F459446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 298 | 522 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0260721|Ga0466969_0260721_26_763 |
| Length | 245 |
| Sequence | MKEAVMAIVLVGRKAGMTRVFTDAGETVPCTVIEVLPNRVTQVKTQEKDGYRAVQVTYGTRRPQLYSKAVAGHYAKANVAPGKALVEFRLAPTDKAEVAAGAELKVDLFKVGQKVDVTGTTIGKGYAGGMKRHGFGGLPATHGVSVSHRSIGSIGMRQTPGRVFKGRRMSGHMGVDRVTTENLKVVEIDTARNLILIRGAVPGAEGGQVIIRPGLKAARLALRKTTAPTKSGSGPSKDPAKQGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 3 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 185 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 186 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 187 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 195 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 196 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 197 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 198 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 199 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 200 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 201 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 202 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 203 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 204 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 205 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 206 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 288 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 289 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 290 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 297 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 298 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.25 |
| Metatranscriptomes | 7.98 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 5.89 |
| Rhizosphere | 86.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1679528 | 2162886007 | Unclassified | 4851 |
| 2 | Ga0058863_11858572 | 3300004799 | Bacteria | 1229 |
| 3 | Ga0058861_11936056 | 3300004800 | Unclassified | 1108 |
| 4 | Ga0058861_12059673 | 3300004800 | Bacteria | 1459 |
| 5 | Ga0058862_10147900 | 3300004803 | Unclassified | 1080 |
| 6 | Ga0065704_10070877 | 3300005289 | Bacteria | 15122 |
| 7 | Ga0070670_100542929 | 3300005331 | Bacteria | 1037 |
| 8 | Ga0070666_10001446 | 3300005335 | Bacteria | 14396 |
| 9 | Ga0070666_10040531 | 3300005335 | Bacteria | 3108 |
| 10 | Ga0070666_10129460 | 3300005335 | Bacteria | 1753 |
| 11 | Ga0070680_100006614 | 3300005336 | Bacteria | 8813 |
| 12 | Ga0070680_100014132 | 3300005336 | Bacteria | 6235 |
| 13 | Ga0070689_100059541 | 3300005340 | Bacteria | 2969 |
| 14 | Ga0070692_10120310 | 3300005345 | Bacteria | 1464 |
| 15 | Ga0070668_100332068 | 3300005347 | Bacteria | 1282 |
| 16 | Ga0070669_100006485 | 3300005353 | Bacteria | 8426 |
| 17 | Ga0070669_100036309 | 3300005353 | Bacteria | 3570 |
| 18 | Ga0070675_100156400 | 3300005354 | Bacteria | 1957 |
| 19 | Ga0070671_100003161 | 3300005355 | Bacteria | 12839 |
| 20 | Ga0070671_100005400 | 3300005355 | Bacteria | 10190 |
| 21 | Ga0070671_100149605 | 3300005355 | Bacteria | 1971 |
| 22 | Ga0070674_100372781 | 3300005356 | Bacteria | 1159 |
| 23 | Ga0070673_100077547 | 3300005364 | Bacteria | 2685 |
| 24 | Ga0070673_100269144 | 3300005364 | Bacteria | 1491 |
| 25 | Ga0070659_100494874 | 3300005366 | Bacteria | 1041 |
| 26 | Ga0070667_100002601 | 3300005367 | Bacteria | 15672 |
| 27 | Ga0070667_100014275 | 3300005367 | Bacteria | 6561 |
| 28 | Ga0070667_100025221 | 3300005367 | Bacteria | 4942 |
| 29 | Ga0070667_100090124 | 3300005367 | Bacteria | 2635 |
| 30 | Ga0070709_10036484 | 3300005434 | Bacteria | 2995 |
| 31 | Ga0070709_10131918 | 3300005434 | Bacteria | 1707 |
| 32 | Ga0070714_100037919 | 3300005435 | Bacteria | 4052 |
| 33 | Ga0070713_100001795 | 3300005436 | Bacteria | 13831 |
| 34 | Ga0070713_100006105 | 3300005436 | Bacteria | 8311 |
| 35 | Ga0070713_100834383 | 3300005436 | Bacteria | 884 |
| 36 | Ga0070710_10031164 | 3300005437 | Bacteria | 2875 |
| 37 | Ga0070710_10054813 | 3300005437 | Bacteria | 2250 |
| 38 | Ga0070711_100460469 | 3300005439 | Bacteria | 1042 |
| 39 | Ga0070700_100133180 | 3300005441 | Bacteria | 1680 |
| 40 | Ga0070694_100402780 | 3300005444 | Bacteria | 1071 |
| 41 | Ga0070662_100068780 | 3300005457 | Bacteria | 2604 |
| 42 | Ga0070681_10001074 | 3300005458 | Bacteria | 23281 |
| 43 | Ga0070681_10054348 | 3300005458 | Bacteria | 3990 |
| 44 | Ga0070681_10166379 | 3300005458 | Bacteria | 2128 |
| 45 | Ga0070681_10172191 | 3300005458 | Bacteria | 2087 |
| 46 | Ga0068867_100025266 | 3300005459 | Bacteria | 4262 |
| 47 | Ga0068867_100184337 | 3300005459 | Bacteria | 1661 |
| 48 | Ga0068867_100199434 | 3300005459 | Bacteria | 1601 |
| 49 | Ga0068867_100257860 | 3300005459 | Bacteria | 1420 |
| 50 | Ga0070679_100240910 | 3300005530 | Bacteria | 1766 |
| 51 | Ga0070684_100194565 | 3300005535 | Bacteria | 1846 |
| 52 | Ga0070672_100194982 | 3300005543 | Bacteria | 1692 |
| 53 | Ga0070686_100296172 | 3300005544 | Bacteria | 1198 |
| 54 | Ga0070695_100002554 | 3300005545 | Bacteria | 10512 |
| 55 | Ga0070665_100005442 | 3300005548 | Bacteria | 13132 |
| 56 | Ga0070665_100020767 | 3300005548 | Bacteria | 6599 |
| 57 | Ga0070665_100039130 | 3300005548 | Bacteria | 4769 |
| 58 | Ga0070665_100056051 | 3300005548 | Bacteria | 3952 |
| 59 | Ga0070665_100072878 | 3300005548 | Bacteria | 3442 |
| 60 | Ga0070665_100090458 | 3300005548 | Bacteria | 3066 |
| 61 | Ga0070704_100763508 | 3300005549 | Bacteria | 862 |
| 62 | Ga0068855_100162407 | 3300005563 | Bacteria | 2534 |
| 63 | Ga0068855_100233788 | 3300005563 | Bacteria | 2056 |
| 64 | Ga0068855_100831227 | 3300005563 | Bacteria | 980 |
| 65 | Ga0070664_100160685 | 3300005564 | Bacteria | 1988 |
| 66 | Ga0068857_100333296 | 3300005577 | Bacteria | 1403 |
| 67 | Ga0068857_100494317 | 3300005577 | Bacteria | 1147 |
| 68 | Ga0068854_100369790 | 3300005578 | Unclassified | 1178 |
| 69 | Ga0068856_100006458 | 3300005614 | Bacteria | 11500 |
| 70 | Ga0068852_100473234 | 3300005616 | Bacteria | 1244 |
| 71 | Ga0068859_100000641 | 3300005617 | Bacteria | 34946 |
| 72 | Ga0068859_100094378 | 3300005617 | Bacteria | 3044 |
| 73 | Ga0068859_100124584 | 3300005617 | Bacteria | 2645 |
| 74 | Ga0068859_100199475 | 3300005617 | Bacteria | 2085 |
| 75 | Ga0068864_100007914 | 3300005618 | Bacteria | 8759 |
| 76 | Ga0068864_100076450 | 3300005618 | Bacteria | 2926 |
| 77 | Ga0068866_10054670 | 3300005718 | Bacteria | 2047 |
| 78 | Ga0068851_10044653 | 3300005834 | Bacteria | 2238 |
| 79 | Ga0068863_100007442 | 3300005841 | Bacteria | 10714 |
| 80 | Ga0068863_100074617 | 3300005841 | Bacteria | 3209 |
| 81 | Ga0068863_100543284 | 3300005841 | Bacteria | 1147 |
| 82 | Ga0068858_100000125 | 3300005842 | Bacteria | 79795 |
| 83 | Ga0068858_100037896 | 3300005842 | Bacteria | 4471 |
| 84 | Ga0068858_100186119 | 3300005842 | Bacteria | 1961 |
| 85 | Ga0068858_100250658 | 3300005842 | Bacteria | 1682 |
| 86 | Ga0068860_100009263 | 3300005843 | Bacteria | 9789 |
| 87 | Ga0068860_100027680 | 3300005843 | Bacteria | 5458 |
| 88 | Ga0068860_100038900 | 3300005843 | Bacteria | 4550 |
| 89 | Ga0068860_100078629 | 3300005843 | Bacteria | 3136 |
| 90 | Ga0068862_100046942 | 3300005844 | Bacteria | 3684 |
| 91 | Ga0070717_10016779 | 3300006028 | Bacteria | 5684 |
| 92 | Ga0070715_10004582 | 3300006163 | Bacteria | 4553 |
| 93 | Ga0070716_100003910 | 3300006173 | Bacteria | 7076 |
| 94 | Ga0070716_100104267 | 3300006173 | Bacteria | 1745 |
| 95 | Ga0070716_100136660 | 3300006173 | Bacteria | 1557 |
| 96 | Ga0070712_100001456 | 3300006175 | Bacteria | 14428 |
| 97 | Ga0070712_100048988 | 3300006175 | Bacteria | 2931 |
| 98 | Ga0070712_100165383 | 3300006175 | Bacteria | 1712 |
| 99 | Ga0097621_100058060 | 3300006237 | Bacteria | 3166 |
| 100 | Ga0097621_100380426 | 3300006237 | Bacteria | 1261 |
| 101 | Ga0068871_100058952 | 3300006358 | Bacteria | 3127 |
| 102 | Ga0068871_100159060 | 3300006358 | Bacteria | 1931 |
| 103 | Ga0075428_100100570 | 3300006844 | Bacteria | 3152 |
| 104 | Ga0068865_100001214 | 3300006881 | Bacteria | 15025 |
| 105 | Ga0068865_100418722 | 3300006881 | Bacteria | 1101 |
| 106 | Ga0097620_100000641 | 3300006931 | Bacteria | 34946 |
| 107 | Ga0097620_100094378 | 3300006931 | Bacteria | 3044 |
| 108 | Ga0097620_100124582 | 3300006931 | Bacteria | 2645 |
| 109 | Ga0097620_100199474 | 3300006931 | Bacteria | 2085 |
| 110 | Ga0097620_100872411 | 3300006931 | Bacteria | 985 |
| 111 | Ga0099795_10036139 | 3300007788 | Bacteria | 1732 |
| 112 | Ga0105240_10010598 | 3300009093 | Bacteria | 12954 |
| 113 | Ga0105240_10050500 | 3300009093 | Bacteria | 5242 |
| 114 | Ga0105240_10078712 | 3300009093 | Bacteria | 4059 |
| 115 | Ga0105240_10090660 | 3300009093 | Bacteria | 3736 |
| 116 | Ga0105240_10121093 | 3300009093 | Bacteria | 3150 |
| 117 | Ga0105240_10121608 | 3300009093 | Bacteria | 3143 |
| 118 | Ga0105240_10520512 | 3300009093 | Bacteria | 1320 |
| 119 | Ga0105245_10002714 | 3300009098 | Bacteria | 15935 |
| 120 | Ga0105245_10011368 | 3300009098 | Bacteria | 7751 |
| 121 | Ga0105247_10002466 | 3300009101 | Bacteria | 12578 |
| 122 | Ga0105247_10016819 | 3300009101 | Bacteria | 4385 |
| 123 | Ga0105247_10410520 | 3300009101 | Bacteria | 967 |
| 124 | Ga0105241_10037721 | 3300009174 | Bacteria | 3640 |
| 125 | Ga0105241_10741304 | 3300009174 | Bacteria | 900 |
| 126 | Ga0105242_10026778 | 3300009176 | Bacteria | 4572 |
| 127 | Ga0105242_10051158 | 3300009176 | Bacteria | 3366 |
| 128 | Ga0105242_10383798 | 3300009176 | Bacteria | 1307 |
| 129 | Ga0105248_10003146 | 3300009177 | Bacteria | 18265 |
| 130 | Ga0105248_10006447 | 3300009177 | Bacteria | 12878 |
| 131 | Ga0105248_10039978 | 3300009177 | Bacteria | 5257 |
| 132 | Ga0105237_10031936 | 3300009545 | Bacteria | 5332 |
| 133 | Ga0105237_10181875 | 3300009545 | Bacteria | 2103 |
| 134 | Ga0105237_10284030 | 3300009545 | Bacteria | 1658 |
| 135 | Ga0105238_10048429 | 3300009551 | Bacteria | 4284 |
| 136 | Ga0105238_10114714 | 3300009551 | Bacteria | 2673 |
| 137 | Ga0105238_10232549 | 3300009551 | Bacteria | 1820 |
| 138 | Ga0105238_10470562 | 3300009551 | Bacteria | 1255 |
| 139 | Ga0105249_10048373 | 3300009553 | Bacteria | 3877 |
| 140 | Ga0105249_10073064 | 3300009553 | Bacteria | 3172 |
| 141 | Ga0105030_100588 | 3300009987 | Bacteria | 3249 |
| 142 | Ga0099796_10022473 | 3300010159 | Bacteria | 1957 |
| 143 | Ga0105239_10057866 | 3300010375 | Bacteria | 4252 |
| 144 | Ga0105239_10101214 | 3300010375 | Bacteria | 3187 |
| 145 | Ga0105239_10108235 | 3300010375 | Bacteria | 3080 |
| 146 | Ga0105239_11574296 | 3300010375 | Bacteria | 760 |
| 147 | Ga0157369_10015323 | 3300013105 | Bacteria | 8645 |
| 148 | Ga0157369_10124992 | 3300013105 | Bacteria | 2728 |
| 149 | Ga0157369_10556663 | 3300013105 | Bacteria | 1185 |
| 150 | Ga0157374_10009580 | 3300013296 | Bacteria | 8319 |
| 151 | Ga0157374_10024385 | 3300013296 | Bacteria | 5423 |
| 152 | Ga0157374_10201081 | 3300013296 | Bacteria | 1951 |
| 153 | Ga0157378_10004652 | 3300013297 | Bacteria | 12033 |
| 154 | Ga0157378_10006374 | 3300013297 | Bacteria | 10319 |
| 155 | Ga0163162_10006236 | 3300013306 | Bacteria | 11558 |
| 156 | Ga0163162_10007547 | 3300013306 | Bacteria | 10591 |
| 157 | Ga0163162_10057607 | 3300013306 | Bacteria | 3914 |
| 158 | Ga0163162_10293535 | 3300013306 | Bacteria | 1757 |
| 159 | Ga0163162_10823013 | 3300013306 | Bacteria | 1045 |
| 160 | Ga0157372_10146281 | 3300013307 | Bacteria | 2725 |
| 161 | Ga0157372_10225941 | 3300013307 | Bacteria | 2170 |
| 162 | Ga0157372_10256411 | 3300013307 | Bacteria | 2030 |
| 163 | Ga0157372_10667019 | 3300013307 | Bacteria | 1211 |
| 164 | Ga0157375_10003225 | 3300013308 | Bacteria | 14154 |
| 165 | Ga0157375_10039845 | 3300013308 | Bacteria | 4524 |
| 166 | Ga0157375_10224546 | 3300013308 | Bacteria | 2037 |
| 167 | Ga0157375_10362616 | 3300013308 | Bacteria | 1615 |
| 168 | Ga0157375_10511845 | 3300013308 | Bacteria | 1364 |
| 169 | Ga0163163_10059072 | 3300014325 | Bacteria | 3792 |
| 170 | Ga0163163_10092410 | 3300014325 | Bacteria | 3041 |
| 171 | Ga0157380_10032693 | 3300014326 | Bacteria | 4004 |
| 172 | Ga0157380_10034739 | 3300014326 | Bacteria | 3890 |
| 173 | Ga0157380_10065115 | 3300014326 | Bacteria | 2928 |
| 174 | Ga0157379_10021790 | 3300014968 | Bacteria | 5677 |
| 175 | Ga0157379_10041785 | 3300014968 | Bacteria | 4092 |
| 176 | Ga0157379_10073756 | 3300014968 | Bacteria | 3055 |
| 177 | Ga0157379_10136446 | 3300014968 | Bacteria | 2210 |
| 178 | Ga0157376_10029700 | 3300014969 | Bacteria | 4357 |
| 179 | Ga0157376_10093347 | 3300014969 | Bacteria | 2612 |
| 180 | Ga0163161_10229375 | 3300017792 | Bacteria | 1441 |
| 181 | Ga0206356_11287737 | 3300020070 | Bacteria | 988 |
| 182 | Ga0206356_11866678 | 3300020070 | Bacteria | 1043 |
| 183 | Ga0206355_1038196 | 3300020076 | Bacteria | 1447 |
| 184 | Ga0213872_10188334 | 3300021361 | Bacteria | 889 |
| 185 | Ga0213874_10062026 | 3300021377 | Bacteria | 1173 |
| 186 | Ga0213871_10001968 | 3300021441 | Bacteria | 3648 |
| 187 | Ga0224712_10092194 | 3300022467 | Bacteria | 1271 |
| 188 | Ga0224712_10104730 | 3300022467 | Bacteria | 1205 |
| 189 | Ga0224712_10115888 | 3300022467 | Bacteria | 1155 |
| 190 | Ga0207692_10031480 | 3300025898 | Bacteria | 2541 |
| 191 | Ga0207692_10163605 | 3300025898 | Bacteria | 1284 |
| 192 | Ga0207710_10005001 | 3300025900 | Bacteria | 5741 |
| 193 | Ga0207710_10011141 | 3300025900 | Bacteria | 3786 |
| 194 | Ga0207680_10081154 | 3300025903 | Bacteria | 2038 |
| 195 | Ga0207680_10143707 | 3300025903 | Bacteria | 1584 |
| 196 | Ga0207680_10199309 | 3300025903 | Bacteria | 1363 |
| 197 | Ga0207647_10089543 | 3300025904 | Bacteria | 1836 |
| 198 | Ga0207685_10024333 | 3300025905 | Bacteria | 2075 |
| 199 | Ga0207699_10017117 | 3300025906 | Bacteria | 3806 |
| 200 | Ga0207699_10275281 | 3300025906 | Bacteria | 1168 |
| 201 | Ga0207643_10067620 | 3300025908 | Bacteria | 2051 |
| 202 | Ga0207643_10219438 | 3300025908 | Bacteria | 1163 |
| 203 | Ga0207654_10191202 | 3300025911 | Bacteria | 1342 |
| 204 | Ga0207707_10027138 | 3300025912 | Bacteria | 5007 |
| 205 | Ga0207707_10032067 | 3300025912 | Bacteria | 4600 |
| 206 | Ga0207707_10069599 | 3300025912 | Bacteria | 3067 |
| 207 | Ga0207707_10090231 | 3300025912 | Bacteria | 2678 |
| 208 | Ga0207707_10120685 | 3300025912 | Bacteria | 2292 |
| 209 | Ga0207707_10294481 | 3300025912 | Bacteria | 1404 |
| 210 | Ga0207695_10030776 | 3300025913 | Bacteria | 5905 |
| 211 | Ga0207695_10037866 | 3300025913 | Bacteria | 5201 |
| 212 | Ga0207695_10059336 | 3300025913 | Bacteria | 3968 |
| 213 | Ga0207695_10087344 | 3300025913 | Bacteria | 3141 |
| 214 | Ga0207671_10075016 | 3300025914 | Bacteria | 2529 |
| 215 | Ga0207671_10202974 | 3300025914 | Bacteria | 1549 |
| 216 | Ga0207671_10254490 | 3300025914 | Bacteria | 1381 |
| 217 | Ga0207693_10000448 | 3300025915 | Bacteria | 37696 |
| 218 | Ga0207693_10163089 | 3300025915 | Bacteria | 1754 |
| 219 | Ga0207663_10074257 | 3300025916 | Bacteria | 2203 |
| 220 | Ga0207660_10023662 | 3300025917 | Bacteria | 4151 |
| 221 | Ga0207657_10427464 | 3300025919 | Bacteria | 1041 |
| 222 | Ga0207652_10105226 | 3300025921 | Bacteria | 2497 |
| 223 | Ga0207652_10159759 | 3300025921 | Bacteria | 2020 |
| 224 | Ga0207681_10042404 | 3300025923 | Bacteria | 3039 |
| 225 | Ga0207694_10173145 | 3300025924 | Bacteria | 1748 |
| 226 | Ga0207694_10185946 | 3300025924 | Bacteria | 1686 |
| 227 | Ga0207659_10024731 | 3300025926 | Bacteria | 4028 |
| 228 | Ga0207687_10316600 | 3300025927 | Bacteria | 1262 |
| 229 | Ga0207700_10078177 | 3300025928 | Bacteria | 2573 |
| 230 | Ga0207664_10102147 | 3300025929 | Bacteria | 2370 |
| 231 | Ga0207664_10211583 | 3300025929 | Bacteria | 1678 |
| 232 | Ga0207644_10000428 | 3300025931 | Bacteria | 27319 |
| 233 | Ga0207644_10022460 | 3300025931 | Bacteria | 4310 |
| 234 | Ga0207706_10043777 | 3300025933 | Bacteria | 3967 |
| 235 | Ga0207686_10063556 | 3300025934 | Bacteria | 2348 |
| 236 | Ga0207686_10437371 | 3300025934 | Bacteria | 1004 |
| 237 | Ga0207704_10004775 | 3300025938 | Bacteria | 6223 |
| 238 | Ga0207704_10156059 | 3300025938 | Bacteria | 1618 |
| 239 | Ga0207665_10057059 | 3300025939 | Bacteria | 2637 |
| 240 | Ga0207691_10107136 | 3300025940 | Bacteria | 2488 |
| 241 | Ga0207711_10002222 | 3300025941 | Bacteria | 17420 |
| 242 | Ga0207711_10205483 | 3300025941 | Bacteria | 1798 |
| 243 | Ga0207711_10333190 | 3300025941 | Bacteria | 1404 |
| 244 | Ga0207689_10212625 | 3300025942 | Bacteria | 1598 |
| 245 | Ga0207661_10114061 | 3300025944 | Bacteria | 2291 |
| 246 | Ga0207667_10014085 | 3300025949 | Bacteria | 9130 |
| 247 | Ga0207667_10014175 | 3300025949 | Bacteria | 9098 |
| 248 | Ga0207667_10741364 | 3300025949 | Bacteria | 982 |
| 249 | Ga0207651_10105994 | 3300025960 | Bacteria | 2098 |
| 250 | Ga0207712_10068569 | 3300025961 | Bacteria | 2542 |
| 251 | Ga0207712_10216517 | 3300025961 | Bacteria | 1529 |
| 252 | Ga0207712_10821165 | 3300025961 | Bacteria | 818 |
| 253 | Ga0207668_10381544 | 3300025972 | Bacteria | 1186 |
| 254 | Ga0207640_10353669 | 3300025981 | Bacteria | 1181 |
| 255 | Ga0207658_10000131 | 3300025986 | Bacteria | 80909 |
| 256 | Ga0207658_10011254 | 3300025986 | Bacteria | 6095 |
| 257 | Ga0207658_10019790 | 3300025986 | Bacteria | 4657 |
| 258 | Ga0207703_10001524 | 3300026035 | Bacteria | 21042 |
| 259 | Ga0207703_10105984 | 3300026035 | Bacteria | 2390 |
| 260 | Ga0207703_10114419 | 3300026035 | Bacteria | 2307 |
| 261 | Ga0207703_10180083 | 3300026035 | Bacteria | 1865 |
| 262 | Ga0207639_10105218 | 3300026041 | Bacteria | 2289 |
| 263 | Ga0207678_10034632 | 3300026067 | Bacteria | 4398 |
| 264 | Ga0207678_10611247 | 3300026067 | Bacteria | 956 |
| 265 | Ga0207641_10002325 | 3300026088 | Bacteria | 17632 |
| 266 | Ga0207641_10043349 | 3300026088 | Bacteria | 3778 |
| 267 | Ga0207641_10194858 | 3300026088 | Bacteria | 1864 |
| 268 | Ga0207641_10315214 | 3300026088 | Bacteria | 1481 |
| 269 | Ga0207641_10484636 | 3300026088 | Bacteria | 1199 |
| 270 | Ga0207676_10061162 | 3300026095 | Bacteria | 2981 |
| 271 | Ga0207674_10527105 | 3300026116 | Bacteria | 1141 |
| 272 | Ga0207683_10002499 | 3300026121 | Bacteria | 16042 |
| 273 | Ga0210002_1001714 | 3300027617 | Bacteria | 3127 |
| 274 | Ga0210002_1009747 | 3300027617 | Bacteria | 1468 |
| 275 | Ga0209983_1002487 | 3300027665 | Bacteria | 4031 |
| 276 | Ga0209971_1001640 | 3300027682 | Bacteria | 5538 |
| 277 | Ga0268266_10000943 | 3300028379 | Bacteria | 37110 |
| 278 | Ga0268266_10011246 | 3300028379 | Bacteria | 7790 |
| 279 | Ga0268266_10013564 | 3300028379 | Bacteria | 7018 |
| 280 | Ga0268266_10485147 | 3300028379 | Bacteria | 1178 |
| 281 | Ga0268265_10009976 | 3300028380 | Bacteria | 6411 |
| 282 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 283 | Ga0268264_10038276 | 3300028381 | Bacteria | 3957 |
| 284 | Ga0268264_10141591 | 3300028381 | Bacteria | 2145 |
| 285 | Ga0307515_10034640 | 3300028794 | Bacteria | 8252 |
| 286 | Ga0307511_10000235 | 3300030521 | Bacteria | 56564 |
| 287 | Ga0265763_1004784 | 3300030763 | Bacteria | 1118 |
| 288 | Ga0265760_10006072 | 3300031090 | Bacteria | 3451 |
| 289 | Ga0265330_10028535 | 3300031235 | Bacteria | 2514 |
| 290 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 291 | Ga0307513_10184273 | 3300031456 | Bacteria | 1947 |
| 292 | Ga0307509_10000987 | 3300031507 | Bacteria | 48811 |
| 293 | Ga0307408_100016409 | 3300031548 | Bacteria | 4943 |
| 294 | Ga0316575_10014365 | 3300031665 | Bacteria | 2972 |
| 295 | Ga0316579_10222058 | 3300031691 | Bacteria | 914 |
| 296 | Ga0316576_10009279 | 3300031727 | Bacteria | 6342 |
| 297 | Ga0316576_10022704 | 3300031727 | Bacteria | 4361 |
| 298 | Ga0316576_10064356 | 3300031727 | Bacteria | 2693 |
| 299 | Ga0316576_10096325 | 3300031727 | Bacteria | 2208 |
| 300 | Ga0316578_10167747 | 3300031728 | Bacteria | 1323 |
| 301 | Ga0316578_10324898 | 3300031728 | Bacteria | 918 |
| 302 | Ga0307405_10174028 | 3300031731 | Bacteria | 1538 |
| 303 | Ga0307413_10476480 | 3300031824 | Bacteria | 996 |
| 304 | Ga0307406_10074342 | 3300031901 | Bacteria | 2237 |
| 305 | Ga0307409_100435532 | 3300031995 | Bacteria | 1261 |
| 306 | Ga0307415_100021375 | 3300032126 | Bacteria | 3975 |
| 307 | Ga0316593_10000028 | 3300032168 | Bacteria | 15385 |
| 308 | Ga0316593_10000325 | 3300032168 | Bacteria | 8199 |
| 309 | Ga0316593_10026106 | 3300032168 | Bacteria | 1865 |
| 310 | Ga0316593_10072059 | 3300032168 | Bacteria | 1196 |
| 311 | Ga0316593_10090714 | 3300032168 | Bacteria | 1076 |
| 312 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 313 | Ga0307510_10153566 | 3300033180 | Bacteria | 1914 |
| 314 | Ga0316592_1000006 | 3300033524 | Bacteria | 14706 |
| 315 | Ga0316592_1001885 | 3300033524 | Bacteria | 3511 |
| 316 | Ga0316592_1009411 | 3300033524 | Bacteria | 1955 |
| 317 | Ga0316592_1010690 | 3300033524 | Bacteria | 1855 |
| 318 | Ga0316592_1022795 | 3300033524 | Bacteria | 1341 |
| 319 | Ga0316586_1000040 | 3300033527 | Bacteria | 8841 |
| 320 | Ga0316586_1000370 | 3300033527 | Bacteria | 4227 |
| 321 | Ga0316586_1000884 | 3300033527 | Bacteria | 3162 |
| 322 | Ga0316588_1001236 | 3300033528 | Bacteria | 4108 |
| 323 | Ga0316588_1031795 | 3300033528 | Bacteria | 1240 |
| 324 | Ga0316587_1000021 | 3300033529 | Bacteria | 9386 |
| 325 | Ga0316587_1000022 | 3300033529 | Bacteria | 9239 |
| 326 | Ga0316587_1017202 | 3300033529 | Bacteria | 1210 |
| 327 | Ga0316587_1020058 | 3300033529 | Bacteria | 1133 |
| 328 | Ga0316596_1000016 | 3300033541 | Bacteria | 15149 |
| 329 | Ga0316596_1000026 | 3300033541 | Bacteria | 14495 |
| 330 | Ga0316596_1007663 | 3300033541 | Bacteria | 2556 |
| 331 | Ga0316596_1008172 | 3300033541 | Bacteria | 2488 |
| 332 | Ga0316596_1009566 | 3300033541 | Bacteria | 2327 |
| 333 | Ga0316596_1009806 | 3300033541 | Bacteria | 2303 |
| 334 | Ga0316596_1036926 | 3300033541 | Bacteria | 1278 |
| 335 | Ga0316596_1062126 | 3300033541 | Bacteria | 996 |
| 336 | Ga0373934_0086450 | 3300035086 | Bacteria | 1262 |
| 337 | Ga0373936_0012383 | 3300035113 | Bacteria | 3244 |
| 338 | Ga0373936_0113659 | 3300035113 | Bacteria | 1151 |
| 339 | Ga0373945_0041920 | 3300035116 | Bacteria | 1657 |
| 340 | Ga0373953_0148332 | 3300035117 | Bacteria | 1005 |
| 341 | Ga0373943_0015875 | 3300035170 | Bacteria | 3426 |
| 342 | Ga0373955_0011455 | 3300035172 | Bacteria | 4228 |
| 343 | Ga0373955_0095895 | 3300035172 | Bacteria | 1697 |
| 344 | Ga0316574_0055313 | 3300035398 | Bacteria | 2480 |
| 345 | Ga0316574_0211189 | 3300035398 | Bacteria | 1245 |
| 346 | Ga0373924_0229154 | 3300035410 | Bacteria | 821 |
| 347 | Ga0373927_0047414 | 3300035695 | Bacteria | 2779 |
| 348 | Ga0373933_0039288 | 3300035724 | Bacteria | 2784 |
| 349 | Ga0373947_0161552 | 3300035725 | Bacteria | 1449 |
| 350 | Ga0373937_0001807 | 3300036401 | Bacteria | 17957 |
| 351 | Ga0373937_0109265 | 3300036401 | Bacteria | 2571 |
| 352 | Ga0316582_0611842 | 3300036647 | Bacteria | 750 |
| 353 | Ga0316584_0052488 | 3300036712 | Bacteria | 3049 |
| 354 | Ga0316584_0066465 | 3300036712 | Bacteria | 2702 |
| 355 | Ga0316584_0072965 | 3300036712 | Bacteria | 2572 |
| 356 | Ga0316584_0138191 | 3300036712 | Bacteria | 1818 |
| 357 | Ga0373925_0230527 | 3300037068 | Bacteria | 1481 |
| 358 | Ga0395899_0438450 | 3300037312 | Bacteria | 858 |
| 359 | Ga0395900_0684668 | 3300037418 | Bacteria | 960 |
| 360 | Ga0395898_0081820 | 3300037466 | Bacteria | 3113 |
| 361 | Ga0395898_0206094 | 3300037466 | Bacteria | 1876 |
| 362 | Ga0395898_0631487 | 3300037466 | Bacteria | 1014 |
| 363 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 364 | Ga0400490_39901 | 3300038726 | Bacteria | 15663 |
| 365 | Ga0400491_03590 | 3300038727 | Bacteria | 1419 |
| 366 | Ga0400488_58342 | 3300038741 | Bacteria | 2007 |
| 367 | Ga0400487_33558 | 3300039110 | Bacteria | 1049 |
| 368 | Ga0400487_66163 | 3300039110 | Bacteria | 6500 |
| 369 | Ga0436365_0602380 | 3300039437 | Bacteria | 1236 |
| 370 | Ga0436365_1354175 | 3300039437 | Bacteria | 1645 |
| 371 | Ga0436360_0362694 | 3300039438 | Bacteria | 3842 |
| 372 | Ga0436360_0561928 | 3300039438 | Bacteria | 3033 |
| 373 | Ga0436360_0908003 | 3300039438 | Bacteria | 5627 |
| 374 | Ga0436361_1033248 | 3300039447 | Bacteria | 1017 |
| 375 | Ga0436363_0556173 | 3300039450 | Bacteria | 5699 |
| 376 | Ga0436363_1105124 | 3300039450 | Bacteria | 718 |
| 377 | Ga0436362_0845588 | 3300039453 | Bacteria | 2759 |
| 378 | Ga0439439_0006907 | 3300041406 | Bacteria | 2635 |
| 379 | Ga0439431_0013051 | 3300041997 | Bacteria | 1914 |
| 380 | Ga0439433_0013255 | 3300041999 | Bacteria | 1809 |
| 381 | Ga0439441_025217 | 3300042001 | Bacteria | 1121 |
| 382 | Ga0450920_008609 | 3300042122 | Bacteria | 1868 |
| 383 | Ga0450921_002224 | 3300042123 | Bacteria | 1269 |
| 384 | Ga0450923_007844 | 3300042125 | Bacteria | 1819 |
| 385 | Ga0450923_007882 | 3300042125 | Bacteria | 1816 |
| 386 | Ga0450895_000997 | 3300042132 | Bacteria | 1855 |
| 387 | Ga0450896_000981 | 3300042133 | Bacteria | 3318 |
| 388 | Ga0450898_009537 | 3300042134 | Bacteria | 1555 |
| 389 | Ga0450899_009972 | 3300042135 | Bacteria | 1050 |
| 390 | Ga0450910_002509 | 3300042147 | Bacteria | 2411 |
| 391 | Ga0439446_0010521 | 3300042156 | Bacteria | 2493 |
| 392 | Ga0450908_001700 | 3300042184 | Bacteria | 4283 |
| 393 | Ga0439434_0055903 | 3300042435 | Bacteria | 1229 |
| 394 | Ga0439435_0006321 | 3300042436 | Bacteria | 2657 |
| 395 | Ga0439460_0001652 | 3300042461 | Bacteria | 5282 |
| 396 | Ga0450893_0017941 | 3300042532 | Bacteria | 1204 |
| 397 | Ga0451577_0008152 | 3300042876 | Bacteria | 10217 |
| 398 | Ga0466969_0002476 | 3300044656 | Bacteria | 9861 |
| 399 | Ga0466969_0260721 | 3300044656 | Bacteria | 785 |
| 400 | Ga0453683_0005334 | 3300044673 | Bacteria | 8982 |
| 401 | Ga0466966_0002570 | 3300044684 | Bacteria | 11886 |
| 402 | Ga0466966_0220128 | 3300044684 | Bacteria | 1146 |
| 403 | Ga0466961_0016727 | 3300044693 | Bacteria | 4715 |
| 404 | Ga0466964_0012273 | 3300044706 | Bacteria | 3242 |
| 405 | Ga0453684_0043943 | 3300044712 | Bacteria | 5991 |
| 406 | Ga0466968_0152700 | 3300044735 | Bacteria | 1062 |
| 407 | Ga0466970_0018566 | 3300044765 | Bacteria | 3601 |
| 408 | Ga0466957_0007884 | 3300044842 | Bacteria | 6039 |
| 409 | Ga0466959_0002822 | 3300045049 | Bacteria | 11197 |
| 410 | Ga0466959_0022213 | 3300045049 | Bacteria | 4687 |
| 411 | Ga0466959_0182791 | 3300045049 | Bacteria | 1466 |
| 412 | Ga0466959_0362466 | 3300045049 | Bacteria | 987 |
| 413 | Ga0451576_0098246 | 3300045051 | Bacteria | 3045 |
| 414 | Ga0466958_0177421 | 3300045836 | Bacteria | 1351 |
| 415 | Ga0495580_0141191 | 3300046472 | Bacteria | 1669 |
| 416 | Ga0495580_0167561 | 3300046472 | Bacteria | 1519 |
| 417 | Ga0495580_0649999 | 3300046472 | Bacteria | 693 |
| 418 | Ga0495664_0240740 | 3300046477 | Bacteria | 1095 |
| 419 | Ga0495606_0042851 | 3300046507 | Bacteria | 3024 |
| 420 | Ga0495630_0026241 | 3300046517 | Bacteria | 4312 |
| 421 | Ga0495643_0158616 | 3300046522 | Bacteria | 1115 |
| 422 | Ga0495666_0184389 | 3300046526 | Bacteria | 963 |
| 423 | Ga0495587_0019207 | 3300046536 | Bacteria | 4234 |
| 424 | Ga0495621_0104182 | 3300046539 | Bacteria | 1082 |
| 425 | Ga0495645_0410584 | 3300046543 | Bacteria | 861 |
| 426 | Ga0495657_0150741 | 3300046675 | Bacteria | 1444 |
| 427 | Ga0495599_0121138 | 3300046678 | Bacteria | 1626 |
| 428 | Ga0495623_0050975 | 3300046679 | Bacteria | 2620 |
| 429 | Ga0495649_0197017 | 3300046694 | Bacteria | 1047 |
| 430 | Ga0495687_052847 | 3300047443 | Bacteria | 1715 |
| 431 | Ga0495681_0028694 | 3300047470 | Bacteria | 2859 |
| 432 | Ga0496100_0088239 | 3300048903 | Bacteria | 2110 |
| 433 | Ga0496100_0389731 | 3300048903 | Bacteria | 1059 |
| 434 | Ga0496101_0019992 | 3300048904 | Bacteria | 4579 |
| 435 | Ga0496102_0009299 | 3300048905 | Bacteria | 8437 |
| 436 | Ga0496102_0014665 | 3300048905 | Bacteria | 6813 |
| 437 | Ga0496102_0053702 | 3300048905 | Bacteria | 3672 |
| 438 | Ga0496102_0070282 | 3300048905 | Bacteria | 3214 |
| 439 | Ga0496103_0058907 | 3300048906 | Bacteria | 2386 |
| 440 | Ga0496104_0002304 | 3300048907 | Bacteria | 16478 |
| 441 | Ga0496104_0381243 | 3300048907 | Bacteria | 1323 |
| 442 | Ga0496105_0003469 | 3300048908 | Bacteria | 11665 |
| 443 | Ga0496105_0096203 | 3300048908 | Bacteria | 2445 |
| 444 | Ga0496105_0221104 | 3300048908 | Bacteria | 1542 |
| 445 | Ga0496106_0028441 | 3300048909 | Bacteria | 4164 |
| 446 | Ga0496106_0391327 | 3300048909 | Bacteria | 1117 |
| 447 | Ga0496107_0001576 | 3300048910 | Bacteria | 14181 |
| 448 | Ga0496107_0137570 | 3300048910 | Bacteria | 1805 |
| 449 | Ga0496108_0002086 | 3300048911 | Bacteria | 15999 |
| 450 | Ga0496108_0013190 | 3300048911 | Bacteria | 6735 |
| 451 | Ga0496108_0182334 | 3300048911 | Bacteria | 1818 |
| 452 | Ga0496109_0067040 | 3300048912 | Bacteria | 3287 |
| 453 | Ga0496110_0011624 | 3300048913 | Bacteria | 7217 |
| 454 | Ga0496110_0017578 | 3300048913 | Bacteria | 5980 |
| 455 | Ga0496111_0001868 | 3300048914 | Bacteria | 12443 |
| 456 | Ga0496111_0092759 | 3300048914 | Bacteria | 2213 |
| 457 | Ga0496112_0070013 | 3300048915 | Bacteria | 3466 |
| 458 | Ga0496112_0463120 | 3300048915 | Bacteria | 1205 |
| 459 | Ga0496113_0090410 | 3300048916 | Bacteria | 2358 |
| 460 | Ga0496113_0130906 | 3300048916 | Bacteria | 1969 |
| 461 | Ga0496114_0042545 | 3300048917 | Bacteria | 3766 |
| 462 | Ga0496114_0074247 | 3300048917 | Bacteria | 2862 |
| 463 | Ga0496116_0190449 | 3300048919 | Bacteria | 1086 |
| 464 | Ga0496117_0000787 | 3300048920 | Bacteria | 49745 |
| 465 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 466 | Ga0496119_0012506 | 3300048922 | Bacteria | 6886 |
| 467 | Ga0496119_0050187 | 3300048922 | Bacteria | 2573 |
| 468 | Ga0496120_0021776 | 3300048923 | Bacteria | 4042 |
| 469 | Ga0496121_0028073 | 3300048924 | Bacteria | 5247 |
| 470 | Ga0496121_0061867 | 3300048924 | Bacteria | 3069 |
| 471 | Ga0496121_0157167 | 3300048924 | Bacteria | 1667 |
| 472 | Ga0496124_0055985 | 3300048927 | Bacteria | 3329 |
| 473 | Ga0496125_0001378 | 3300048928 | Bacteria | 35674 |
| 474 | Ga0496125_0020647 | 3300048928 | Bacteria | 6177 |
| 475 | Ga0496125_0022367 | 3300048928 | Bacteria | 5873 |
| 476 | Ga0496126_0004928 | 3300048929 | Bacteria | 15582 |
| 477 | Ga0496126_0011396 | 3300048929 | Bacteria | 9209 |
| 478 | Ga0496126_0130504 | 3300048929 | Bacteria | 2172 |
| 479 | Ga0501317_009998 | 3300049533 | Bacteria | 1125 |
| 480 | Ga0501037_0219855 | 3300049573 | Bacteria | 1337 |
| 481 | Ga0501038_0085350 | 3300049574 | Bacteria | 2655 |
| 482 | Ga0501039_0183373 | 3300049575 | Bacteria | 1646 |
| 483 | Ga0501039_0345334 | 3300049575 | Bacteria | 1169 |
| 484 | Ga0501046_0201610 | 3300049580 | Bacteria | 1480 |
| 485 | Ga0501067_0010361 | 3300049583 | Bacteria | 5158 |
| 486 | Ga0501068_0071871 | 3300049584 | Bacteria | 2112 |
| 487 | Ga0501071_0118123 | 3300049587 | Bacteria | 1964 |
| 488 | Ga0501072_0006368 | 3300049588 | Bacteria | 8989 |
| 489 | Ga0501073_0152302 | 3300049589 | Bacteria | 1602 |
| 490 | Ga0501074_0073803 | 3300049590 | Bacteria | 2450 |
| 491 | Ga0501076_0153543 | 3300049592 | Bacteria | 1873 |
| 492 | Ga0501076_0256165 | 3300049592 | Bacteria | 1432 |
| 493 | Ga0501077_0031057 | 3300049593 | Bacteria | 3398 |
| 494 | Ga0501077_0060020 | 3300049593 | Bacteria | 2414 |
| 495 | Ga0501079_0027935 | 3300049741 | Bacteria | 4327 |
| 496 | Ga0501079_0153094 | 3300049741 | Bacteria | 1797 |
| 497 | Ga0501079_0276651 | 3300049741 | Bacteria | 1312 |
| 498 | Ga0501080_0022485 | 3300049742 | Bacteria | 5841 |
| 499 | Ga0501080_0032199 | 3300049742 | Bacteria | 4888 |
| 500 | Ga0501083_0114597 | 3300049744 | Bacteria | 1770 |
| 501 | Ga0501083_0133691 | 3300049744 | Bacteria | 1626 |
| 502 | Ga0501035_0798344 | 3300049822 | Bacteria | 754 |
| 503 | Ga0501045_0069991 | 3300049824 | Bacteria | 2580 |
| 504 | nmdc:mga0qj67_204738_c1 | 3300050509 | Bacteria | 1603 |
| 505 | nmdc:mga08y16_52691_c1 | 3300050511 | Bacteria | 4257 |
| 506 | nmdc:mga08x19_67683_c1 | 3300050514 | Bacteria | 2323 |
| 507 | Ga0495612_0122898 | 3300053078 | Bacteria | 1117 |
| 508 | Ga0495619_0241771 | 3300053085 | Bacteria | 1251 |
| 509 | Ga0500556_0000700 | 3300053104 | Bacteria | 20573 |
| 510 | Ga0500591_052893 | 3300053115 | Bacteria | 1899 |
| 511 | Ga0500614_084529 | 3300053123 | Bacteria | 893 |
| 512 | Ga0500622_0035350 | 3300053156 | Bacteria | 2615 |
| 513 | Ga0500636_0255292 | 3300053177 | Bacteria | 891 |
| 514 | Ga0500637_0004292 | 3300053178 | Bacteria | 6744 |
| 515 | Ga0500637_0057154 | 3300053178 | Bacteria | 2230 |
| 516 | Ga0501084_0011273 | 3300054114 | Bacteria | 7399 |
| 517 | Ga0501084_0240788 | 3300054114 | Bacteria | 1527 |
| 518 | Ga0587084_005426 | 3300059477 | Bacteria | 1510 |
| 519 | Ga0587111_0008813 | 3300060346 | Bacteria | 1683 |
| 520 | Ga0501082_0035746 | 3300060353 | Bacteria | 4281 |
| 521 | Ga0501082_0037651 | 3300060353 | Bacteria | 4171 |
| 522 | Ga0466962_0001207 | 3300061719 | Bacteria | 11873 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0241771 | Ga0495619_0241771_440_1156 | 172 |
| 2 | 3300039437 | Ga0436365_1354175 | Ga0436365_1354175_662_1384 | 177 |
| 3 | 3300039453 | Ga0436362_0845588 | Ga0436362_0845588_445_1167 | 177 |
| 4 | 3300050509 | nmdc:mga0qj67_204738_c1 | nmdc:mga0qj67_204738_c1_568_1212 | 178 |
| 5 | 3300048907 | Ga0496104_0002304 | Ga0496104_0002304_14987_15703 | 179 |
| 6 | 3300048908 | Ga0496105_0096203 | Ga0496105_0096203_755_1471 | 179 |
| 7 | 3300048911 | Ga0496108_0013190 | Ga0496108_0013190_776_1492 | 179 |
| 8 | 3300048913 | Ga0496110_0011624 | Ga0496110_0011624_5754_6470 | 179 |
| 9 | 3300048914 | Ga0496111_0001868 | Ga0496111_0001868_3821_4537 | 179 |
| 10 | 3300048917 | Ga0496114_0042545 | Ga0496114_0042545_2780_3496 | 179 |
| 11 | 3300021361 | Ga0213872_10188334 | Ga0213872_101883341 | 182 |
| 12 | 3300039438 | Ga0436360_0362694 | Ga0436360_0362694_2587_3309 | 182 |
| 13 | 3300039447 | Ga0436361_1033248 | Ga0436361_1033248_68_790 | 182 |
| 14 | 3300013308 | Ga0157375_10224546 | Ga0157375_102245462 | 183 |
| 15 | 3300021377 | Ga0213874_10062026 | Ga0213874_100620262 | 183 |
| 16 | 3300039450 | Ga0436363_0556173 | Ga0436363_0556173_1337_2059 | 185 |
| 17 | 3300014326 | Ga0157380_10032693 | Ga0157380_100326933 | 188 |
| 18 | 3300049573 | Ga0501037_0219855 | Ga0501037_0219855_395_1075 | 189 |
| 19 | 3300049574 | Ga0501038_0085350 | Ga0501038_0085350_1593_2273 | 189 |
| 20 | 3300049575 | Ga0501039_0345334 | Ga0501039_0345334_291_971 | 189 |
| 21 | 3300049580 | Ga0501046_0201610 | Ga0501046_0201610_64_744 | 189 |
| 22 | 3300049584 | Ga0501068_0071871 | Ga0501068_0071871_910_1590 | 189 |
| 23 | 3300049587 | Ga0501071_0118123 | Ga0501071_0118123_765_1445 | 189 |
| 24 | 3300049588 | Ga0501072_0006368 | Ga0501072_0006368_597_1277 | 189 |
| 25 | 3300049592 | Ga0501076_0153543 | Ga0501076_0153543_642_1322 | 189 |
| 26 | 3300049741 | Ga0501079_0027935 | Ga0501079_0027935_3097_3777 | 189 |
| 27 | 3300049742 | Ga0501080_0032199 | Ga0501080_0032199_3458_4138 | 189 |
| 28 | 3300049744 | Ga0501083_0114597 | Ga0501083_0114597_594_1274 | 189 |
| 29 | 3300049822 | Ga0501035_0798344 | Ga0501035_0798344_46_726 | 189 |
| 30 | 3300049824 | Ga0501045_0069991 | Ga0501045_0069991_1835_2515 | 189 |
| 31 | 3300060353 | Ga0501082_0035746 | Ga0501082_0035746_563_1243 | 189 |
| 32 | 3300005335 | Ga0070666_10040531 | Ga0070666_100405312 | 190 |
| 33 | 3300005340 | Ga0070689_100059541 | Ga0070689_1000595414 | 190 |
| 34 | 3300005355 | Ga0070671_100149605 | Ga0070671_1001496053 | 190 |
| 35 | 3300005364 | Ga0070673_100269144 | Ga0070673_1002691442 | 190 |
| 36 | 3300005367 | Ga0070667_100025221 | Ga0070667_1000252213 | 190 |
| 37 | 3300005459 | Ga0068867_100184337 | Ga0068867_1001843371 | 190 |
| 38 | 3300005459 | Ga0068867_100199434 | Ga0068867_1001994342 | 190 |
| 39 | 3300005543 | Ga0070672_100194982 | Ga0070672_1001949823 | 190 |
| 40 | 3300005548 | Ga0070665_100090458 | Ga0070665_1000904583 | 190 |
| 41 | 3300005549 | Ga0070704_100763508 | Ga0070704_1007635081 | 190 |
| 42 | 3300005617 | Ga0068859_100094378 | Ga0068859_1000943783 | 190 |
| 43 | 3300005618 | Ga0068864_100007914 | Ga0068864_1000079143 | 190 |
| 44 | 3300005841 | Ga0068863_100007442 | Ga0068863_10000744221 | 190 |
| 45 | 3300005841 | Ga0068863_100543284 | Ga0068863_1005432841 | 190 |
| 46 | 3300005842 | Ga0068858_100186119 | Ga0068858_1001861193 | 190 |
| 47 | 3300005843 | Ga0068860_100078629 | Ga0068860_1000786293 | 190 |
| 48 | 3300006237 | Ga0097621_100058060 | Ga0097621_1000580603 | 190 |
| 49 | 3300006358 | Ga0068871_100058952 | Ga0068871_1000589523 | 190 |
| 50 | 3300006931 | Ga0097620_100094378 | Ga0097620_1000943783 | 190 |
| 51 | 3300009098 | Ga0105245_10002714 | Ga0105245_100027143 | 190 |
| 52 | 3300009176 | Ga0105242_10026778 | Ga0105242_100267783 | 190 |
| 53 | 3300009176 | Ga0105242_10383798 | Ga0105242_103837981 | 190 |
| 54 | 3300009177 | Ga0105248_10006447 | Ga0105248_100064473 | 190 |
| 55 | 3300013296 | Ga0157374_10009580 | Ga0157374_1000958016 | 190 |
| 56 | 3300013297 | Ga0157378_10004652 | Ga0157378_1000465224 | 190 |
| 57 | 3300013306 | Ga0163162_10007547 | Ga0163162_100075473 | 190 |
| 58 | 3300013308 | Ga0157375_10003225 | Ga0157375_100032253 | 190 |
| 59 | 3300013308 | Ga0157375_10362616 | Ga0157375_103626162 | 190 |
| 60 | 3300014325 | Ga0163163_10059072 | Ga0163163_100590724 | 190 |
| 61 | 3300014326 | Ga0157380_10065115 | Ga0157380_100651154 | 190 |
| 62 | 3300014969 | Ga0157376_10093347 | Ga0157376_100933474 | 190 |
| 63 | 3300017792 | Ga0163161_10229375 | Ga0163161_102293752 | 190 |
| 64 | 3300025903 | Ga0207680_10143707 | Ga0207680_101437072 | 190 |
| 65 | 3300025926 | Ga0207659_10024731 | Ga0207659_100247313 | 190 |
| 66 | 3300025934 | Ga0207686_10063556 | Ga0207686_100635562 | 190 |
| 67 | 3300025934 | Ga0207686_10437371 | Ga0207686_104373712 | 190 |
| 68 | 3300025941 | Ga0207711_10002222 | Ga0207711_100022223 | 190 |
| 69 | 3300025960 | Ga0207651_10105994 | Ga0207651_101059943 | 190 |
| 70 | 3300026088 | Ga0207641_10043349 | Ga0207641_100433491 | 190 |
| 71 | 3300026088 | Ga0207641_10484636 | Ga0207641_104846361 | 190 |
| 72 | 3300026095 | Ga0207676_10061162 | Ga0207676_100611623 | 190 |
| 73 | 3300028379 | Ga0268266_10011246 | Ga0268266_1001124617 | 190 |
| 74 | 3300031727 | Ga0316576_10096325 | Ga0316576_100963253 | 190 |
| 75 | 3300031728 | Ga0316578_10167747 | Ga0316578_101677471 | 190 |
| 76 | 3300036712 | Ga0316584_0052488 | Ga0316584_0052488_589_1269 | 190 |
| 77 | 3300025940 | Ga0207691_10107136 | Ga0207691_101071364 | 191 |
| 78 | 3300049741 | Ga0501079_0276651 | Ga0501079_0276651_562_1242 | 192 |
| 79 | 3300054114 | Ga0501084_0240788 | Ga0501084_0240788_479_1159 | 192 |
| 80 | 3300005331 | Ga0070670_100542929 | Ga0070670_1005429291 | 193 |
| 81 | 3300005354 | Ga0070675_100156400 | Ga0070675_1001564003 | 193 |
| 82 | 3300005458 | Ga0070681_10166379 | Ga0070681_101663792 | 193 |
| 83 | 3300005577 | Ga0068857_100333296 | Ga0068857_1003332962 | 193 |
| 84 | 3300014326 | Ga0157380_10034739 | Ga0157380_100347392 | 193 |
| 85 | 3300025942 | Ga0207689_10212625 | Ga0207689_102126252 | 193 |
| 86 | 3300047470 | Ga0495681_0028694 | Ga0495681_0028694_75_788 | 193 |
| 87 | 3300049575 | Ga0501039_0183373 | Ga0501039_0183373_128_808 | 193 |
| 88 | 3300005353 | Ga0070669_100006485 | Ga0070669_10000648515 | 194 |
| 89 | 3300005459 | Ga0068867_100257860 | Ga0068867_1002578602 | 194 |
| 90 | 3300042122 | Ga0450920_008609 | Ga0450920_008609_240_920 | 194 |
| 91 | 3300042125 | Ga0450923_007882 | Ga0450923_007882_1065_1745 | 194 |
| 92 | 3300042133 | Ga0450896_000981 | Ga0450896_000981_626_1306 | 194 |
| 93 | 3300042134 | Ga0450898_009537 | Ga0450898_009537_638_1318 | 194 |
| 94 | 3300042135 | Ga0450899_009972 | Ga0450899_009972_113_793 | 194 |
| 95 | 3300042147 | Ga0450910_002509 | Ga0450910_002509_1043_1723 | 194 |
| 96 | 3300042184 | Ga0450908_001700 | Ga0450908_001700_528_1208 | 194 |
| 97 | 3300049593 | Ga0501077_0060020 | Ga0501077_0060020_32_712 | 194 |
| 98 | 3300031235 | Ga0265330_10028535 | Ga0265330_100285352 | 195 |
| 99 | 3300035117 | Ga0373953_0148332 | Ga0373953_0148332_370_981 | 195 |
| 100 | 3300039438 | Ga0436360_0561928 | Ga0436360_0561928_712_1440 | 195 |
| 101 | 3300039450 | Ga0436363_1105124 | Ga0436363_1105124_46_657 | 195 |
| 102 | 3300050514 | nmdc:mga08x19_67683_c1 | nmdc:mga08x19_67683_c1_520_1239 | 195 |
| 103 | 3300005435 | Ga0070714_100037919 | Ga0070714_1000379192 | 196 |
| 104 | 3300005436 | Ga0070713_100001795 | Ga0070713_1000017954 | 196 |
| 105 | 3300006028 | Ga0070717_10016779 | Ga0070717_100167797 | 196 |
| 106 | 3300006173 | Ga0070716_100003910 | Ga0070716_1000039103 | 196 |
| 107 | 3300009987 | Ga0105030_100588 | Ga0105030_1005885 | 196 |
| 108 | 3300025906 | Ga0207699_10017117 | Ga0207699_100171171 | 196 |
| 109 | 3300025908 | Ga0207643_10067620 | Ga0207643_100676202 | 196 |
| 110 | 3300025928 | Ga0207700_10078177 | Ga0207700_100781772 | 196 |
| 111 | 3300025929 | Ga0207664_10102147 | Ga0207664_101021474 | 196 |
| 112 | 3300027617 | Ga0210002_1001714 | Ga0210002_10017146 | 196 |
| 113 | 3300027665 | Ga0209983_1002487 | Ga0209983_10024877 | 196 |
| 114 | 3300027682 | Ga0209971_1001640 | Ga0209971_10016403 | 196 |
| 115 | 3300028794 | Ga0307515_10034640 | Ga0307515_1003464016 | 196 |
| 116 | 3300031456 | Ga0307513_10184273 | Ga0307513_101842732 | 196 |
| 117 | 3300031548 | Ga0307408_100016409 | Ga0307408_1000164093 | 196 |
| 118 | 3300031731 | Ga0307405_10174028 | Ga0307405_101740283 | 196 |
| 119 | 3300031824 | Ga0307413_10476480 | Ga0307413_104764801 | 196 |
| 120 | 3300031901 | Ga0307406_10074342 | Ga0307406_100743423 | 196 |
| 121 | 3300031995 | Ga0307409_100435532 | Ga0307409_1004355322 | 196 |
| 122 | 3300032126 | Ga0307415_100021375 | Ga0307415_1000213753 | 196 |
| 123 | 3300041406 | Ga0439439_0006907 | Ga0439439_0006907_299_979 | 196 |
| 124 | 3300041997 | Ga0439431_0013051 | Ga0439431_0013051_217_897 | 196 |
| 125 | 3300041999 | Ga0439433_0013255 | Ga0439433_0013255_265_945 | 196 |
| 126 | 3300042001 | Ga0439441_025217 | Ga0439441_025217_188_868 | 196 |
| 127 | 3300042123 | Ga0450921_002224 | Ga0450921_002224_551_1231 | 196 |
| 128 | 3300042125 | Ga0450923_007844 | Ga0450923_007844_994_1674 | 196 |
| 129 | 3300042132 | Ga0450895_000997 | Ga0450895_000997_1102_1782 | 196 |
| 130 | 3300042156 | Ga0439446_0010521 | Ga0439446_0010521_1772_2452 | 196 |
| 131 | 3300042435 | Ga0439434_0055903 | Ga0439434_0055903_71_751 | 196 |
| 132 | 3300042436 | Ga0439435_0006321 | Ga0439435_0006321_182_862 | 196 |
| 133 | 3300042461 | Ga0439460_0001652 | Ga0439460_0001652_711_1391 | 196 |
| 134 | 3300042532 | Ga0450893_0017941 | Ga0450893_0017941_167_847 | 196 |
| 135 | 3300044656 | Ga0466969_0002476 | Ga0466969_0002476_8292_9014 | 196 |
| 136 | 3300048903 | Ga0496100_0389731 | Ga0496100_0389731_215_925 | 196 |
| 137 | 3300048910 | Ga0496107_0137570 | Ga0496107_0137570_849_1568 | 196 |
| 138 | 3300048915 | Ga0496112_0070013 | Ga0496112_0070013_2525_3235 | 196 |
| 139 | 3300048916 | Ga0496113_0130906 | Ga0496113_0130906_347_1057 | 196 |
| 140 | 3300049583 | Ga0501067_0010361 | Ga0501067_0010361_4360_5040 | 196 |
| 141 | 3300049589 | Ga0501073_0152302 | Ga0501073_0152302_641_1321 | 196 |
| 142 | 3300049590 | Ga0501074_0073803 | Ga0501074_0073803_1740_2420 | 196 |
| 143 | 3300049592 | Ga0501076_0256165 | Ga0501076_0256165_737_1417 | 196 |
| 144 | 3300049593 | Ga0501077_0031057 | Ga0501077_0031057_1206_1886 | 196 |
| 145 | 3300049741 | Ga0501079_0153094 | Ga0501079_0153094_15_695 | 196 |
| 146 | 3300049742 | Ga0501080_0022485 | Ga0501080_0022485_5075_5755 | 196 |
| 147 | 3300049744 | Ga0501083_0133691 | Ga0501083_0133691_741_1421 | 196 |
| 148 | 3300054114 | Ga0501084_0011273 | Ga0501084_0011273_69_749 | 196 |
| 149 | 3300060353 | Ga0501082_0037651 | Ga0501082_0037651_2851_3531 | 196 |
| 150 | 3300004799 | Ga0058863_11858572 | Ga0058863_118585721 | 197 |
| 151 | 3300004800 | Ga0058861_12059673 | Ga0058861_120596731 | 197 |
| 152 | 3300005458 | Ga0070681_10001074 | Ga0070681_100010744 | 197 |
| 153 | 3300005548 | Ga0070665_100072878 | Ga0070665_1000728784 | 197 |
| 154 | 3300006173 | Ga0070716_100136660 | Ga0070716_1001366602 | 197 |
| 155 | 3300006175 | Ga0070712_100048988 | Ga0070712_1000489885 | 197 |
| 156 | 3300009093 | Ga0105240_10010598 | Ga0105240_100105983 | 197 |
| 157 | 3300009093 | Ga0105240_10050500 | Ga0105240_100505004 | 197 |
| 158 | 3300009545 | Ga0105237_10031936 | Ga0105237_100319365 | 197 |
| 159 | 3300009551 | Ga0105238_10048429 | Ga0105238_100484294 | 197 |
| 160 | 3300013105 | Ga0157369_10556663 | Ga0157369_105566632 | 197 |
| 161 | 3300013307 | Ga0157372_10225941 | Ga0157372_102259412 | 197 |
| 162 | 3300020070 | Ga0206356_11287737 | Ga0206356_112877371 | 197 |
| 163 | 3300021441 | Ga0213871_10001968 | Ga0213871_100019683 | 197 |
| 164 | 3300025912 | Ga0207707_10069599 | Ga0207707_100695994 | 197 |
| 165 | 3300025913 | Ga0207695_10030776 | Ga0207695_100307763 | 197 |
| 166 | 3300025915 | Ga0207693_10163089 | Ga0207693_101630892 | 197 |
| 167 | 3300025924 | Ga0207694_10173145 | Ga0207694_101731454 | 197 |
| 168 | 3300025939 | Ga0207665_10057059 | Ga0207665_100570593 | 197 |
| 169 | 3300025949 | Ga0207667_10014175 | Ga0207667_1001417519 | 197 |
| 170 | 3300028379 | Ga0268266_10013564 | Ga0268266_1001356413 | 197 |
| 171 | 3300031090 | Ga0265760_10006072 | Ga0265760_100060724 | 197 |
| 172 | 3300039438 | Ga0436360_0908003 | Ga0436360_0908003_1570_2292 | 197 |
| 173 | 3300045049 | Ga0466959_0002822 | Ga0466959_0002822_867_1589 | 197 |
| 174 | 3300005434 | Ga0070709_10036484 | Ga0070709_100364844 | 198 |
| 175 | 3300005437 | Ga0070710_10054813 | Ga0070710_100548131 | 198 |
| 176 | 3300005545 | Ga0070695_100002554 | Ga0070695_10000255418 | 198 |
| 177 | 3300025929 | Ga0207664_10211583 | Ga0207664_102115832 | 198 |
| 178 | 3300036647 | Ga0316582_0611842 | Ga0316582_0611842_103_705 | 200 |
| 179 | 3300036712 | Ga0316584_0072965 | Ga0316584_0072965_731_1333 | 200 |
| 180 | 3300036712 | Ga0316584_0138191 | Ga0316584_0138191_708_1310 | 200 |
| 181 | 3300005842 | Ga0068858_100250658 | Ga0068858_1002506583 | 202 |
| 182 | 3300014968 | Ga0157379_10073756 | Ga0157379_100737563 | 202 |
| 183 | 3300026035 | Ga0207703_10180083 | Ga0207703_101800832 | 202 |
| 184 | 3300046472 | Ga0495580_0649999 | Ga0495580_0649999_11_655 | 206 |
| 185 | 3300031727 | Ga0316576_10022704 | Ga0316576_100227043 | 207 |
| 186 | 3300053177 | Ga0500636_0255292 | Ga0500636_0255292_68_757 | 208 |
| 187 | 3300053178 | Ga0500637_0057154 | Ga0500637_0057154_717_1448 | 208 |
| 188 | iso_pu_bacteria | 2687453129 | 2687580636 | 208 |
| 189 | iso_pu_bacteria | 2952252522 | 2952256176 | 208 |
| 190 | iso_pu_bacteria | 8057160832 | 8057163875 | 208 |
| 191 | 3300033527 | Ga0316586_1000884 | Ga0316586_10008846 | 210 |
| 192 | 3300035410 | Ga0373924_0229154 | Ga0373924_0229154_19_675 | 210 |
| 193 | 3300047443 | Ga0495687_052847 | Ga0495687_052847_1039_1695 | 210 |
| 194 | 3300048919 | Ga0496116_0190449 | Ga0496116_0190449_420_1076 | 210 |
| 195 | 3300031691 | Ga0316579_10222058 | Ga0316579_102220582 | 211 |
| 196 | 3300031727 | Ga0316576_10009279 | Ga0316576_100092792 | 211 |
| 197 | 3300031727 | Ga0316576_10064356 | Ga0316576_100643564 | 211 |
| 198 | 3300033524 | Ga0316592_1022795 | Ga0316592_10227952 | 211 |
| 199 | 3300033529 | Ga0316587_1017202 | Ga0316587_10172022 | 211 |
| 200 | 3300033541 | Ga0316596_1008172 | Ga0316596_10081725 | 211 |
| 201 | 3300033541 | Ga0316596_1036926 | Ga0316596_10369262 | 211 |
| 202 | 3300033541 | Ga0316596_1062126 | Ga0316596_10621262 | 211 |
| 203 | 3300035398 | Ga0316574_0055313 | Ga0316574_0055313_1577_2212 | 211 |
| 204 | 3300035398 | Ga0316574_0211189 | Ga0316574_0211189_89_724 | 211 |
| 205 | iso_pu_bacteria | 8056054917 | 8056058654 | 211 |
| 206 | 3300005336 | Ga0070680_100014132 | Ga0070680_1000141324 | 212 |
| 207 | 3300022467 | Ga0224712_10115888 | Ga0224712_101158881 | 212 |
| 208 | 3300025912 | Ga0207707_10027138 | Ga0207707_100271388 | 212 |
| 209 | 3300025917 | Ga0207660_10023662 | Ga0207660_100236624 | 212 |
| 210 | 3300025921 | Ga0207652_10105226 | Ga0207652_101052264 | 212 |
| 211 | 3300031251 | Ga0265327_10000005 | Ga0265327_10000005178 | 212 |
| 212 | 3300031728 | Ga0316578_10324898 | Ga0316578_103248981 | 212 |
| 213 | 3300032168 | Ga0316593_10026106 | Ga0316593_100261061 | 212 |
| 214 | 3300033524 | Ga0316592_1001885 | Ga0316592_10018851 | 212 |
| 215 | 3300033527 | Ga0316586_1000370 | Ga0316586_10003704 | 212 |
| 216 | 3300033528 | Ga0316588_1031795 | Ga0316588_10317952 | 212 |
| 217 | 3300033529 | Ga0316587_1000022 | Ga0316587_100002220 | 212 |
| 218 | 3300033541 | Ga0316596_1000026 | Ga0316596_10000264 | 212 |
| 219 | 3300031665 | Ga0316575_10014365 | Ga0316575_100143652 | 213 |
| 220 | 3300033529 | Ga0316587_1020058 | Ga0316587_10200582 | 213 |
| 221 | 3300010375 | Ga0105239_10057866 | Ga0105239_100578664 | 214 |
| 222 | 3300032168 | Ga0316593_10000325 | Ga0316593_1000032514 | 214 |
| 223 | 3300032168 | Ga0316593_10072059 | Ga0316593_100720592 | 214 |
| 224 | 3300032168 | Ga0316593_10090714 | Ga0316593_100907142 | 214 |
| 225 | 3300033524 | Ga0316592_1009411 | Ga0316592_10094113 | 214 |
| 226 | 3300053104 | Ga0500556_0000700 | Ga0500556_0000700_1332_2054 | 214 |
| 227 | 3300006931 | Ga0097620_100872411 | Ga0097620_1008724112 | 215 |
| 228 | 3300027617 | Ga0210002_1009747 | Ga0210002_10097473 | 216 |
| 229 | 3300032168 | Ga0316593_10000028 | Ga0316593_1000002827 | 216 |
| 230 | 3300033524 | Ga0316592_1000006 | Ga0316592_10000063 | 216 |
| 231 | 3300033524 | Ga0316592_1010690 | Ga0316592_10106903 | 216 |
| 232 | 3300033527 | Ga0316586_1000040 | Ga0316586_100004018 | 216 |
| 233 | 3300033528 | Ga0316588_1001236 | Ga0316588_10012363 | 216 |
| 234 | 3300033529 | Ga0316587_1000021 | Ga0316587_10000213 | 216 |
| 235 | 3300033541 | Ga0316596_1000016 | Ga0316596_100001627 | 216 |
| 236 | 3300033541 | Ga0316596_1009806 | Ga0316596_10098063 | 216 |
| 237 | 3300036712 | Ga0316584_0066465 | Ga0316584_0066465_1254_1904 | 216 |
| 238 | 3300038726 | Ga0400490_00437 | Ga0400490_00437_449_1099 | 216 |
| 239 | 3300038726 | Ga0400490_39901 | Ga0400490_39901_536_1186 | 216 |
| 240 | 3300038727 | Ga0400491_03590 | Ga0400491_03590_450_1100 | 216 |
| 241 | 3300038741 | Ga0400488_58342 | Ga0400488_58342_23_673 | 216 |
| 242 | 3300039110 | Ga0400487_33558 | Ga0400487_33558_86_736 | 216 |
| 243 | 3300039110 | Ga0400487_66163 | Ga0400487_66163_1430_2080 | 216 |
| 244 | 3300048905 | Ga0496102_0014665 | Ga0496102_0014665_1371_2021 | 216 |
| 245 | 3300033541 | Ga0316596_1007663 | Ga0316596_10076633 | 217 |
| 246 | 3300033541 | Ga0316596_1009566 | Ga0316596_10095663 | 217 |
| 247 | 3300059477 | Ga0587084_005426 | Ga0587084_005426_285_938 | 217 |
| 248 | 3300060346 | Ga0587111_0008813 | Ga0587111_0008813_739_1392 | 217 |
| 249 | 3300035113 | Ga0373936_0012383 | Ga0373936_0012383_710_1432 | 219 |
| 250 | 3300035113 | Ga0373936_0113659 | Ga0373936_0113659_25_714 | 221 |
| 251 | 3300035172 | Ga0373955_0095895 | Ga0373955_0095895_11_700 | 221 |
| 252 | 3300037466 | Ga0395898_0631487 | Ga0395898_0631487_20_709 | 221 |
| 253 | 3300044684 | Ga0466966_0220128 | Ga0466966_0220128_22_711 | 221 |
| 254 | 3300048922 | Ga0496119_0050187 | Ga0496119_0050187_12_701 | 221 |
| 255 | 3300009101 | Ga0105247_10016819 | Ga0105247_100168197 | 222 |
| 256 | 3300009177 | Ga0105248_10039978 | Ga0105248_100399782 | 222 |
| 257 | 3300010375 | Ga0105239_11574296 | Ga0105239_115742961 | 222 |
| 258 | 3300014968 | Ga0157379_10136446 | Ga0157379_101364462 | 222 |
| 259 | 3300005335 | Ga0070666_10129460 | Ga0070666_101294601 | 224 |
| 260 | 3300005367 | Ga0070667_100002601 | Ga0070667_1000026017 | 224 |
| 261 | 3300005617 | Ga0068859_100124584 | Ga0068859_1001245842 | 224 |
| 262 | 3300006931 | Ga0097620_100124582 | Ga0097620_1001245822 | 224 |
| 263 | 3300014968 | Ga0157379_10021790 | Ga0157379_100217907 | 224 |
| 264 | 3300025900 | Ga0207710_10011141 | Ga0207710_100111411 | 224 |
| 265 | 3300025903 | Ga0207680_10081154 | Ga0207680_100811543 | 224 |
| 266 | 3300025941 | Ga0207711_10333190 | Ga0207711_103331902 | 224 |
| 267 | 3300025961 | Ga0207712_10821165 | Ga0207712_108211651 | 224 |
| 268 | 3300025986 | Ga0207658_10000131 | Ga0207658_100001317 | 224 |
| 269 | 3300026035 | Ga0207703_10114419 | Ga0207703_101144192 | 224 |
| 270 | 3300046539 | Ga0495621_0104182 | Ga0495621_0104182_344_1018 | 224 |
| 271 | 3300005345 | Ga0070692_10120310 | Ga0070692_101203102 | 226 |
| 272 | 3300005347 | Ga0070668_100332068 | Ga0070668_1003320682 | 226 |
| 273 | 3300005353 | Ga0070669_100036309 | Ga0070669_1000363093 | 226 |
| 274 | 3300005366 | Ga0070659_100494874 | Ga0070659_1004948741 | 226 |
| 275 | 3300005441 | Ga0070700_100133180 | Ga0070700_1001331802 | 226 |
| 276 | 3300005444 | Ga0070694_100402780 | Ga0070694_1004027801 | 226 |
| 277 | 3300005457 | Ga0070662_100068780 | Ga0070662_1000687803 | 226 |
| 278 | 3300005564 | Ga0070664_100160685 | Ga0070664_1001606851 | 226 |
| 279 | 3300005577 | Ga0068857_100494317 | Ga0068857_1004943171 | 226 |
| 280 | 3300005844 | Ga0068862_100046942 | Ga0068862_1000469427 | 226 |
| 281 | 3300006844 | Ga0075428_100100570 | Ga0075428_1001005704 | 226 |
| 282 | 3300006881 | Ga0068865_100418722 | Ga0068865_1004187222 | 226 |
| 283 | 3300009553 | Ga0105249_10073064 | Ga0105249_100730644 | 226 |
| 284 | 3300013306 | Ga0163162_10823013 | Ga0163162_108230131 | 226 |
| 285 | 3300025908 | Ga0207643_10219438 | Ga0207643_102194381 | 226 |
| 286 | 3300025919 | Ga0207657_10427464 | Ga0207657_104274642 | 226 |
| 287 | 3300025923 | Ga0207681_10042404 | Ga0207681_100424044 | 226 |
| 288 | 3300025933 | Ga0207706_10043777 | Ga0207706_100437773 | 226 |
| 289 | 3300025938 | Ga0207704_10156059 | Ga0207704_101560591 | 226 |
| 290 | 3300025961 | Ga0207712_10216517 | Ga0207712_102165172 | 226 |
| 291 | 3300025972 | Ga0207668_10381544 | Ga0207668_103815441 | 226 |
| 292 | 3300026067 | Ga0207678_10611247 | Ga0207678_106112472 | 226 |
| 293 | 3300026116 | Ga0207674_10527105 | Ga0207674_105271051 | 226 |
| 294 | 3300028380 | Ga0268265_10009976 | Ga0268265_100099764 | 226 |
| 295 | 3300049533 | Ga0501317_009998 | Ga0501317_009998_10_702 | 226 |
| 296 | 3300050511 | nmdc:mga08y16_52691_c1 | nmdc:mga08y16_52691_c1_1243_1935 | 226 |
| 297 | 3300053156 | Ga0500622_0035350 | Ga0500622_0035350_1638_2330 | 226 |
| 298 | 2162886007 | SwRhRL2b_contig_1679528 | SwRhRL2b_0143.00007460 | 232 |
| 299 | 3300004800 | Ga0058861_11936056 | Ga0058861_119360562 | 232 |
| 300 | 3300004803 | Ga0058862_10147900 | Ga0058862_101479001 | 232 |
| 301 | 3300005289 | Ga0065704_10070877 | Ga0065704_100708772 | 232 |
| 302 | 3300005335 | Ga0070666_10001446 | Ga0070666_100014463 | 232 |
| 303 | 3300005336 | Ga0070680_100006614 | Ga0070680_10000661418 | 232 |
| 304 | 3300005355 | Ga0070671_100003161 | Ga0070671_10000316124 | 232 |
| 305 | 3300005355 | Ga0070671_100005400 | Ga0070671_1000054002 | 232 |
| 306 | 3300005356 | Ga0070674_100372781 | Ga0070674_1003727811 | 232 |
| 307 | 3300005364 | Ga0070673_100077547 | Ga0070673_1000775473 | 232 |
| 308 | 3300005367 | Ga0070667_100014275 | Ga0070667_1000142753 | 232 |
| 309 | 3300005367 | Ga0070667_100090124 | Ga0070667_1000901243 | 232 |
| 310 | 3300005434 | Ga0070709_10131918 | Ga0070709_101319182 | 232 |
| 311 | 3300005436 | Ga0070713_100006105 | Ga0070713_1000061053 | 232 |
| 312 | 3300005436 | Ga0070713_100834383 | Ga0070713_1008343832 | 232 |
| 313 | 3300005437 | Ga0070710_10031164 | Ga0070710_100311643 | 232 |
| 314 | 3300005439 | Ga0070711_100460469 | Ga0070711_1004604692 | 232 |
| 315 | 3300005458 | Ga0070681_10054348 | Ga0070681_100543483 | 232 |
| 316 | 3300005458 | Ga0070681_10172191 | Ga0070681_101721911 | 232 |
| 317 | 3300005459 | Ga0068867_100025266 | Ga0068867_1000252664 | 232 |
| 318 | 3300005530 | Ga0070679_100240910 | Ga0070679_1002409102 | 232 |
| 319 | 3300005535 | Ga0070684_100194565 | Ga0070684_1001945652 | 232 |
| 320 | 3300005544 | Ga0070686_100296172 | Ga0070686_1002961722 | 232 |
| 321 | 3300005548 | Ga0070665_100005442 | Ga0070665_10000544226 | 232 |
| 322 | 3300005548 | Ga0070665_100020767 | Ga0070665_1000207673 | 232 |
| 323 | 3300005548 | Ga0070665_100039130 | Ga0070665_1000391307 | 232 |
| 324 | 3300005548 | Ga0070665_100056051 | Ga0070665_1000560516 | 232 |
| 325 | 3300005563 | Ga0068855_100162407 | Ga0068855_1001624074 | 232 |
| 326 | 3300005563 | Ga0068855_100233788 | Ga0068855_1002337882 | 232 |
| 327 | 3300005563 | Ga0068855_100831227 | Ga0068855_1008312271 | 232 |
| 328 | 3300005578 | Ga0068854_100369790 | Ga0068854_1003697902 | 232 |
| 329 | 3300005614 | Ga0068856_100006458 | Ga0068856_1000064586 | 232 |
| 330 | 3300005616 | Ga0068852_100473234 | Ga0068852_1004732341 | 232 |
| 331 | 3300005617 | Ga0068859_100000641 | Ga0068859_1000006413 | 232 |
| 332 | 3300005617 | Ga0068859_100199475 | Ga0068859_1001994751 | 232 |
| 333 | 3300005618 | Ga0068864_100076450 | Ga0068864_1000764502 | 232 |
| 334 | 3300005718 | Ga0068866_10054670 | Ga0068866_100546702 | 232 |
| 335 | 3300005834 | Ga0068851_10044653 | Ga0068851_100446532 | 232 |
| 336 | 3300005841 | Ga0068863_100074617 | Ga0068863_1000746174 | 232 |
| 337 | 3300005842 | Ga0068858_100000125 | Ga0068858_10000012535 | 232 |
| 338 | 3300005842 | Ga0068858_100037896 | Ga0068858_1000378967 | 232 |
| 339 | 3300005843 | Ga0068860_100009263 | Ga0068860_1000092634 | 232 |
| 340 | 3300005843 | Ga0068860_100027680 | Ga0068860_1000276803 | 232 |
| 341 | 3300005843 | Ga0068860_100038900 | Ga0068860_1000389003 | 232 |
| 342 | 3300006163 | Ga0070715_10004582 | Ga0070715_100045823 | 232 |
| 343 | 3300006173 | Ga0070716_100104267 | Ga0070716_1001042673 | 232 |
| 344 | 3300006175 | Ga0070712_100001456 | Ga0070712_10000145627 | 232 |
| 345 | 3300006175 | Ga0070712_100165383 | Ga0070712_1001653832 | 232 |
| 346 | 3300006237 | Ga0097621_100380426 | Ga0097621_1003804262 | 232 |
| 347 | 3300006358 | Ga0068871_100159060 | Ga0068871_1001590601 | 232 |
| 348 | 3300006881 | Ga0068865_100001214 | Ga0068865_1000012143 | 232 |
| 349 | 3300006931 | Ga0097620_100000641 | Ga0097620_1000006413 | 232 |
| 350 | 3300006931 | Ga0097620_100199474 | Ga0097620_1001994741 | 232 |
| 351 | 3300007788 | Ga0099795_10036139 | Ga0099795_100361393 | 232 |
| 352 | 3300009093 | Ga0105240_10078712 | Ga0105240_100787125 | 232 |
| 353 | 3300009093 | Ga0105240_10090660 | Ga0105240_100906607 | 232 |
| 354 | 3300009093 | Ga0105240_10121093 | Ga0105240_101210932 | 232 |
| 355 | 3300009093 | Ga0105240_10121608 | Ga0105240_101216083 | 232 |
| 356 | 3300009093 | Ga0105240_10520512 | Ga0105240_105205121 | 232 |
| 357 | 3300009098 | Ga0105245_10011368 | Ga0105245_100113689 | 232 |
| 358 | 3300009101 | Ga0105247_10002466 | Ga0105247_100024663 | 232 |
| 359 | 3300009101 | Ga0105247_10410520 | Ga0105247_104105201 | 232 |
| 360 | 3300009174 | Ga0105241_10037721 | Ga0105241_100377213 | 232 |
| 361 | 3300009174 | Ga0105241_10741304 | Ga0105241_107413041 | 232 |
| 362 | 3300009176 | Ga0105242_10051158 | Ga0105242_100511583 | 232 |
| 363 | 3300009177 | Ga0105248_10003146 | Ga0105248_100031463 | 232 |
| 364 | 3300009545 | Ga0105237_10181875 | Ga0105237_101818751 | 232 |
| 365 | 3300009545 | Ga0105237_10284030 | Ga0105237_102840303 | 232 |
| 366 | 3300009551 | Ga0105238_10114714 | Ga0105238_101147142 | 232 |
| 367 | 3300009551 | Ga0105238_10232549 | Ga0105238_102325492 | 232 |
| 368 | 3300009551 | Ga0105238_10470562 | Ga0105238_104705622 | 232 |
| 369 | 3300009553 | Ga0105249_10048373 | Ga0105249_100483733 | 232 |
| 370 | 3300010159 | Ga0099796_10022473 | Ga0099796_100224732 | 232 |
| 371 | 3300010375 | Ga0105239_10101214 | Ga0105239_101012144 | 232 |
| 372 | 3300010375 | Ga0105239_10108235 | Ga0105239_101082354 | 232 |
| 373 | 3300013105 | Ga0157369_10015323 | Ga0157369_1001532318 | 232 |
| 374 | 3300013105 | Ga0157369_10124992 | Ga0157369_101249922 | 232 |
| 375 | 3300013296 | Ga0157374_10024385 | Ga0157374_100243858 | 232 |
| 376 | 3300013296 | Ga0157374_10201081 | Ga0157374_102010813 | 232 |
| 377 | 3300013297 | Ga0157378_10006374 | Ga0157378_1000637421 | 232 |
| 378 | 3300013306 | Ga0163162_10006236 | Ga0163162_100062363 | 232 |
| 379 | 3300013306 | Ga0163162_10057607 | Ga0163162_100576072 | 232 |
| 380 | 3300013306 | Ga0163162_10293535 | Ga0163162_102935352 | 232 |
| 381 | 3300013307 | Ga0157372_10146281 | Ga0157372_101462813 | 232 |
| 382 | 3300013307 | Ga0157372_10256411 | Ga0157372_102564112 | 232 |
| 383 | 3300013307 | Ga0157372_10667019 | Ga0157372_106670191 | 232 |
| 384 | 3300013308 | Ga0157375_10039845 | Ga0157375_100398452 | 232 |
| 385 | 3300013308 | Ga0157375_10511845 | Ga0157375_105118452 | 232 |
| 386 | 3300014325 | Ga0163163_10092410 | Ga0163163_100924103 | 232 |
| 387 | 3300014968 | Ga0157379_10041785 | Ga0157379_100417853 | 232 |
| 388 | 3300014969 | Ga0157376_10029700 | Ga0157376_100297007 | 232 |
| 389 | 3300020070 | Ga0206356_11866678 | Ga0206356_118666781 | 232 |
| 390 | 3300020076 | Ga0206355_1038196 | Ga0206355_10381962 | 232 |
| 391 | 3300022467 | Ga0224712_10092194 | Ga0224712_100921942 | 232 |
| 392 | 3300022467 | Ga0224712_10104730 | Ga0224712_101047302 | 232 |
| 393 | 3300025898 | Ga0207692_10031480 | Ga0207692_100314802 | 232 |
| 394 | 3300025898 | Ga0207692_10163605 | Ga0207692_101636052 | 232 |
| 395 | 3300025900 | Ga0207710_10005001 | Ga0207710_100050013 | 232 |
| 396 | 3300025903 | Ga0207680_10199309 | Ga0207680_101993091 | 232 |
| 397 | 3300025904 | Ga0207647_10089543 | Ga0207647_100895432 | 232 |
| 398 | 3300025905 | Ga0207685_10024333 | Ga0207685_100243333 | 232 |
| 399 | 3300025906 | Ga0207699_10275281 | Ga0207699_102752812 | 232 |
| 400 | 3300025911 | Ga0207654_10191202 | Ga0207654_101912022 | 232 |
| 401 | 3300025912 | Ga0207707_10032067 | Ga0207707_100320676 | 232 |
| 402 | 3300025912 | Ga0207707_10090231 | Ga0207707_100902312 | 232 |
| 403 | 3300025912 | Ga0207707_10120685 | Ga0207707_101206851 | 232 |
| 404 | 3300025912 | Ga0207707_10294481 | Ga0207707_102944811 | 232 |
| 405 | 3300025913 | Ga0207695_10037866 | Ga0207695_100378666 | 232 |
| 406 | 3300025913 | Ga0207695_10059336 | Ga0207695_100593362 | 232 |
| 407 | 3300025913 | Ga0207695_10087344 | Ga0207695_100873443 | 232 |
| 408 | 3300025914 | Ga0207671_10075016 | Ga0207671_100750162 | 232 |
| 409 | 3300025914 | Ga0207671_10202974 | Ga0207671_102029742 | 232 |
| 410 | 3300025914 | Ga0207671_10254490 | Ga0207671_102544901 | 232 |
| 411 | 3300025915 | Ga0207693_10000448 | Ga0207693_100004483 | 232 |
| 412 | 3300025916 | Ga0207663_10074257 | Ga0207663_100742573 | 232 |
| 413 | 3300025921 | Ga0207652_10159759 | Ga0207652_101597594 | 232 |
| 414 | 3300025924 | Ga0207694_10185946 | Ga0207694_101859463 | 232 |
| 415 | 3300025927 | Ga0207687_10316600 | Ga0207687_103166001 | 232 |
| 416 | 3300025931 | Ga0207644_10000428 | Ga0207644_1000042831 | 232 |
| 417 | 3300025931 | Ga0207644_10022460 | Ga0207644_100224602 | 232 |
| 418 | 3300025938 | Ga0207704_10004775 | Ga0207704_100047753 | 232 |
| 419 | 3300025941 | Ga0207711_10205483 | Ga0207711_102054831 | 232 |
| 420 | 3300025944 | Ga0207661_10114061 | Ga0207661_101140612 | 232 |
| 421 | 3300025949 | Ga0207667_10014085 | Ga0207667_1001408513 | 232 |
| 422 | 3300025949 | Ga0207667_10741364 | Ga0207667_107413641 | 232 |
| 423 | 3300025961 | Ga0207712_10068569 | Ga0207712_100685693 | 232 |
| 424 | 3300025981 | Ga0207640_10353669 | Ga0207640_103536692 | 232 |
| 425 | 3300025986 | Ga0207658_10011254 | Ga0207658_1001125412 | 232 |
| 426 | 3300025986 | Ga0207658_10019790 | Ga0207658_100197908 | 232 |
| 427 | 3300026035 | Ga0207703_10001524 | Ga0207703_1000152432 | 232 |
| 428 | 3300026035 | Ga0207703_10105984 | Ga0207703_101059843 | 232 |
| 429 | 3300026041 | Ga0207639_10105218 | Ga0207639_101052183 | 232 |
| 430 | 3300026067 | Ga0207678_10034632 | Ga0207678_100346321 | 232 |
| 431 | 3300026088 | Ga0207641_10002325 | Ga0207641_100023253 | 232 |
| 432 | 3300026088 | Ga0207641_10194858 | Ga0207641_101948584 | 232 |
| 433 | 3300026088 | Ga0207641_10315214 | Ga0207641_103152141 | 232 |
| 434 | 3300026121 | Ga0207683_10002499 | Ga0207683_1000249928 | 232 |
| 435 | 3300028379 | Ga0268266_10000943 | Ga0268266_100009432 | 232 |
| 436 | 3300028379 | Ga0268266_10485147 | Ga0268266_104851472 | 232 |
| 437 | 3300028381 | Ga0268264_10000102 | Ga0268264_100001023 | 232 |
| 438 | 3300028381 | Ga0268264_10038276 | Ga0268264_100382763 | 232 |
| 439 | 3300028381 | Ga0268264_10141591 | Ga0268264_101415911 | 232 |
| 440 | 3300030521 | Ga0307511_10000235 | Ga0307511_1000023562 | 232 |
| 441 | 3300030763 | Ga0265763_1004784 | Ga0265763_10047842 | 232 |
| 442 | 3300031507 | Ga0307509_10000987 | Ga0307509_1000098756 | 232 |
| 443 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006334 | 232 |
| 444 | 3300033180 | Ga0307510_10153566 | Ga0307510_101535663 | 232 |
| 445 | 3300035086 | Ga0373934_0086450 | Ga0373934_0086450_113_835 | 232 |
| 446 | 3300035116 | Ga0373945_0041920 | Ga0373945_0041920_172_894 | 232 |
| 447 | 3300035170 | Ga0373943_0015875 | Ga0373943_0015875_2105_2827 | 232 |
| 448 | 3300035172 | Ga0373955_0011455 | Ga0373955_0011455_2315_3037 | 232 |
| 449 | 3300035695 | Ga0373927_0047414 | Ga0373927_0047414_1817_2539 | 232 |
| 450 | 3300035724 | Ga0373933_0039288 | Ga0373933_0039288_476_1198 | 232 |
| 451 | 3300035725 | Ga0373947_0161552 | Ga0373947_0161552_20_742 | 232 |
| 452 | 3300036401 | Ga0373937_0001807 | Ga0373937_0001807_12323_13045 | 232 |
| 453 | 3300036401 | Ga0373937_0109265 | Ga0373937_0109265_707_1429 | 232 |
| 454 | 3300037068 | Ga0373925_0230527 | Ga0373925_0230527_589_1311 | 232 |
| 455 | 3300037312 | Ga0395899_0438450 | Ga0395899_0438450_100_822 | 232 |
| 456 | 3300037418 | Ga0395900_0684668 | Ga0395900_0684668_190_912 | 232 |
| 457 | 3300037466 | Ga0395898_0081820 | Ga0395898_0081820_1761_2483 | 232 |
| 458 | 3300037466 | Ga0395898_0206094 | Ga0395898_0206094_546_1268 | 232 |
| 459 | 3300039437 | Ga0436365_0602380 | Ga0436365_0602380_382_1104 | 232 |
| 460 | 3300042876 | Ga0451577_0008152 | Ga0451577_0008152_697_1419 | 232 |
| 461 | 3300044656 | Ga0466969_0260721 | Ga0466969_0260721_26_763 | 232 |
| 462 | 3300044673 | Ga0453683_0005334 | Ga0453683_0005334_6527_7249 | 232 |
| 463 | 3300044684 | Ga0466966_0002570 | Ga0466966_0002570_1632_2354 | 232 |
| 464 | 3300044693 | Ga0466961_0016727 | Ga0466961_0016727_1632_2354 | 232 |
| 465 | 3300044706 | Ga0466964_0012273 | Ga0466964_0012273_1611_2333 | 232 |
| 466 | 3300044712 | Ga0453684_0043943 | Ga0453684_0043943_4573_5295 | 232 |
| 467 | 3300044735 | Ga0466968_0152700 | Ga0466968_0152700_308_1030 | 232 |
| 468 | 3300044765 | Ga0466970_0018566 | Ga0466970_0018566_518_1240 | 232 |
| 469 | 3300044842 | Ga0466957_0007884 | Ga0466957_0007884_257_979 | 232 |
| 470 | 3300045049 | Ga0466959_0022213 | Ga0466959_0022213_1604_2326 | 232 |
| 471 | 3300045049 | Ga0466959_0182791 | Ga0466959_0182791_44_766 | 232 |
| 472 | 3300045049 | Ga0466959_0362466 | Ga0466959_0362466_210_947 | 232 |
| 473 | 3300045051 | Ga0451576_0098246 | Ga0451576_0098246_1933_2655 | 232 |
| 474 | 3300045836 | Ga0466958_0177421 | Ga0466958_0177421_326_1048 | 232 |
| 475 | 3300046472 | Ga0495580_0141191 | Ga0495580_0141191_769_1491 | 232 |
| 476 | 3300046472 | Ga0495580_0167561 | Ga0495580_0167561_380_1102 | 232 |
| 477 | 3300046477 | Ga0495664_0240740 | Ga0495664_0240740_40_762 | 232 |
| 478 | 3300046507 | Ga0495606_0042851 | Ga0495606_0042851_805_1527 | 232 |
| 479 | 3300046517 | Ga0495630_0026241 | Ga0495630_0026241_2865_3587 | 232 |
| 480 | 3300046522 | Ga0495643_0158616 | Ga0495643_0158616_109_831 | 232 |
| 481 | 3300046526 | Ga0495666_0184389 | Ga0495666_0184389_91_813 | 232 |
| 482 | 3300046536 | Ga0495587_0019207 | Ga0495587_0019207_1702_2424 | 232 |
| 483 | 3300046543 | Ga0495645_0410584 | Ga0495645_0410584_106_828 | 232 |
| 484 | 3300046675 | Ga0495657_0150741 | Ga0495657_0150741_144_866 | 232 |
| 485 | 3300046678 | Ga0495599_0121138 | Ga0495599_0121138_65_787 | 232 |
| 486 | 3300046679 | Ga0495623_0050975 | Ga0495623_0050975_86_808 | 232 |
| 487 | 3300046694 | Ga0495649_0197017 | Ga0495649_0197017_167_889 | 232 |
| 488 | 3300048903 | Ga0496100_0088239 | Ga0496100_0088239_357_1079 | 232 |
| 489 | 3300048904 | Ga0496101_0019992 | Ga0496101_0019992_3590_4312 | 232 |
| 490 | 3300048905 | Ga0496102_0009299 | Ga0496102_0009299_7041_7763 | 232 |
| 491 | 3300048905 | Ga0496102_0053702 | Ga0496102_0053702_772_1494 | 232 |
| 492 | 3300048905 | Ga0496102_0070282 | Ga0496102_0070282_2275_2997 | 232 |
| 493 | 3300048906 | Ga0496103_0058907 | Ga0496103_0058907_1595_2317 | 232 |
| 494 | 3300048907 | Ga0496104_0381243 | Ga0496104_0381243_527_1249 | 232 |
| 495 | 3300048908 | Ga0496105_0003469 | Ga0496105_0003469_10172_10894 | 232 |
| 496 | 3300048908 | Ga0496105_0221104 | Ga0496105_0221104_187_909 | 232 |
| 497 | 3300048909 | Ga0496106_0028441 | Ga0496106_0028441_1470_2192 | 232 |
| 498 | 3300048909 | Ga0496106_0391327 | Ga0496106_0391327_166_888 | 232 |
| 499 | 3300048910 | Ga0496107_0001576 | Ga0496107_0001576_4624_5346 | 232 |
| 500 | 3300048911 | Ga0496108_0002086 | Ga0496108_0002086_9029_9751 | 232 |
| 501 | 3300048911 | Ga0496108_0182334 | Ga0496108_0182334_824_1546 | 232 |
| 502 | 3300048912 | Ga0496109_0067040 | Ga0496109_0067040_2361_3083 | 232 |
| 503 | 3300048913 | Ga0496110_0017578 | Ga0496110_0017578_1800_2522 | 232 |
| 504 | 3300048914 | Ga0496111_0092759 | Ga0496111_0092759_772_1494 | 232 |
| 505 | 3300048915 | Ga0496112_0463120 | Ga0496112_0463120_111_833 | 232 |
| 506 | 3300048916 | Ga0496113_0090410 | Ga0496113_0090410_133_855 | 232 |
| 507 | 3300048917 | Ga0496114_0074247 | Ga0496114_0074247_764_1486 | 232 |
| 508 | 3300048920 | Ga0496117_0000787 | Ga0496117_0000787_25180_25902 | 232 |
| 509 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_233652_234374 | 232 |
| 510 | 3300048922 | Ga0496119_0012506 | Ga0496119_0012506_3981_4703 | 232 |
| 511 | 3300048923 | Ga0496120_0021776 | Ga0496120_0021776_2511_3233 | 232 |
| 512 | 3300048924 | Ga0496121_0028073 | Ga0496121_0028073_795_1517 | 232 |
| 513 | 3300048924 | Ga0496121_0061867 | Ga0496121_0061867_1509_2231 | 232 |
| 514 | 3300048924 | Ga0496121_0157167 | Ga0496121_0157167_812_1534 | 232 |
| 515 | 3300048927 | Ga0496124_0055985 | Ga0496124_0055985_1713_2435 | 232 |
| 516 | 3300048928 | Ga0496125_0001378 | Ga0496125_0001378_1023_1745 | 232 |
| 517 | 3300048928 | Ga0496125_0020647 | Ga0496125_0020647_788_1510 | 232 |
| 518 | 3300048928 | Ga0496125_0022367 | Ga0496125_0022367_3145_3867 | 232 |
| 519 | 3300048929 | Ga0496126_0004928 | Ga0496126_0004928_13971_14693 | 232 |
| 520 | 3300048929 | Ga0496126_0011396 | Ga0496126_0011396_837_1559 | 232 |
| 521 | 3300048929 | Ga0496126_0130504 | Ga0496126_0130504_286_1008 | 232 |
| 522 | 3300053078 | Ga0495612_0122898 | Ga0495612_0122898_321_1043 | 232 |
| 523 | 3300053115 | Ga0500591_052893 | Ga0500591_052893_929_1651 | 232 |
| 524 | 3300053123 | Ga0500614_084529 | Ga0500614_084529_142_864 | 232 |
| 525 | 3300053178 | Ga0500637_0004292 | Ga0500637_0004292_4837_5559 | 232 |
| 526 | 3300061719 | Ga0466962_0001207 | Ga0466962_0001207_9548_10270 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9275 | 2 | 210 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9237 | 2 | 210 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9127 | 2 | 210 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.911 | 2 | 210 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.8922 | 3 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9612 | 34 | 97 | 3.30.160.810 |
| 1vw3C02 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9365 | 33 | 99 | 3.30.160.810 |
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9323 | 34 | 97 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.932 | 35 | 99 | 3.30.160.810 |
| 1vw3C01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9191 | 1 | 211 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0Z1Y0-F1-model_v4 | 50S ribosomal protein L3 | 0.9379 | 5 | 104 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A087B7P6-F1-model_v4 | deleted | 0.9374 | 5 | 106 |
|
| AF-A0A485AH68-F1-model_v4 | 50S ribosomal protein L3 | 0.937 | 2 | 103 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A447N332-F1-model_v4 | 50S ribosomal protein L3 | 0.9347 | 2 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7X6ZH73-F1-model_v4 | 50S ribosomal protein L3 | 0.93 | 12 | 99 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar