ga0466964_0012273 3300044706 Bacteria 3242
405 Ga0453684_0043943 3300044712 Bacteria 5991
406 Ga0466968_0152700 3300044735 Bacteria 1062
407 Ga0466970_0018566 3300044765 Bacteria 3601
408 Ga0466957_0007884 3300044842 Bacteria 6039
409 Ga0466959_0002822 3300045049 Bacteria 11197
410 Ga0466959_0022213 3300045049 Bacteria 4687
411 Ga0466959_0182791 3300045049 Bacteria 1466
412 Ga0466959_0362466 3300045049 Bacteria 987
413 Ga0451576_0098246 3300045051 Bacteria 3045
414 Ga0466958_0177421 3300045836 Bacteria 1351
415 Ga0495580_0141191 3300046472 Bacteria 1669
416 Ga0495580_0167561 3300046472 Bacteria 1519
417 Ga0495580_0649999 3300046472 Bacteria 693
418 Ga0495664_0240740 3300046477 Bacteria 1095
419 Ga0495606_0042851 3300046507 Bacteria 3024
420 Ga0495630_0026241 3300046517 Bacteria 4312
421 Ga0495643_0158616 3300046522 Bacteria 1115
422 Ga0495666_0184389 3300046526 Bacteria 963
423 Ga0495587_0019207 3300046536 Bacteria 4234
424 Ga0495621_0104182 3300046539 Bacteria 1082
425 Ga0495645_0410584 3300046543 Bacteria 861
426 Ga0495657_0150741 3300046675 Bacteria 1444
427 Ga0495599_0121138 3300046678 Bacteria 1626
428 Ga0495623_0050975 3300046679 Bacteria 2620
429 Ga0495649_0197017 3300046694 Bacteria 1047
430 Ga0495687_052847 3300047443 Bacteria 1715
431 Ga0495681_0028694 3300047470 Bacteria 2859
432 Ga0496100_0088239 3300048903 Bacteria 2110
433 Ga0496100_0389731 3300048903 Bacteria 1059
434 Ga0496101_0019992 3300048904 Bacteria 4579
435 Ga0496102_0009299 3300048905 Bacteria 8437
436 Ga0496102_0014665 3300048905 Bacteria 6813
437 Ga0496102_0053702 3300048905 Bacteria 3672
438 Ga0496102_0070282 3300048905 Bacteria 3214
439 Ga0496103_0058907 3300048906 Bacteria 2386
440 Ga0496104_0002304 3300048907 Bacteria 16478
441 Ga0496104_0381243 3300048907 Bacteria 1323
442 Ga0496105_0003469 3300048908 Bacteria 11665
443 Ga0496105_0096203 3300048908 Bacteria 2445
444 Ga0496105_0221104 3300048908 Bacteria 1542
445 Ga0496106_0028441 3300048909 Bacteria 4164
446 Ga0496106_0391327 3300048909 Bacteria 1117
447 Ga0496107_0001576 3300048910 Bacteria 14181
448 Ga0496107_0137570 3300048910 Bacteria 1805
449 Ga0496108_0002086 3300048911 Bacteria 15999
450 Ga0496108_0013190 3300048911 Bacteria 6735
451 Ga0496108_0182334 3300048911 Bacteria 1818
452 Ga0496109_0067040 3300048912 Bacteria 3287
453 Ga0496110_0011624 3300048913 Bacteria 7217
454 Ga0496110_0017578 3300048913 Bacteria 5980
455 Ga0496111_0001868 3300048914 Bacteria 12443
456 Ga0496111_0092759 3300048914 Bacteria 2213
457 Ga0496112_0070013 3300048915 Bacteria 3466
458 Ga0496112_0463120 3300048915 Bacteria 1205
459 Ga0496113_0090410 3300048916 Bacteria 2358
460 Ga0496113_0130906 3300048916 Bacteria 1969
461 Ga0496114_0042545 3300048917 Bacteria 3766
462 Ga0496114_0074247 3300048917 Bacteria 2862
463 Ga0496116_0190449 3300048919 Bacteria 1086
464 Ga0496117_0000787 3300048920 Bacteria 49745
465 Ga0496118_0000032 3300048921 Bacteria 330072
466 Ga0496119_0012506 3300048922 Bacteria 6886
467 Ga0496119_0050187 3300048922 Bacteria 2573
468 Ga0496120_0021776 3300048923 Bacteria 4042
469 Ga0496121_0028073 3300048924 Bacteria 5247
470 Ga0496121_0061867 3300048924 Bacteria 3069
471 Ga0496121_0157167 3300048924 Bacteria 1667
472 Ga0496124_0055985 3300048927 Bacteria 3329
473 Ga0496125_0001378 3300048928 Bacteria 35674
474 Ga0496125_0020647 3300048928 Bacteria 6177
475 Ga0496125_0022367 3300048928 Bacteria 5873
476 Ga0496126_0004928 3300048929 Bacteria 15582
477 Ga0496126_0011396 3300048929 Bacteria 9209
478 Ga0496126_0130504 3300048929 Bacteria 2172
479 Ga0501317_009998 3300049533 Bacteria 1125
480 Ga0501037_0219855 3300049573 Bacteria 1337
481 Ga0501038_0085350 3300049574 Bacteria 2655
482 Ga0501039_0183373 3300049575 Bacteria 1646
483 Ga0501039_0345334 3300049575 Bacteria 1169
484 Ga0501046_0201610 3300049580 Bacteria 1480
485 Ga0501067_0010361 3300049583 Bacteria 5158
486 Ga0501068_0071871 3300049584 Bacteria 2112
487 Ga0501071_0118123 3300049587 Bacteria 1964
488 Ga0501072_0006368 3300049588 Bacteria 8989
489 Ga0501073_0152302 3300049589 Bacteria 1602
490 Ga0501074_0073803 3300049590 Bacteria 2450
491 Ga0501076_0153543 3300049592 Bacteria 1873
492 Ga0501076_0256165 3300049592 Bacteria 1432
493 Ga0501077_0031057 3300049593 Bacteria 3398
494 Ga0501077_0060020 3300049593 Bacteria 2414
495 Ga0501079_0027935 3300049741 Bacteria 4327
496 Ga0501079_0153094 3300049741 Bacteria 1797
497 Ga0501079_0276651 3300049741 Bacteria 1312
498 Ga0501080_0022485 3300049742 Bacteria 5841
499 Ga0501080_0032199 3300049742 Bacteria 4888
500 Ga0501083_0114597 3300049744 Bacteria 1770
501 Ga0501083_0133691 3300049744 Bacteria 1626
502 Ga0501035_0798344 3300049822 Bacteria 754
503 Ga0501045_0069991 3300049824 Bacteria 2580
504 nmdc:mga0qj67_204738_c1 3300050509 Bacteria 1603
505 nmdc:mga08y16_52691_c1 3300050511 Bacteria 4257
506 nmdc:mga08x19_67683_c1 3300050514 Bacteria 2323
507 Ga0495612_0122898 3300053078 Bacteria 1117
508 Ga0495619_0241771 3300053085 Bacteria 1251
509 Ga0500556_0000700 3300053104 Bacteria 20573
510 Ga0500591_052893 3300053115 Bacteria 1899
511 Ga0500614_084529 3300053123 Bacteria 893
512 Ga0500622_0035350 3300053156 Bacteria 2615
513 Ga0500636_0255292 3300053177 Bacteria 891
514 Ga0500637_0004292 3300053178 Bacteria 6744
515 Ga0500637_0057154 3300053178 Bacteria 2230
516 Ga0501084_0011273 3300054114 Bacteria 7399
517 Ga0501084_0240788 3300054114 Bacteria 1527
518 Ga0587084_005426 3300059477 Bacteria 1510
519 Ga0587111_0008813 3300060346 Bacteria 1683
520 Ga0501082_0035746 3300060353 Bacteria 4281
521 Ga0501082_0037651 3300060353 Bacteria 4171
522 Ga0466962_0001207 3300061719 Bacteria 11873

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0241771 Ga0495619_0241771_440_1156 172
2 3300039437 Ga0436365_1354175 Ga0436365_1354175_662_1384 177
3 3300039453 Ga0436362_0845588 Ga0436362_0845588_445_1167 177
4 3300050509 nmdc:mga0qj67_204738_c1 nmdc:mga0qj67_204738_c1_568_1212 178
5 3300048907 Ga0496104_0002304 Ga0496104_0002304_14987_15703 179
6 3300048908 Ga0496105_0096203 Ga0496105_0096203_755_1471 179
7 3300048911 Ga0496108_0013190 Ga0496108_0013190_776_1492 179
8 3300048913 Ga0496110_0011624 Ga0496110_0011624_5754_6470 179
9 3300048914 Ga0496111_0001868 Ga0496111_0001868_3821_4537 179
10 3300048917 Ga0496114_0042545 Ga0496114_0042545_2780_3496 179
11 3300021361 Ga0213872_10188334 Ga0213872_101883341 182
12 3300039438 Ga0436360_0362694 Ga0436360_0362694_2587_3309 182
13 3300039447 Ga0436361_1033248 Ga0436361_1033248_68_790 182
14 3300013308 Ga0157375_10224546 Ga0157375_102245462 183
15 3300021377 Ga0213874_10062026 Ga0213874_100620262 183
16 3300039450 Ga0436363_0556173 Ga0436363_0556173_1337_2059 185
17 3300014326 Ga0157380_10032693 Ga0157380_100326933 188
18 3300049573 Ga0501037_0219855 Ga0501037_0219855_395_1075 189
19 3300049574 Ga0501038_0085350 Ga0501038_0085350_1593_2273 189
20 3300049575 Ga0501039_0345334 Ga0501039_0345334_291_971 189
21 3300049580 Ga0501046_0201610 Ga0501046_0201610_64_744 189
22 3300049584 Ga0501068_0071871 Ga0501068_0071871_910_1590 189
23 3300049587 Ga0501071_0118123 Ga0501071_0118123_765_1445 189
24 3300049588 Ga0501072_0006368 Ga0501072_0006368_597_1277 189
25 3300049592 Ga0501076_0153543 Ga0501076_0153543_642_1322 189
26 3300049741 Ga0501079_0027935 Ga0501079_0027935_3097_3777 189
27 3300049742 Ga0501080_0032199 Ga0501080_0032199_3458_4138 189
28 3300049744 Ga0501083_0114597 Ga0501083_0114597_594_1274 189
29 3300049822 Ga0501035_0798344 Ga0501035_0798344_46_726 189
30 3300049824 Ga0501045_0069991 Ga0501045_0069991_1835_2515 189
31 3300060353 Ga0501082_0035746 Ga0501082_0035746_563_1243 189
32 3300005335 Ga0070666_10040531 Ga0070666_100405312 190
33 3300005340 Ga0070689_100059541 Ga0070689_1000595414 190
34 3300005355 Ga0070671_100149605 Ga0070671_1001496053 190
35 3300005364 Ga0070673_100269144 Ga0070673_1002691442 190
36 3300005367 Ga0070667_100025221 Ga0070667_1000252213 190
37 3300005459 Ga0068867_100184337 Ga0068867_1001843371 190
38 3300005459 Ga0068867_100199434 Ga0068867_1001994342 190
39 3300005543 Ga0070672_100194982 Ga0070672_1001949823 190
40 3300005548 Ga0070665_100090458 Ga0070665_1000904583 190
41 3300005549 Ga0070704_100763508 Ga0070704_1007635081 190
42 3300005617 Ga0068859_100094378 Ga0068859_1000943783 190
43 3300005618 Ga0068864_100007914 Ga0068864_1000079143 190
44 3300005841 Ga0068863_100007442 Ga0068863_10000744221 190
45 3300005841 Ga0068863_100543284 Ga0068863_1005432841 190
46 3300005842 Ga0068858_100186119 Ga0068858_1001861193 190
47 3300005843 Ga0068860_100078629 Ga0068860_1000786293 190
48 3300006237 Ga0097621_100058060 Ga0097621_1000580603 190
49 3300006358 Ga0068871_100058952 Ga0068871_1000589523 190
50 3300006931 Ga0097620_100094378 Ga0097620_1000943783 190
51 3300009098 Ga0105245_10002714 Ga0105245_100027143 190
52 3300009176 Ga0105242_10026778 Ga0105242_100267783 190
53 3300009176 Ga0105242_10383798 Ga0105242_103837981 190
54 3300009177 Ga0105248_10006447 Ga0105248_100064473 190
55 3300013296 Ga0157374_10009580 Ga0157374_1000958016 190
56 3300013297 Ga0157378_10004652 Ga0157378_1000465224 190
57 3300013306 Ga0163162_10007547 Ga0163162_100075473 190
58 3300013308 Ga0157375_10003225 Ga0157375_100032253 190
59 3300013308 Ga0157375_10362616 Ga0157375_103626162 190
60 3300014325 Ga0163163_10059072 Ga0163163_100590724 190
61 3300014326 Ga0157380_10065115 Ga0157380_100651154 190
62 3300014969 Ga0157376_10093347 Ga0157376_100933474 190
63 3300017792 Ga0163161_10229375 Ga0163161_102293752 190
64 3300025903 Ga0207680_10143707 Ga0207680_101437072 190
65 3300025926 Ga0207659_10024731 Ga0207659_100247313 190
66 3300025934 Ga0207686_10063556 Ga0207686_100635562 190
67 3300025934 Ga0207686_10437371 Ga0207686_104373712 190
68 3300025941 Ga0207711_10002222 Ga0207711_100022223 190
69 3300025960 Ga0207651_10105994 Ga0207651_101059943 190
70 3300026088 Ga0207641_10043349 Ga0207641_100433491 190
71 3300026088 Ga0207641_10484636 Ga0207641_104846361 190
72 3300026095 Ga0207676_10061162 Ga0207676_100611623 190
73 3300028379 Ga0268266_10011246 Ga0268266_1001124617 190
74 3300031727 Ga0316576_10096325 Ga0316576_100963253 190
75 3300031728 Ga0316578_10167747 Ga0316578_101677471 190
76 3300036712 Ga0316584_0052488 Ga0316584_0052488_589_1269 190
77 3300025940 Ga0207691_10107136 Ga0207691_101071364 191
78 3300049741 Ga0501079_0276651 Ga0501079_0276651_562_1242 192
79 3300054114 Ga0501084_0240788 Ga0501084_0240788_479_1159 192
80 3300005331 Ga0070670_100542929 Ga0070670_1005429291 193
81 3300005354 Ga0070675_100156400 Ga0070675_1001564003 193
82 3300005458 Ga0070681_10166379 Ga0070681_101663792 193
83 3300005577 Ga0068857_100333296 Ga0068857_1003332962 193
84 3300014326 Ga0157380_10034739 Ga0157380_100347392 193
85 3300025942 Ga0207689_10212625 Ga0207689_102126252 193
86 3300047470 Ga0495681_0028694 Ga0495681_0028694_75_788 193
87 3300049575 Ga0501039_0183373 Ga0501039_0183373_128_808 193
88 3300005353 Ga0070669_100006485 Ga0070669_10000648515 194
89 3300005459 Ga0068867_100257860 Ga0068867_1002578602 194
90 3300042122 Ga0450920_008609 Ga0450920_008609_240_920 194
91 3300042125 Ga0450923_007882 Ga0450923_007882_1065_1745 194
92 3300042133 Ga0450896_000981 Ga0450896_000981_626_1306 194
93 3300042134 Ga0450898_009537 Ga0450898_009537_638_1318 194
94 3300042135 Ga0450899_009972 Ga0450899_009972_113_793 194
95 3300042147 Ga0450910_002509 Ga0450910_002509_1043_1723 194
96 3300042184 Ga0450908_001700 Ga0450908_001700_528_1208 194
97 3300049593 Ga0501077_0060020 Ga0501077_0060020_32_712 194
98 3300031235 Ga0265330_10028535 Ga0265330_100285352 195
99 3300035117 Ga0373953_0148332 Ga0373953_0148332_370_981 195
100 3300039438 Ga0436360_0561928 Ga0436360_0561928_712_1440 195
101 3300039450 Ga0436363_1105124 Ga0436363_1105124_46_657 195
102 3300050514 nmdc:mga08x19_67683_c1 nmdc:mga08x19_67683_c1_520_1239 195
103 3300005435 Ga0070714_100037919 Ga0070714_1000379192 196
104 3300005436 Ga0070713_100001795 Ga0070713_1000017954 196
105 3300006028 Ga0070717_10016779 Ga0070717_100167797 196
106 3300006173 Ga0070716_100003910 Ga0070716_1000039103 196
107 3300009987 Ga0105030_100588 Ga0105030_1005885 196
108 3300025906 Ga0207699_10017117 Ga0207699_100171171 196
109 3300025908 Ga0207643_10067620 Ga0207643_100676202 196
110 3300025928 Ga0207700_10078177 Ga0207700_100781772 196
111 3300025929 Ga0207664_10102147 Ga0207664_101021474 196
112 3300027617 Ga0210002_1001714 Ga0210002_10017146 196
113 3300027665 Ga0209983_1002487 Ga0209983_10024877 196
114 3300027682 Ga0209971_1001640 Ga0209971_10016403 196
115 3300028794 Ga0307515_10034640 Ga0307515_1003464016 196
116 3300031456 Ga0307513_10184273 Ga0307513_101842732 196
117 3300031548 Ga0307408_100016409 Ga0307408_1000164093 196
118 3300031731 Ga0307405_10174028 Ga0307405_101740283 196
119 3300031824 Ga0307413_10476480 Ga0307413_104764801 196
120 3300031901 Ga0307406_10074342 Ga0307406_100743423 196
121 3300031995 Ga0307409_100435532 Ga0307409_1004355322 196
122 3300032126 Ga0307415_100021375 Ga0307415_1000213753 196
123 3300041406 Ga0439439_0006907 Ga0439439_0006907_299_979 196
124 3300041997 Ga0439431_0013051 Ga0439431_0013051_217_897 196
125 3300041999 Ga0439433_0013255 Ga0439433_0013255_265_945 196
126 3300042001 Ga0439441_025217 Ga0439441_025217_188_868 196
127 3300042123 Ga0450921_002224 Ga0450921_002224_551_1231 196
128 3300042125 Ga0450923_007844 Ga0450923_007844_994_1674 196
129 3300042132 Ga0450895_000997 Ga0450895_000997_1102_1782 196
130 3300042156 Ga0439446_0010521 Ga0439446_0010521_1772_2452 196
131 3300042435 Ga0439434_0055903 Ga0439434_0055903_71_751 196
132 3300042436 Ga0439435_0006321 Ga0439435_0006321_182_862 196
133 3300042461 Ga0439460_0001652 Ga0439460_0001652_711_1391 196
134 3300042532 Ga0450893_0017941 Ga0450893_0017941_167_847 196
135 3300044656 Ga0466969_0002476 Ga0466969_0002476_8292_9014 196
136 3300048903 Ga0496100_0389731 Ga0496100_0389731_215_925 196
137 3300048910 Ga0496107_0137570 Ga0496107_0137570_849_1568 196
138 3300048915 Ga0496112_0070013 Ga0496112_0070013_2525_3235 196
139 3300048916 Ga0496113_0130906 Ga0496113_0130906_347_1057 196
140 3300049583 Ga0501067_0010361 Ga0501067_0010361_4360_5040 196
141 3300049589 Ga0501073_0152302 Ga0501073_0152302_641_1321 196
142 3300049590 Ga0501074_0073803 Ga0501074_0073803_1740_2420 196
143 3300049592 Ga0501076_0256165 Ga0501076_0256165_737_1417 196
144 3300049593 Ga0501077_0031057 Ga0501077_0031057_1206_1886 196
145 3300049741 Ga0501079_0153094 Ga0501079_0153094_15_695 196
146 3300049742 Ga0501080_0022485 Ga0501080_0022485_5075_5755 196
147 3300049744 Ga0501083_0133691 Ga0501083_0133691_741_1421 196
148 3300054114 Ga0501084_0011273 Ga0501084_0011273_69_749 196
149 3300060353 Ga0501082_0037651 Ga0501082_0037651_2851_3531 196
150 3300004799 Ga0058863_11858572 Ga0058863_118585721 197
151 3300004800 Ga0058861_12059673 Ga0058861_120596731 197
152 3300005458 Ga0070681_10001074 Ga0070681_100010744 197
153 3300005548 Ga0070665_100072878 Ga0070665_1000728784 197
154 3300006173 Ga0070716_100136660 Ga0070716_1001366602 197
155 3300006175 Ga0070712_100048988 Ga0070712_1000489885 197
156 3300009093 Ga0105240_10010598 Ga0105240_100105983 197
157 3300009093 Ga0105240_10050500 Ga0105240_100505004 197
158 3300009545 Ga0105237_10031936 Ga0105237_100319365 197
159 3300009551 Ga0105238_10048429 Ga0105238_100484294 197
160 3300013105 Ga0157369_10556663 Ga0157369_105566632 197
161 3300013307 Ga0157372_10225941 Ga0157372_102259412 197
162 3300020070 Ga0206356_11287737 Ga0206356_112877371 197
163 3300021441 Ga0213871_10001968 Ga0213871_100019683 197
164 3300025912 Ga0207707_10069599 Ga0207707_100695994 197
165 3300025913 Ga0207695_10030776 Ga0207695_100307763 197
166 3300025915 Ga0207693_10163089 Ga0207693_101630892 197
167 3300025924 Ga0207694_10173145 Ga0207694_101731454 197
168 3300025939 Ga0207665_10057059 Ga0207665_100570593 197
169 3300025949 Ga0207667_10014175 Ga0207667_1001417519 197
170 3300028379 Ga0268266_10013564 Ga0268266_1001356413 197
171 3300031090 Ga0265760_10006072 Ga0265760_100060724 197
172 3300039438 Ga0436360_0908003 Ga0436360_0908003_1570_2292 197
173 3300045049 Ga0466959_0002822 Ga0466959_0002822_867_1589 197
174 3300005434 Ga0070709_10036484 Ga0070709_100364844 198
175 3300005437 Ga0070710_10054813 Ga0070710_100548131 198
176 3300005545 Ga0070695_100002554 Ga0070695_10000255418 198
177 3300025929 Ga0207664_10211583 Ga0207664_102115832 198
178 3300036647 Ga0316582_0611842 Ga0316582_0611842_103_705 200
179 3300036712 Ga0316584_0072965 Ga0316584_0072965_731_1333 200
180 3300036712 Ga0316584_0138191 Ga0316584_0138191_708_1310 200
181 3300005842 Ga0068858_100250658 Ga0068858_1002506583 202
182 3300014968 Ga0157379_10073756 Ga0157379_100737563 202
183 3300026035 Ga0207703_10180083 Ga0207703_101800832 202
184 3300046472 Ga0495580_0649999 Ga0495580_0649999_11_655 206
185 3300031727 Ga0316576_10022704 Ga0316576_100227043 207
186 3300053177 Ga0500636_0255292 Ga0500636_0255292_68_757 208
187 3300053178 Ga0500637_0057154 Ga0500637_0057154_717_1448 208
188 iso_pu_bacteria 2687453129 2687580636 208
189 iso_pu_bacteria 2952252522 2952256176 208
190 iso_pu_bacteria 8057160832 8057163875 208
191 3300033527 Ga0316586_1000884 Ga0316586_10008846 210
192 3300035410 Ga0373924_0229154 Ga0373924_0229154_19_675 210
193 3300047443 Ga0495687_052847 Ga0495687_052847_1039_1695 210
194 3300048919 Ga0496116_0190449 Ga0496116_0190449_420_1076 210
195 3300031691 Ga0316579_10222058 Ga0316579_102220582 211
196 3300031727 Ga0316576_10009279 Ga0316576_100092792 211
197 3300031727 Ga0316576_10064356 Ga0316576_100643564 211
198 3300033524 Ga0316592_1022795 Ga0316592_10227952 211
199 3300033529 Ga0316587_1017202 Ga0316587_10172022 211
200 3300033541 Ga0316596_1008172 Ga0316596_10081725 211
201 3300033541 Ga0316596_1036926 Ga0316596_10369262 211
202 3300033541 Ga0316596_1062126 Ga0316596_10621262 211
203 3300035398 Ga0316574_0055313 Ga0316574_0055313_1577_2212 211
204 3300035398 Ga0316574_0211189 Ga0316574_0211189_89_724 211
205 iso_pu_bacteria 8056054917 8056058654 211
206 3300005336 Ga0070680_100014132 Ga0070680_1000141324 212
207 3300022467 Ga0224712_10115888 Ga0224712_101158881 212
208 3300025912 Ga0207707_10027138 Ga0207707_100271388 212
209 3300025917 Ga0207660_10023662 Ga0207660_100236624 212
210 3300025921 Ga0207652_10105226 Ga0207652_101052264 212
211 3300031251 Ga0265327_10000005 Ga0265327_10000005178 212
212 3300031728 Ga0316578_10324898 Ga0316578_103248981 212
213 3300032168 Ga0316593_10026106 Ga0316593_100261061 212
214 3300033524 Ga0316592_1001885 Ga0316592_10018851 212
215 3300033527 Ga0316586_1000370 Ga0316586_10003704 212
216 3300033528 Ga0316588_1031795 Ga0316588_10317952 212
217 3300033529 Ga0316587_1000022 Ga0316587_100002220 212
218 3300033541 Ga0316596_1000026 Ga0316596_10000264 212
219 3300031665 Ga0316575_10014365 Ga0316575_100143652 213
220 3300033529 Ga0316587_1020058 Ga0316587_10200582 213
221 3300010375 Ga0105239_10057866 Ga0105239_100578664 214
222 3300032168 Ga0316593_10000325 Ga0316593_1000032514 214
223 3300032168 Ga0316593_10072059 Ga0316593_100720592 214
224 3300032168 Ga0316593_10090714 Ga0316593_100907142 214
225 3300033524 Ga0316592_1009411 Ga0316592_10094113 214
226 3300053104 Ga0500556_0000700 Ga0500556_0000700_1332_2054 214
227 3300006931 Ga0097620_100872411 Ga0097620_1008724112 215
228 3300027617 Ga0210002_1009747 Ga0210002_10097473 216
229 3300032168 Ga0316593_10000028 Ga0316593_1000002827 216
230 3300033524 Ga0316592_1000006 Ga0316592_10000063 216
231 3300033524 Ga0316592_1010690 Ga0316592_10106903 216
232 3300033527 Ga0316586_1000040 Ga0316586_100004018 216
233 3300033528 Ga0316588_1001236 Ga0316588_10012363 216
234 3300033529 Ga0316587_1000021 Ga0316587_10000213 216
235 3300033541 Ga0316596_1000016 Ga0316596_100001627 216
236 3300033541 Ga0316596_1009806 Ga0316596_10098063 216
237 3300036712 Ga0316584_0066465 Ga0316584_0066465_1254_1904 216
238 3300038726 Ga0400490_00437 Ga0400490_00437_449_1099 216
239 3300038726 Ga0400490_39901 Ga0400490_39901_536_1186 216
240 3300038727 Ga0400491_03590 Ga0400491_03590_450_1100 216
241 3300038741 Ga0400488_58342 Ga0400488_58342_23_673 216
242 3300039110 Ga0400487_33558 Ga0400487_33558_86_736 216
243 3300039110 Ga0400487_66163 Ga0400487_66163_1430_2080 216
244 3300048905 Ga0496102_0014665 Ga0496102_0014665_1371_2021 216
245 3300033541 Ga0316596_1007663 Ga0316596_10076633 217
246 3300033541 Ga0316596_1009566 Ga0316596_10095663 217
247 3300059477 Ga0587084_005426 Ga0587084_005426_285_938 217
248 3300060346 Ga0587111_0008813 Ga0587111_0008813_739_1392 217
249 3300035113 Ga0373936_0012383 Ga0373936_0012383_710_1432 219
250 3300035113 Ga0373936_0113659 Ga0373936_0113659_25_714 221
251 3300035172 Ga0373955_0095895 Ga0373955_0095895_11_700 221
252 3300037466 Ga0395898_0631487 Ga0395898_0631487_20_709 221
253 3300044684 Ga0466966_0220128 Ga0466966_0220128_22_711 221
254 3300048922 Ga0496119_0050187 Ga0496119_0050187_12_701 221
255 3300009101 Ga0105247_10016819 Ga0105247_100168197 222
256 3300009177 Ga0105248_10039978 Ga0105248_100399782 222
257 3300010375 Ga0105239_11574296 Ga0105239_115742961 222
258 3300014968 Ga0157379_10136446 Ga0157379_101364462 222
259 3300005335 Ga0070666_10129460 Ga0070666_101294601 224
260 3300005367 Ga0070667_100002601 Ga0070667_1000026017 224
261 3300005617 Ga0068859_100124584 Ga0068859_1001245842 224
262 3300006931 Ga0097620_100124582 Ga0097620_1001245822 224
263 3300014968 Ga0157379_10021790 Ga0157379_100217907 224
264 3300025900 Ga0207710_10011141 Ga0207710_100111411 224
265 3300025903 Ga0207680_10081154 Ga0207680_100811543 224
266 3300025941 Ga0207711_10333190 Ga0207711_103331902 224
267 3300025961 Ga0207712_10821165 Ga0207712_108211651 224
268 3300025986 Ga0207658_10000131 Ga0207658_100001317 224
269 3300026035 Ga0207703_10114419 Ga0207703_101144192 224
270 3300046539 Ga0495621_0104182 Ga0495621_0104182_344_1018 224
271 3300005345 Ga0070692_10120310 Ga0070692_101203102 226
272 3300005347 Ga0070668_100332068 Ga0070668_1003320682 226
273 3300005353 Ga0070669_100036309 Ga0070669_1000363093 226
274 3300005366 Ga0070659_100494874 Ga0070659_1004948741 226
275 3300005441 Ga0070700_100133180 Ga0070700_1001331802 226
276 3300005444 Ga0070694_100402780 Ga0070694_1004027801 226
277 3300005457 Ga0070662_100068780 Ga0070662_1000687803 226
278 3300005564 Ga0070664_100160685 Ga0070664_1001606851 226
279 3300005577 Ga0068857_100494317 Ga0068857_1004943171 226
280 3300005844 Ga0068862_100046942 Ga0068862_1000469427 226
281 3300006844 Ga0075428_100100570 Ga0075428_1001005704 226
282 3300006881 Ga0068865_100418722 Ga0068865_1004187222 226
283 3300009553 Ga0105249_10073064 Ga0105249_100730644 226
284 3300013306 Ga0163162_10823013 Ga0163162_108230131 226
285 3300025908 Ga0207643_10219438 Ga0207643_102194381 226
286 3300025919 Ga0207657_10427464 Ga0207657_104274642 226
287 3300025923 Ga0207681_10042404 Ga0207681_100424044 226
288 3300025933 Ga0207706_10043777 Ga0207706_100437773 226
289 3300025938 Ga0207704_10156059 Ga0207704_101560591 226
290 3300025961 Ga0207712_10216517 Ga0207712_102165172 226
291 3300025972 Ga0207668_10381544 Ga0207668_103815441 226
292 3300026067 Ga0207678_10611247 Ga0207678_106112472 226
293 3300026116 Ga0207674_10527105 Ga0207674_105271051 226
294 3300028380 Ga0268265_10009976 Ga0268265_100099764 226
295 3300049533 Ga0501317_009998 Ga0501317_009998_10_702 226
296 3300050511 nmdc:mga08y16_52691_c1 nmdc:mga08y16_52691_c1_1243_1935 226
297 3300053156 Ga0500622_0035350 Ga0500622_0035350_1638_2330 226
298 2162886007 SwRhRL2b_contig_1679528 SwRhRL2b_0143.00007460 232
299 3300004800 Ga0058861_11936056 Ga0058861_119360562 232
300 3300004803 Ga0058862_10147900 Ga0058862_101479001 232
301 3300005289 Ga0065704_10070877 Ga0065704_100708772 232
302 3300005335 Ga0070666_10001446 Ga0070666_100014463 232
303 3300005336 Ga0070680_100006614 Ga0070680_10000661418 232
304 3300005355 Ga0070671_100003161 Ga0070671_10000316124 232
305 3300005355 Ga0070671_100005400 Ga0070671_1000054002 232
306 3300005356 Ga0070674_100372781 Ga0070674_1003727811 232
307 3300005364 Ga0070673_100077547 Ga0070673_1000775473 232
308 3300005367 Ga0070667_100014275 Ga0070667_1000142753 232
309 3300005367 Ga0070667_100090124 Ga0070667_1000901243 232
310 3300005434 Ga0070709_10131918 Ga0070709_101319182 232
311 3300005436 Ga0070713_100006105 Ga0070713_1000061053 232
312 3300005436 Ga0070713_100834383 Ga0070713_1008343832 232
313 3300005437 Ga0070710_10031164 Ga0070710_100311643 232
314 3300005439 Ga0070711_100460469 Ga0070711_1004604692 232
315 3300005458 Ga0070681_10054348 Ga0070681_100543483 232
316 3300005458 Ga0070681_10172191 Ga0070681_101721911 232
317 3300005459 Ga0068867_100025266 Ga0068867_1000252664 232
318 3300005530 Ga0070679_100240910 Ga0070679_1002409102 232
319 3300005535 Ga0070684_100194565 Ga0070684_1001945652 232
320 3300005544 Ga0070686_100296172 Ga0070686_1002961722 232
321 3300005548 Ga0070665_100005442 Ga0070665_10000544226 232
322 3300005548 Ga0070665_100020767 Ga0070665_1000207673 232
323 3300005548 Ga0070665_100039130 Ga0070665_1000391307 232
324 3300005548 Ga0070665_100056051 Ga0070665_1000560516 232
325 3300005563 Ga0068855_100162407 Ga0068855_1001624074 232
326 3300005563 Ga0068855_100233788 Ga0068855_1002337882 232
327 3300005563 Ga0068855_100831227 Ga0068855_1008312271 232
328 3300005578 Ga0068854_100369790 Ga0068854_1003697902 232
329 3300005614 Ga0068856_100006458 Ga0068856_1000064586 232
330 3300005616 Ga0068852_100473234 Ga0068852_1004732341 232
331 3300005617 Ga0068859_100000641 Ga0068859_1000006413 232
332 3300005617 Ga0068859_100199475 Ga0068859_1001994751 232
333 3300005618 Ga0068864_100076450 Ga0068864_1000764502 232
334 3300005718 Ga0068866_10054670 Ga0068866_100546702 232
335 3300005834 Ga0068851_10044653 Ga0068851_100446532 232
336 3300005841 Ga0068863_100074617 Ga0068863_1000746174 232
337 3300005842 Ga0068858_100000125 Ga0068858_10000012535 232
338 3300005842 Ga0068858_100037896 Ga0068858_1000378967 232
339 3300005843 Ga0068860_100009263 Ga0068860_1000092634 232
340 3300005843 Ga0068860_100027680 Ga0068860_1000276803 232
341 3300005843 Ga0068860_100038900 Ga0068860_1000389003 232
342 3300006163 Ga0070715_10004582 Ga0070715_100045823 232
343 3300006173 Ga0070716_100104267 Ga0070716_1001042673 232
344 3300006175 Ga0070712_100001456 Ga0070712_10000145627 232
345 3300006175 Ga0070712_100165383 Ga0070712_1001653832 232
346 3300006237 Ga0097621_100380426 Ga0097621_1003804262 232
347 3300006358 Ga0068871_100159060 Ga0068871_1001590601 232
348 3300006881 Ga0068865_100001214 Ga0068865_1000012143 232
349 3300006931 Ga0097620_100000641 Ga0097620_1000006413 232
350 3300006931 Ga0097620_100199474 Ga0097620_1001994741 232
351 3300007788 Ga0099795_10036139 Ga0099795_100361393 232
352 3300009093 Ga0105240_10078712 Ga0105240_100787125 232
353 3300009093 Ga0105240_10090660 Ga0105240_100906607 232
354 3300009093 Ga0105240_10121093 Ga0105240_101210932 232
355 3300009093 Ga0105240_10121608 Ga0105240_101216083 232
356 3300009093 Ga0105240_10520512 Ga0105240_105205121 232
357 3300009098 Ga0105245_10011368 Ga0105245_100113689 232
358 3300009101 Ga0105247_10002466 Ga0105247_100024663 232
359 3300009101 Ga0105247_10410520 Ga0105247_104105201 232
360 3300009174 Ga0105241_10037721 Ga0105241_100377213 232
361 3300009174 Ga0105241_10741304 Ga0105241_107413041 232
362 3300009176 Ga0105242_10051158 Ga0105242_100511583 232
363 3300009177 Ga0105248_10003146 Ga0105248_100031463 232
364 3300009545 Ga0105237_10181875 Ga0105237_101818751 232
365 3300009545 Ga0105237_10284030 Ga0105237_102840303 232
366 3300009551 Ga0105238_10114714 Ga0105238_101147142 232
367 3300009551 Ga0105238_10232549 Ga0105238_102325492 232
368 3300009551 Ga0105238_10470562 Ga0105238_104705622 232
369 3300009553 Ga0105249_10048373 Ga0105249_100483733 232
370 3300010159 Ga0099796_10022473 Ga0099796_100224732 232
371 3300010375 Ga0105239_10101214 Ga0105239_101012144 232
372 3300010375 Ga0105239_10108235 Ga0105239_101082354 232
373 3300013105 Ga0157369_10015323 Ga0157369_1001532318 232
374 3300013105 Ga0157369_10124992 Ga0157369_101249922 232
375 3300013296 Ga0157374_10024385 Ga0157374_100243858 232
376 3300013296 Ga0157374_10201081 Ga0157374_102010813 232
377 3300013297 Ga0157378_10006374 Ga0157378_1000637421 232
378 3300013306 Ga0163162_10006236 Ga0163162_100062363 232
379 3300013306 Ga0163162_10057607 Ga0163162_100576072 232
380 3300013306 Ga0163162_10293535 Ga0163162_102935352 232
381 3300013307 Ga0157372_10146281 Ga0157372_101462813 232
382 3300013307 Ga0157372_10256411 Ga0157372_102564112 232
383 3300013307 Ga0157372_10667019 Ga0157372_106670191 232
384 3300013308 Ga0157375_10039845 Ga0157375_100398452 232
385 3300013308 Ga0157375_10511845 Ga0157375_105118452 232
386 3300014325 Ga0163163_10092410 Ga0163163_100924103 232
387 3300014968 Ga0157379_10041785 Ga0157379_100417853 232
388 3300014969 Ga0157376_10029700 Ga0157376_100297007 232
389 3300020070 Ga0206356_11866678 Ga0206356_118666781 232
390 3300020076 Ga0206355_1038196 Ga0206355_10381962 232
391 3300022467 Ga0224712_10092194 Ga0224712_100921942 232
392 3300022467 Ga0224712_10104730 Ga0224712_101047302 232
393 3300025898 Ga0207692_10031480 Ga0207692_100314802 232
394 3300025898 Ga0207692_10163605 Ga0207692_101636052 232
395 3300025900 Ga0207710_10005001 Ga0207710_100050013 232
396 3300025903 Ga0207680_10199309 Ga0207680_101993091 232
397 3300025904 Ga0207647_10089543 Ga0207647_100895432 232
398 3300025905 Ga0207685_10024333 Ga0207685_100243333 232
399 3300025906 Ga0207699_10275281 Ga0207699_102752812 232
400 3300025911 Ga0207654_10191202 Ga0207654_101912022 232
401 3300025912 Ga0207707_10032067 Ga0207707_100320676 232
402 3300025912 Ga0207707_10090231 Ga0207707_100902312 232
403 3300025912 Ga0207707_10120685 Ga0207707_101206851 232
404 3300025912 Ga0207707_10294481 Ga0207707_102944811 232
405 3300025913 Ga0207695_10037866 Ga0207695_100378666 232
406 3300025913 Ga0207695_10059336 Ga0207695_100593362 232
407 3300025913 Ga0207695_10087344 Ga0207695_100873443 232
408 3300025914 Ga0207671_10075016 Ga0207671_100750162 232
409 3300025914 Ga0207671_10202974 Ga0207671_102029742 232
410 3300025914 Ga0207671_10254490 Ga0207671_102544901 232
411 3300025915 Ga0207693_10000448 Ga0207693_100004483 232
412 3300025916 Ga0207663_10074257 Ga0207663_100742573 232
413 3300025921 Ga0207652_10159759 Ga0207652_101597594 232
414 3300025924 Ga0207694_10185946 Ga0207694_101859463 232
415 3300025927 Ga0207687_10316600 Ga0207687_103166001 232
416 3300025931 Ga0207644_10000428 Ga0207644_1000042831 232
417 3300025931 Ga0207644_10022460 Ga0207644_100224602 232
418 3300025938 Ga0207704_10004775 Ga0207704_100047753 232
419 3300025941 Ga0207711_10205483 Ga0207711_102054831 232
420 3300025944 Ga0207661_10114061 Ga0207661_101140612 232
421 3300025949 Ga0207667_10014085 Ga0207667_1001408513 232
422 3300025949 Ga0207667_10741364 Ga0207667_107413641 232
423 3300025961 Ga0207712_10068569 Ga0207712_100685693 232
424 3300025981 Ga0207640_10353669 Ga0207640_103536692 232
425 3300025986 Ga0207658_10011254 Ga0207658_1001125412 232
426 3300025986 Ga0207658_10019790 Ga0207658_100197908 232
427 3300026035 Ga0207703_10001524 Ga0207703_1000152432 232
428 3300026035 Ga0207703_10105984 Ga0207703_101059843 232
429 3300026041 Ga0207639_10105218 Ga0207639_101052183 232
430 3300026067 Ga0207678_10034632 Ga0207678_100346321 232
431 3300026088 Ga0207641_10002325 Ga0207641_100023253 232
432 3300026088 Ga0207641_10194858 Ga0207641_101948584 232
433 3300026088 Ga0207641_10315214 Ga0207641_103152141 232
434 3300026121 Ga0207683_10002499 Ga0207683_1000249928 232
435 3300028379 Ga0268266_10000943 Ga0268266_100009432 232
436 3300028379 Ga0268266_10485147 Ga0268266_104851472 232
437 3300028381 Ga0268264_10000102 Ga0268264_100001023 232
438 3300028381 Ga0268264_10038276 Ga0268264_100382763 232
439 3300028381 Ga0268264_10141591 Ga0268264_101415911 232
440 3300030521 Ga0307511_10000235 Ga0307511_1000023562 232
441 3300030763 Ga0265763_1004784 Ga0265763_10047842 232
442 3300031507 Ga0307509_10000987 Ga0307509_1000098756 232
443 3300033180 Ga0307510_10000006 Ga0307510_10000006334 232
444 3300033180 Ga0307510_10153566 Ga0307510_101535663 232
445 3300035086 Ga0373934_0086450 Ga0373934_0086450_113_835 232
446 3300035116 Ga0373945_0041920 Ga0373945_0041920_172_894 232
447 3300035170 Ga0373943_0015875 Ga0373943_0015875_2105_2827 232
448 3300035172 Ga0373955_0011455 Ga0373955_0011455_2315_3037 232
449 3300035695 Ga0373927_0047414 Ga0373927_0047414_1817_2539 232
450 3300035724 Ga0373933_0039288 Ga0373933_0039288_476_1198 232
451 3300035725 Ga0373947_0161552 Ga0373947_0161552_20_742 232
452 3300036401 Ga0373937_0001807 Ga0373937_0001807_12323_13045 232
453 3300036401 Ga0373937_0109265 Ga0373937_0109265_707_1429 232
454 3300037068 Ga0373925_0230527 Ga0373925_0230527_589_1311 232
455 3300037312 Ga0395899_0438450 Ga0395899_0438450_100_822 232
456 3300037418 Ga0395900_0684668 Ga0395900_0684668_190_912 232
457 3300037466 Ga0395898_0081820 Ga0395898_0081820_1761_2483 232
458 3300037466 Ga0395898_0206094 Ga0395898_0206094_546_1268 232
459 3300039437 Ga0436365_0602380 Ga0436365_0602380_382_1104 232
460 3300042876 Ga0451577_0008152 Ga0451577_0008152_697_1419 232
461 3300044656 Ga0466969_0260721 Ga0466969_0260721_26_763 232
462 3300044673 Ga0453683_0005334 Ga0453683_0005334_6527_7249 232
463 3300044684 Ga0466966_0002570 Ga0466966_0002570_1632_2354 232
464 3300044693 Ga0466961_0016727 Ga0466961_0016727_1632_2354 232
465 3300044706 Ga0466964_0012273 Ga0466964_0012273_1611_2333 232
466 3300044712 Ga0453684_0043943 Ga0453684_0043943_4573_5295 232
467 3300044735 Ga0466968_0152700 Ga0466968_0152700_308_1030 232
468 3300044765 Ga0466970_0018566 Ga0466970_0018566_518_1240 232
469 3300044842 Ga0466957_0007884 Ga0466957_0007884_257_979 232
470 3300045049 Ga0466959_0022213 Ga0466959_0022213_1604_2326 232
471 3300045049 Ga0466959_0182791 Ga0466959_0182791_44_766 232
472 3300045049 Ga0466959_0362466 Ga0466959_0362466_210_947 232
473 3300045051 Ga0451576_0098246 Ga0451576_0098246_1933_2655 232
474 3300045836 Ga0466958_0177421 Ga0466958_0177421_326_1048 232
475 3300046472 Ga0495580_0141191 Ga0495580_0141191_769_1491 232
476 3300046472 Ga0495580_0167561 Ga0495580_0167561_380_1102 232
477 3300046477 Ga0495664_0240740 Ga0495664_0240740_40_762 232
478 3300046507 Ga0495606_0042851 Ga0495606_0042851_805_1527 232
479 3300046517 Ga0495630_0026241 Ga0495630_0026241_2865_3587 232
480 3300046522 Ga0495643_0158616 Ga0495643_0158616_109_831 232
481 3300046526 Ga0495666_0184389 Ga0495666_0184389_91_813 232
482 3300046536 Ga0495587_0019207 Ga0495587_0019207_1702_2424 232
483 3300046543 Ga0495645_0410584 Ga0495645_0410584_106_828 232
484 3300046675 Ga0495657_0150741 Ga0495657_0150741_144_866 232
485 3300046678 Ga0495599_0121138 Ga0495599_0121138_65_787 232
486 3300046679 Ga0495623_0050975 Ga0495623_0050975_86_808 232
487 3300046694 Ga0495649_0197017 Ga0495649_0197017_167_889 232
488 3300048903 Ga0496100_0088239 Ga0496100_0088239_357_1079 232
489 3300048904 Ga0496101_0019992 Ga0496101_0019992_3590_4312 232
490 3300048905 Ga0496102_0009299 Ga0496102_0009299_7041_7763 232
491 3300048905 Ga0496102_0053702 Ga0496102_0053702_772_1494 232
492 3300048905 Ga0496102_0070282 Ga0496102_0070282_2275_2997 232
493 3300048906 Ga0496103_0058907 Ga0496103_0058907_1595_2317 232
494 3300048907 Ga0496104_0381243 Ga0496104_0381243_527_1249 232
495 3300048908 Ga0496105_0003469 Ga0496105_0003469_10172_10894 232
496 3300048908 Ga0496105_0221104 Ga0496105_0221104_187_909 232
497 3300048909 Ga0496106_0028441 Ga0496106_0028441_1470_2192 232
498 3300048909 Ga0496106_0391327 Ga0496106_0391327_166_888 232
499 3300048910 Ga0496107_0001576 Ga0496107_0001576_4624_5346 232
500 3300048911 Ga0496108_0002086 Ga0496108_0002086_9029_9751 232
501 3300048911 Ga0496108_0182334 Ga0496108_0182334_824_1546 232
502 3300048912 Ga0496109_0067040 Ga0496109_0067040_2361_3083 232
503 3300048913 Ga0496110_0017578 Ga0496110_0017578_1800_2522 232
504 3300048914 Ga0496111_0092759 Ga0496111_0092759_772_1494 232
505 3300048915 Ga0496112_0463120 Ga0496112_0463120_111_833 232
506 3300048916 Ga0496113_0090410 Ga0496113_0090410_133_855 232
507 3300048917 Ga0496114_0074247 Ga0496114_0074247_764_1486 232
508 3300048920 Ga0496117_0000787 Ga0496117_0000787_25180_25902 232
509 3300048921 Ga0496118_0000032 Ga0496118_0000032_233652_234374 232
510 3300048922 Ga0496119_0012506 Ga0496119_0012506_3981_4703 232
511 3300048923 Ga0496120_0021776 Ga0496120_0021776_2511_3233 232
512 3300048924 Ga0496121_0028073 Ga0496121_0028073_795_1517 232
513 3300048924 Ga0496121_0061867 Ga0496121_0061867_1509_2231 232
514 3300048924 Ga0496121_0157167 Ga0496121_0157167_812_1534 232
515 3300048927 Ga0496124_0055985 Ga0496124_0055985_1713_2435 232
516 3300048928 Ga0496125_0001378 Ga0496125_0001378_1023_1745 232
517 3300048928 Ga0496125_0020647 Ga0496125_0020647_788_1510 232
518 3300048928 Ga0496125_0022367 Ga0496125_0022367_3145_3867 232
519 3300048929 Ga0496126_0004928 Ga0496126_0004928_13971_14693 232
520 3300048929 Ga0496126_0011396 Ga0496126_0011396_837_1559 232
521 3300048929 Ga0496126_0130504 Ga0496126_0130504_286_1008 232
522 3300053078 Ga0495612_0122898 Ga0495612_0122898_321_1043 232
523 3300053115 Ga0500591_052893 Ga0500591_052893_929_1651 232
524 3300053123 Ga0500614_084529 Ga0500614_084529_142_864 232
525 3300053178 Ga0500637_0004292 Ga0500637_0004292_4837_5559 232
526 3300061719 Ga0466962_0001207 Ga0466962_0001207_9548_10270 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

92

194

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9275 2 210
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9237 2 210
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9127 2 210
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.911 2 210
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8922 3 210
ID Description Score Start End Superfamily
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9612 34 97 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9365 33 99 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9323 34 97 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.932 35 99 3.30.160.810
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9191 1 211 2.40.30.10
ID Description Score Start End GO Terms
AF-X0Z1Y0-F1-model_v4 50S ribosomal protein L3 0.9379 5 104 GO:0003735
GO:0006412
GO:0022625
AF-A0A087B7P6-F1-model_v4 deleted 0.9374 5 106
AF-A0A485AH68-F1-model_v4 50S ribosomal protein L3 0.937 2 103 GO:0003735
GO:0006412
GO:0022625
AF-A0A447N332-F1-model_v4 50S ribosomal protein L3 0.9347 2 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X6ZH73-F1-model_v4 50S ribosomal protein L3 0.93 12 99 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
79.76 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map