F459295

General Info

Members Datasets Scaffolds Average Seq Length
525 356 1050 256

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0057475|Ga0373923_0057475_718_1632
Length 304
Sequence MWADAESTISAPGRHTIRGLLRSARDDSLILQNAPEETMDFKGKVALITGAGNGIGRASALGFAGGGAKVVVVDRDTAGGEGTAGIIRQQGGDALFVAADVTKSADVQAYVKAALDAYGAIDCFHNNAGIEGSVATTAEYDEAMFDAVMSVNVKGVFLGMRHILPVMLKQKRGAIVNTPSVAGLVASPGMPAYVASKHAVIGLTKTAAGEVARSGVRVNAVCPGPIDTRMIHSLESMLNPTDPGSVGDRYQSNIPIGRYGTPEEVANLVLFLCSDLAGNITGAQYVVDGGRTATGGAVTNNLVR

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
225 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
272 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
273 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
274 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
275 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
276 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
277 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
278 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
279 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
295 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
296 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
297 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
298 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
299 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
300 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
303 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
304 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
305 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
306 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
307 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
308 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
309 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
310 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
311 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
312 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
313 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
314 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
315 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
316 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
317 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
323 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
324 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
325 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
326 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
327 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
328 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
329 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
333 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
334 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 1.71
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0057475 3300035111 Bacteria 1645
2 JGI25406J46586_10057067 3300003203 Bacteria 1278
3 JGI26145J50221_1001167 3300003371 Bacteria 2079
4 JGI26141J51220_1003442 3300003503 Bacteria 975
5 Ga0058862_10629301 3300004803 Bacteria 1213
6 Ga0065704_10101879 3300005289 Bacteria 2219
7 Ga0065704_10110373 3300005289 Bacteria 1982
8 Ga0065712_10086704 3300005290 Bacteria 2621
9 Ga0065712_10159828 3300005290 Bacteria 1310
10 Ga0065707_10033906 3300005295 Bacteria 2094
11 Ga0070683_100057429 3300005329 Bacteria 3615
12 Ga0070690_100050587 3300005330 Bacteria 2651
13 Ga0070670_100002918 3300005331 Bacteria 14157
14 Ga0070677_10006139 3300005333 Bacteria 3987
15 Ga0068869_100036779 3300005334 Bacteria 3477
16 Ga0068869_100119767 3300005334 Bacteria 2012
17 Ga0070666_10004669 3300005335 Bacteria 8362
18 Ga0070666_10485886 3300005335 Bacteria 894
19 Ga0070680_100007840 3300005336 Bacteria 8141
20 Ga0070680_100041387 3300005336 Bacteria 3736
21 Ga0070680_100045583 3300005336 Bacteria 3565
22 Ga0068868_100167187 3300005338 Bacteria 1820
23 Ga0070660_100419324 3300005339 Bacteria 1108
24 Ga0070689_100004380 3300005340 Bacteria 9532
25 Ga0070689_100010250 3300005340 Bacteria 6677
26 Ga0070689_100065872 3300005340 Bacteria 2822
27 Ga0070691_10027950 3300005341 Bacteria 2633
28 Ga0070691_10195446 3300005341 Bacteria 1060
29 Ga0070687_100006861 3300005343 Bacteria 4700
30 Ga0070687_100015313 3300005343 Bacteria 3465
31 Ga0070687_100026453 3300005343 Unclassified 2794
32 Ga0070661_100043565 3300005344 Bacteria 3278
33 Ga0070668_100254314 3300005347 Bacteria 1459
34 Ga0070669_100007201 3300005353 Bacteria 7989
35 Ga0070669_100025550 3300005353 Unclassified 4242
36 Ga0070675_100093105 3300005354 Bacteria 2527
37 Ga0070675_100210918 3300005354 Bacteria 1688
38 Ga0070671_100030416 3300005355 Bacteria 4455
39 Ga0070674_100009159 3300005356 Bacteria 5920
40 Ga0070674_100086207 3300005356 Bacteria 2255
41 Ga0070673_100044773 3300005364 Bacteria 3428
42 Ga0070688_100008623 3300005365 Bacteria 5548
43 Ga0070688_100025547 3300005365 Bacteria 3498
44 Ga0070659_100006190 3300005366 Bacteria 8644
45 Ga0070667_100013708 3300005367 Bacteria 6699
46 Ga0070667_100289665 3300005367 Bacteria 1472
47 Ga0070667_100695946 3300005367 Bacteria 940
48 Ga0070709_10062996 3300005434 Bacteria 2366
49 Ga0070709_10224905 3300005434 Bacteria 1340
50 Ga0070711_100018695 3300005439 Bacteria 4430
51 Ga0070711_100157537 3300005439 Bacteria 1718
52 Ga0070711_100350381 3300005439 Bacteria 1187
53 Ga0070705_100074042 3300005440 Bacteria 2069
54 Ga0070705_100116196 3300005440 Bacteria 1719
55 Ga0070705_100583989 3300005440 Bacteria 862
56 Ga0070700_100002231 3300005441 Bacteria 9856
57 Ga0070694_100021002 3300005444 Bacteria 4168
58 Ga0070694_100131727 3300005444 Bacteria 1807
59 Ga0070694_100209223 3300005444 Bacteria 1458
60 Ga0070663_100055162 3300005455 Bacteria 2843
61 Ga0070678_100004964 3300005456 Bacteria 7619
62 Ga0070678_100054999 3300005456 Bacteria 2904
63 Ga0070678_100169193 3300005456 Unclassified 1778
64 Ga0070662_100062696 3300005457 Bacteria 2717
65 Ga0070681_10000059 3300005458 Bacteria 78995
66 Ga0070681_10013094 3300005458 Bacteria 8236
67 Ga0070681_10268184 3300005458 Bacteria 1618
68 Ga0068867_100015381 3300005459 Bacteria 5426
69 Ga0068867_100072509 3300005459 Unclassified 2578
70 Ga0070685_10002109 3300005466 Bacteria 10272
71 Ga0070707_100174993 3300005468 Bacteria 2092
72 Ga0070707_100224913 3300005468 Bacteria 1827
73 Ga0070707_100349536 3300005468 Unclassified 1436
74 Ga0070698_100053974 3300005471 Bacteria 4082
75 Ga0070679_100006336 3300005530 Bacteria 11018
76 Ga0070679_100060241 3300005530 Bacteria 3783
77 Ga0070679_100197618 3300005530 Bacteria 1978
78 Ga0070684_100377978 3300005535 Bacteria 1304
79 Ga0070684_100403059 3300005535 Bacteria 1261
80 Ga0070684_100525196 3300005535 Bacteria 1097
81 Ga0068853_100400640 3300005539 Bacteria 1284
82 Ga0070672_100009782 3300005543 Bacteria 6624
83 Ga0070672_100029222 3300005543 Bacteria 4132
84 Ga0070686_100002532 3300005544 Bacteria 10069
85 Ga0070686_100010944 3300005544 Bacteria 5136
86 Ga0070695_100001262 3300005545 Bacteria 13933
87 Ga0070695_100107657 3300005545 Bacteria 1886
88 Ga0070695_100144883 3300005545 Bacteria 1651
89 Ga0070696_100012763 3300005546 Bacteria 5641
90 Ga0070696_100043924 3300005546 Bacteria 3093
91 Ga0070696_100060441 3300005546 Bacteria 2650
92 Ga0070693_100041374 3300005547 Bacteria 2592
93 Ga0070665_100121296 3300005548 Bacteria 2616
94 Ga0070664_100000697 3300005564 Bacteria 25657
95 Ga0070664_100052240 3300005564 Bacteria 3461
96 Ga0068857_100047506 3300005577 Bacteria 3811
97 Ga0068854_100008853 3300005578 Bacteria 6478
98 Ga0068854_100233090 3300005578 Bacteria 1462
99 Ga0068856_100034319 3300005614 Bacteria 4969
100 Ga0068856_100119556 3300005614 Bacteria 2636
101 Ga0070702_100004005 3300005615 Bacteria 6683
102 Ga0070702_100114183 3300005615 Bacteria 1680
103 Ga0068852_100332673 3300005616 Bacteria 1478
104 Ga0068859_100041446 3300005617 Unclassified 4624
105 Ga0068864_100080947 3300005618 Bacteria 2846
106 Ga0068864_100139044 3300005618 Bacteria 2189
107 Ga0068866_10114965 3300005718 Bacteria 1507
108 Ga0068861_100098101 3300005719 Bacteria 2325
109 Ga0068870_10066377 3300005840 Bacteria 1954
110 Ga0068858_100060461 3300005842 Unclassified 3502
111 Ga0068860_100429549 3300005843 Bacteria 1311
112 Ga0068862_100010751 3300005844 Bacteria 7556
113 Ga0081455_10000641 3300005937 Bacteria 45309
114 Ga0081455_10011101 3300005937 Bacteria 9067
115 Ga0081455_10227957 3300005937 Bacteria 1377
116 Ga0081539_10003586 3300005985 Bacteria 18805
117 Ga0070717_10049379 3300006028 Bacteria 3454
118 Ga0070717_10413668 3300006028 Bacteria 1212
119 Ga0075365_10019054 3300006038 Bacteria 4228
120 Ga0075365_10362815 3300006038 Bacteria 1021
121 Ga0075363_100126073 3300006048 Bacteria 1433
122 Ga0075364_10111475 3300006051 Bacteria 1826
123 Ga0075432_10003144 3300006058 Bacteria 5572
124 Ga0070716_100070378 3300006173 Bacteria 2054
125 Ga0070716_100111807 3300006173 Bacteria 1694
126 Ga0070712_100118680 3300006175 Bacteria 1987
127 Ga0070712_100191015 3300006175 Bacteria 1603
128 Ga0070712_100232421 3300006175 Bacteria 1465
129 Ga0075362_10093148 3300006177 Bacteria 1401
130 Ga0075362_10119476 3300006177 Bacteria 1247
131 Ga0075367_10077364 3300006178 Bacteria 2008
132 Ga0075427_10002908 3300006194 Bacteria 2328
133 Ga0097621_100027577 3300006237 Unclassified 4468
134 Ga0097621_100118391 3300006237 Bacteria 2245
135 Ga0097621_100410822 3300006237 Bacteria 1213
136 Ga0075370_10085776 3300006353 Bacteria 1813
137 Ga0068871_100002019 3300006358 Bacteria 13734
138 Ga0068871_100159249 3300006358 Bacteria 1930
139 Ga0075428_100160501 3300006844 Bacteria 2440
140 Ga0075428_100385952 3300006844 Bacteria 1501
141 Ga0075430_100013053 3300006846 Bacteria 7080
142 Ga0075430_100014672 3300006846 Bacteria 6674
143 Ga0075430_100030205 3300006846 Bacteria 4601
144 Ga0075431_100009072 3300006847 Bacteria 9969
145 Ga0075431_100025136 3300006847 Bacteria 6105
146 Ga0075433_10008179 3300006852 Bacteria 8330
147 Ga0075434_100126215 3300006871 Bacteria 2575
148 Ga0075434_100195041 3300006871 Unclassified 2045
149 Ga0075434_100460581 3300006871 Bacteria 1293
150 Ga0075434_100461175 3300006871 Bacteria 1292
151 Ga0075429_100016353 3300006880 Bacteria 6430
152 Ga0075429_100046948 3300006880 Bacteria 3757
153 Ga0068865_100012797 3300006881 Bacteria 5289
154 Ga0068865_100047194 3300006881 Unclassified 2958
155 Ga0075436_100142015 3300006914 Bacteria 1687
156 Ga0097620_100041443 3300006931 Unclassified 4624
157 Ga0099794_10054314 3300007265 Bacteria 1933
158 Ga0111539_10018395 3300009094 Bacteria 8656
159 Ga0111539_10606385 3300009094 Bacteria 1275
160 Ga0111539_10911280 3300009094 Bacteria 1022
161 Ga0105245_10052671 3300009098 Bacteria 3650
162 Ga0114129_10014952 3300009147 Bacteria 11059
163 Ga0114129_10036362 3300009147 Bacteria 6954
164 Ga0114129_10211520 3300009147 Bacteria 2621
165 Ga0105243_10188559 3300009148 Bacteria 1799
166 Ga0105241_10041812 3300009174 Unclassified 3465
167 Ga0105241_10220412 3300009174 Bacteria 1594
168 Ga0105242_10007201 3300009176 Bacteria 8579
169 Ga0105242_10014118 3300009176 Bacteria 6183
170 Ga0105242_10142377 3300009176 Bacteria 2082
171 Ga0105242_10255192 3300009176 Bacteria 1582
172 Ga0105248_10004525 3300009177 Bacteria 15384
173 Ga0105248_10109756 3300009177 Bacteria 3111
174 Ga0105248_10572646 3300009177 Bacteria 1274
175 Ga0105237_10051931 3300009545 Bacteria 4117
176 Ga0105249_10009298 3300009553 Bacteria 8594
177 Ga0105249_10053950 3300009553 Bacteria 3675
178 Ga0105239_10137140 3300010375 Unclassified 2724
179 Ga0105246_10059287 3300011119 Bacteria 2655
180 Ga0157371_10057773 3300013102 Bacteria 2752
181 Ga0157369_10180418 3300013105 Bacteria 2221
182 Ga0157369_10229161 3300013105 Bacteria 1943
183 Ga0157374_10017318 3300013296 Bacteria 6341
184 Ga0157374_10032359 3300013296 Bacteria 4761
185 Ga0157374_10049278 3300013296 Bacteria 3912
186 Ga0157378_10001616 3300013297 Bacteria 20392
187 Ga0157378_10020393 3300013297 Bacteria 5829
188 Ga0157372_10215939 3300013307 Bacteria 2223
189 Ga0157372_10986539 3300013307 Eukaryota 976
190 Ga0157375_10012404 3300013308 Bacteria 7560
191 Ga0157375_10199656 3300013308 Bacteria 2155
192 Ga0157380_10083918 3300014326 Bacteria 2611
193 Ga0157377_10002800 3300014745 Bacteria 7773
194 Ga0157377_10003891 3300014745 Bacteria 6805
195 Ga0157379_10332736 3300014968 Bacteria 1388
196 Ga0157376_10001364 3300014969 Bacteria 16071
197 Ga0157376_10004403 3300014969 Bacteria 9805
198 Ga0157376_10170617 3300014969 Bacteria 1981
199 Ga0157376_10542579 3300014969 Bacteria 1150
200 Ga0163161_10012669 3300017792 Bacteria 5856
201 Ga0163161_10205250 3300017792 Bacteria 1520
202 Ga0206356_11777606 3300020070 Bacteria 1366
203 Ga0213875_10000996 3300021388 Bacteria 20184
204 Ga0213871_10000607 3300021441 Bacteria 5082
205 Ga0207697_10006965 3300025315 Bacteria 5070
206 Ga0207697_10028614 3300025315 Bacteria 2279
207 Ga0207682_10004002 3300025893 Bacteria 6275
208 Ga0207642_10071661 3300025899 Bacteria 1651
209 Ga0207688_10022741 3300025901 Bacteria 3432
210 Ga0207680_10033448 3300025903 Unclassified 2933
211 Ga0207680_10098967 3300025903 Bacteria 1870
212 Ga0207680_10240948 3300025903 Bacteria 1246
213 Ga0207699_10253981 3300025906 Bacteria 1212
214 Ga0207645_10000179 3300025907 Bacteria 50385
215 Ga0207643_10086853 3300025908 Bacteria 1818
216 Ga0207654_10066421 3300025911 Bacteria 2127
217 Ga0207654_10196820 3300025911 Bacteria 1324
218 Ga0207707_10000097 3300025912 Bacteria 88081
219 Ga0207707_10035355 3300025912 Bacteria 4369
220 Ga0207671_10175587 3300025914 Bacteria 1665
221 Ga0207693_10020016 3300025915 Bacteria 5324
222 Ga0207693_10020167 3300025915 Bacteria 5303
223 Ga0207693_10214466 3300025915 Bacteria 1513
224 Ga0207663_10039684 3300025916 Bacteria 2855
225 Ga0207663_10397197 3300025916 Bacteria 1054
226 Ga0207660_10005602 3300025917 Bacteria 8154
227 Ga0207660_10105480 3300025917 Bacteria 2112
228 Ga0207662_10000994 3300025918 Bacteria 13234
229 Ga0207662_10003549 3300025918 Bacteria 8044
230 Ga0207662_10033769 3300025918 Bacteria 2984
231 Ga0207649_10317465 3300025920 Bacteria 1144
232 Ga0207652_10004707 3300025921 Bacteria 11063
233 Ga0207646_10131843 3300025922 Bacteria 2250
234 Ga0207646_10230440 3300025922 Bacteria 1673
235 Ga0207681_10018112 3300025923 Bacteria 4433
236 Ga0207650_10005467 3300025925 Bacteria 8670
237 Ga0207659_10120955 3300025926 Bacteria 2006
238 Ga0207659_10298030 3300025926 Bacteria 1323
239 Ga0207659_10368727 3300025926 Bacteria 1195
240 Ga0207687_10014612 3300025927 Bacteria 5139
241 Ga0207700_10106553 3300025928 Bacteria 2247
242 Ga0207700_10121155 3300025928 Bacteria 2121
243 Ga0207664_10124351 3300025929 Bacteria 2163
244 Ga0207664_10262318 3300025929 Bacteria 1511
245 Ga0207644_10147572 3300025931 Bacteria 1817
246 Ga0207690_10056721 3300025932 Bacteria 2643
247 Ga0207706_10000210 3300025933 Bacteria 64859
248 Ga0207709_10016769 3300025935 Bacteria 4079
249 Ga0207670_10048764 3300025936 Bacteria 2828
250 Ga0207669_10097064 3300025937 Bacteria 1936
251 Ga0207704_10003044 3300025938 Bacteria 7577
252 Ga0207704_10023241 3300025938 Unclassified 3337
253 Ga0207691_10001052 3300025940 Bacteria 27398
254 Ga0207691_10031513 3300025940 Unclassified 4947
255 Ga0207711_10094146 3300025941 Bacteria 2640
256 Ga0207689_10002408 3300025942 Bacteria 17418
257 Ga0207661_10271330 3300025944 Bacteria 1514
258 Ga0207679_10002115 3300025945 Bacteria 12317
259 Ga0207640_10007050 3300025981 Bacteria 6188
260 Ga0207658_10071404 3300025986 Bacteria 2629
261 Ga0207658_10138307 3300025986 Bacteria 1967
262 Ga0207677_10364904 3300026023 Bacteria 1214
263 Ga0207677_10765852 3300026023 Bacteria 861
264 Ga0207678_10160147 3300026067 Bacteria 1922
265 Ga0207702_10009731 3300026078 Bacteria 8073
266 Ga0207702_10067561 3300026078 Bacteria 3068
267 Ga0207702_10206371 3300026078 Bacteria 1824
268 Ga0207641_10146026 3300026088 Bacteria 2138
269 Ga0207648_10000719 3300026089 Bacteria 37100
270 Ga0207648_10009714 3300026089 Bacteria 9201
271 Ga0207676_10078420 3300026095 Bacteria 2675
272 Ga0207676_10200553 3300026095 Bacteria 1763
273 Ga0207674_10078204 3300026116 Bacteria 3313
274 Ga0207675_100008013 3300026118 Bacteria 9957
275 Ga0207683_10000066 3300026121 Bacteria 79651
276 Ga0207683_10068624 3300026121 Bacteria 3130
277 Ga0207698_10445751 3300026142 Bacteria 1248
278 Ga0209973_1002257 3300027252 Bacteria 1785
279 Ga0209973_1006650 3300027252 Bacteria 1268
280 Ga0209969_1000012 3300027360 Bacteria 22632
281 Ga0209967_1000677 3300027364 Bacteria 4387
282 Ga0209981_1000015 3300027378 Bacteria 18143
283 Ga0209996_1000425 3300027395 Bacteria 5105
284 Ga0209984_1000289 3300027424 Bacteria 5707
285 Ga0210000_1000355 3300027462 Bacteria 6464
286 Ga0209995_1000084 3300027471 Bacteria 14758
287 Ga0209179_1017929 3300027512 Bacteria 1347
288 Ga0209968_1000432 3300027526 Bacteria 6822
289 Ga0209999_1000076 3300027543 Bacteria 11363
290 Ga0209982_1000933 3300027552 Bacteria 3851
291 Ga0210002_1000011 3300027617 Bacteria 29194
292 Ga0209983_1000030 3300027665 Bacteria 19604
293 Ga0209971_1000049 3300027682 Bacteria 38907
294 Ga0209966_1000099 3300027695 Bacteria 38634
295 Ga0209998_10000099 3300027717 Bacteria 34329
296 Ga0209974_10000181 3300027876 Bacteria 19803
297 Ga0207428_10000707 3300027907 Bacteria 38658
298 Ga0207428_10011096 3300027907 Bacteria 8002
299 Ga0268266_10117474 3300028379 Bacteria 2364
300 Ga0268264_10012582 3300028381 Bacteria 6970
301 Ga0268264_10031283 3300028381 Bacteria 4364
302 Ga0265338_10009743 3300028800 Bacteria 11397
303 Ga0307408_100250474 3300031548 Bacteria 1460
304 Ga0307406_10041587 3300031901 Bacteria 2864
305 Ga0307407_10128676 3300031903 Bacteria 1616
306 Ga0307412_10008115 3300031911 Bacteria 5980
307 Ga0307416_100127192 3300032002 Bacteria 2284
308 Ga0307414_10189410 3300032004 Bacteria 1663
309 Ga0307415_100252621 3300032126 Bacteria 1433
310 Ga0373958_0089135 3300034819 Unclassified 709
311 Ga0373934_0035175 3300035086 Bacteria 1970
312 Ga0373939_0092568 3300035114 Bacteria 1024
313 Ga0373941_0099033 3300035115 Bacteria 1012
314 Ga0373953_0030611 3300035117 Bacteria 2088
315 Ga0373954_0004578 3300035118 Bacteria 5958
316 Ga0373954_0061067 3300035118 Bacteria 1778
317 Ga0373957_0037913 3300035120 Bacteria 1802
318 Ga0373946_0037239 3300035171 Bacteria 1976
319 Ga0373955_0012155 3300035172 Bacteria 4132
320 Ga0373955_0120607 3300035172 Bacteria 1524
321 Ga0316574_0233413 3300035398 Unclassified 1177
322 Ga0373931_0054344 3300035691 Bacteria 2140
323 Ga0373935_0033072 3300035692 Bacteria 3217
324 Ga0373935_0047600 3300035692 Bacteria 2712
325 Ga0373927_0030661 3300035695 Bacteria 3508
326 Ga0373927_0149635 3300035695 Bacteria 1529
327 Ga0373927_0214579 3300035695 Bacteria 1264
328 Ga0373933_0114767 3300035724 Bacteria 1683
329 Ga0373947_0038381 3300035725 Bacteria 2845
330 Ga0373947_0341536 3300035725 Bacteria 1003
331 Ga0373937_0001284 3300036401 Bacteria 21014
332 Ga0373937_0014636 3300036401 Bacteria 6926
333 Ga0373937_0041426 3300036401 Bacteria 4200
334 Ga0373937_0051861 3300036401 Bacteria 3760
335 Ga0373937_0060331 3300036401 Bacteria 3486
336 Ga0373937_0094562 3300036401 Bacteria 2771
337 Ga0316582_0045487 3300036647 Bacteria 2764
338 Ga0373925_0034377 3300037068 Bacteria 3735
339 Ga0373925_0076960 3300037068 Bacteria 2531
340 Ga0395905_0036945 3300037471 Bacteria 4589
341 Ga0436364_0173786 3300037853 Bacteria 2507
342 Ga0436364_0730168 3300037853 Bacteria 28599
343 Ga0436364_1023442 3300037853 Bacteria 1493
344 Ga0242420_006544 3300038996 Bacteria 1844
345 Ga0436365_0297382 3300039437 Bacteria 3078
346 Ga0436365_0855784 3300039437 Bacteria 2191
347 Ga0436360_1189697 3300039438 Bacteria 6715
348 Ga0436360_1332330 3300039438 Bacteria 1045
349 Ga0436361_0057841 3300039447 Bacteria 2652
350 Ga0436361_0226867 3300039447 Bacteria 1729
351 Ga0436361_0340965 3300039447 Bacteria 4573
352 Ga0436362_0036921 3300039453 Bacteria 4358
353 Ga0439447_007615 3300041407 Bacteria 3415
354 Ga0439453_0052394 3300041408 Bacteria 828
355 Ga0439466_0009337 3300041411 Bacteria 3666
356 Ga0439465_0035628 3300041413 Bacteria 1596
357 Ga0439431_0043459 3300041997 Bacteria 1150
358 Ga0439441_001529 3300042001 Bacteria 3060
359 Ga0439451_059883 3300042009 Bacteria 762
360 Ga0439452_008548 3300042010 Bacteria 3074
361 Ga0439455_0036024 3300042012 Bacteria 1251
362 Ga0450890_018782 3300042127 Bacteria 927
363 Ga0439446_0092703 3300042156 Bacteria 947
364 Ga0439460_0067397 3300042461 Bacteria 1103
365 Ga0451576_0035085 3300045051 Bacteria 5323
366 Ga0451576_0139551 3300045051 Bacteria 2528
367 Ga0451576_0571758 3300045051 Bacteria 1187
368 Ga0495592_0046572 3300046454 Bacteria 3232
369 Ga0495603_0080096 3300046455 Bacteria 1914
370 Ga0495629_0291882 3300046459 Bacteria 1118
371 Ga0495651_0023995 3300046462 Bacteria 4746
372 Ga0495653_0099604 3300046463 Bacteria 2108
373 Ga0495664_0001373 3300046477 Bacteria 12863
374 Ga0495608_0010357 3300046511 Bacteria 6507
375 Ga0495628_0002364 3300046516 Bacteria 17027
376 Ga0495630_0268040 3300046517 Bacteria 1305
377 Ga0495652_0030385 3300046529 Bacteria 4740
378 Ga0495665_0002470 3300046531 Bacteria 9996
379 Ga0495640_0054176 3300046533 Bacteria 2749
380 Ga0495640_0135625 3300046533 Bacteria 1590
381 Ga0495587_0032238 3300046536 Bacteria 3168
382 Ga0495645_0000743 3300046543 Bacteria 22265
383 Ga0495622_0088706 3300046557 Bacteria 1421
384 Ga0495667_0025099 3300046559 Bacteria 4018
385 Ga0495667_0045503 3300046559 Bacteria 2905
386 Ga0495635_0031167 3300046663 Bacteria 3704
387 Ga0495588_0381162 3300046674 Bacteria 740
388 Ga0495599_0031538 3300046678 Bacteria 3326
389 Ga0495669_0087685 3300046684 Bacteria 1434
390 Ga0495613_0229171 3300046689 Bacteria 1302
391 Ga0495600_0039500 3300046809 Bacteria 3073
392 Ga0495581_0013515 3300047315 Bacteria 4735
393 Ga0495581_0155138 3300047315 Bacteria 1338
394 Ga0495604_0001064 3300047317 Bacteria 22777
395 Ga0495674_0010943 3300047319 Bacteria 8570
396 Ga0495674_0335468 3300047319 Bacteria 1229
397 Ga0495680_0351589 3300047322 Bacteria 1026
398 Ga0495675_0003905 3300047444 Bacteria 9027
399 Ga0495675_0092556 3300047444 Bacteria 1897
400 Ga0495675_0097472 3300047444 Bacteria 1842
401 Ga0495684_0013916 3300047471 Bacteria 6189
402 Ga0495684_0207299 3300047471 Bacteria 1443
403 Ga0495593_0196000 3300047673 Bacteria 1015
404 Ga0495602_0000922 3300048088 Bacteria 28382
405 Ga0495602_0058773 3300048088 Bacteria 3364
406 Ga0495614_0141309 3300048089 Bacteria 1070
407 Ga0496102_0078513 3300048905 Bacteria 3039
408 Ga0496103_0217439 3300048906 Bacteria 1229
409 Ga0496104_0083853 3300048907 Bacteria 3040
410 Ga0496104_0291266 3300048907 Bacteria 1545
411 Ga0496104_0297496 3300048907 Bacteria 1526
412 Ga0496106_0138836 3300048909 Bacteria 1911
413 Ga0496112_0024265 3300048915 Bacteria 5804
414 Ga0496112_0316103 3300048915 Bacteria 1506
415 Ga0496114_0141424 3300048917 Bacteria 2084
416 Ga0496119_0013251 3300048922 Bacteria 6590
417 Ga0496126_0302672 3300048929 Bacteria 1319
418 Ga0501290_000607 3300049513 Bacteria 5391
419 Ga0501291_002810 3300049514 Bacteria 2117
420 Ga0501292_030926 3300049515 Unclassified 899
421 Ga0501297_000281 3300049520 Bacteria 5043
422 Ga0501298_001361 3300049521 Bacteria 3589
423 Ga0501299_001354 3300049522 Bacteria 3133
424 Ga0501299_007930 3300049522 Bacteria 1712
425 Ga0501300_001899 3300049523 Bacteria 3116
426 Ga0501301_000107 3300049524 Bacteria 4223
427 Ga0501303_000464 3300049526 Bacteria 3216
428 Ga0501031_0142394 3300049568 Unclassified 1567
429 Ga0501033_0157513 3300049570 Unclassified 1636
430 Ga0501034_0908823 3300049571 Unclassified 768
431 Ga0501039_0259865 3300049575 Bacteria 1365
432 Ga0501039_0267913 3300049575 Unclassified 1342
433 Ga0501043_0125805 3300049579 Unclassified 2010
434 Ga0501046_0165640 3300049580 Unclassified 1661
435 Ga0501048_0118524 3300049582 Unclassified 1870
436 Ga0501068_0046296 3300049584 Bacteria 2623
437 Ga0501070_0503602 3300049586 Unclassified 973
438 Ga0501071_0329627 3300049587 Unclassified 1160
439 Ga0501072_0126384 3300049588 Unclassified 2037
440 Ga0501074_0069117 3300049590 Bacteria 2539
441 Ga0501075_0202333 3300049591 Unclassified 1514
442 Ga0501076_0098335 3300049592 Unclassified 2357
443 Ga0501198_003384 3300049649 Bacteria 2175
444 Ga0501199_000420 3300049650 Bacteria 3787
445 Ga0501202_001663 3300049652 Bacteria 3600
446 Ga0501206_001953 3300049653 Bacteria 2599
447 Ga0501207_001344 3300049654 Bacteria 3056
448 Ga0501208_000808 3300049655 Bacteria 2658
449 Ga0501222_012055 3300049662 Bacteria 1139
450 Ga0501223_004325 3300049663 Bacteria 3051
451 Ga0501235_003530 3300049669 Bacteria 3384
452 Ga0501236_000505 3300049670 Bacteria 4389
453 Ga0501243_000940 3300049675 Bacteria 4078
454 Ga0501246_002711 3300049676 Bacteria 1402
455 Ga0501249_002393 3300049679 Bacteria 3790
456 Ga0501252_006544 3300049682 Bacteria 1299
457 Ga0501253_006192 3300049683 Bacteria 1608
458 Ga0501257_002400 3300049686 Bacteria 3947
459 Ga0501259_005739 3300049688 Bacteria 1969
460 Ga0501260_000167 3300049689 Bacteria 5011
461 Ga0501261_001319 3300049690 Bacteria 3043
462 Ga0501219_000875 3300049703 Bacteria 3751
463 Ga0501221_001633 3300049704 Bacteria 3726
464 Ga0501225_0000445 3300049705 Bacteria 12880
465 Ga0501234_000803 3300049707 Bacteria 4922
466 Ga0501245_000939 3300049708 Bacteria 3714
467 Ga0501079_0250907 3300049741 Bacteria 1383
468 Ga0501080_0459656 3300049742 Unclassified 1140
469 Ga0501081_0234795 3300049743 Unclassified 1336
470 Ga0501083_0104337 3300049744 Unclassified 1868
471 Ga0501232_001629 3300049757 Bacteria 1824
472 Ga0501262_001763 3300049759 Bacteria 2430
473 Ga0501264_000598 3300049761 Bacteria 5127
474 Ga0501266_002650 3300049763 Bacteria 2241
475 Ga0501270_000178 3300049767 Bacteria 5209
476 Ga0501274_000144 3300049771 Bacteria 4414
477 Ga0501279_000327 3300049775 Bacteria 6384
478 Ga0501283_000055 3300049779 Bacteria 14458
479 Ga0501035_0355081 3300049822 Bacteria 1226
480 Ga0501045_0065050 3300049824 Bacteria 2678
481 Ga0501204_001894 3300049850 Bacteria 2105
482 Ga0501212_002903 3300049851 Bacteria 2104
483 Ga0501226_001121 3300049853 Bacteria 3468
484 nmdc:mga03683_126044_c1 3300050489 Bacteria 1142
485 nmdc:mga0yw44_26838_c1 3300050492 Bacteria 3294
486 nmdc:mga0yw44_30077_c1 3300050492 Bacteria 3143
487 nmdc:mga06z11_68568_c1 3300050494 Bacteria 1870
488 nmdc:mga07m45_24779_c2 3300050496 Bacteria 1857
489 nmdc:mga05p37_164292_c1 3300050507 Bacteria 2710
490 nmdc:mga05p37_597966_c1 3300050507 Bacteria 1246
491 nmdc:mga09592_151994_c1 3300050508 Bacteria 1997
492 nmdc:mga09592_30172_c1 3300050508 Bacteria 4512
493 nmdc:mga09592_83723_c1 3300050508 Bacteria 2719
494 nmdc:mga0qj67_210430_c1 3300050509 Bacteria 1580
495 nmdc:mga0qj67_8701_c1 3300050509 Bacteria 7537
496 nmdc:mga06r32_10284_c1 3300050510 Bacteria 8440
497 nmdc:mga08y16_180099_c1 3300050511 Bacteria 2195
498 nmdc:mga08y16_6058_c1 3300050511 Bacteria 12677
499 nmdc:mga08y16_689911_c1 3300050511 Bacteria 1022
500 nmdc:mga08y16_693784_c1 3300050511 Bacteria 1019
501 nmdc:mga0n895_303598_c1 3300050512 Bacteria 1618
502 nmdc:mga0n895_382563_c1 3300050512 Bacteria 1424
503 nmdc:mga0n895_47408_c1 3300050512 Bacteria 4201
504 nmdc:mga0n895_53167_c1 3300050512 Bacteria 3979
505 nmdc:mga0rr50_126219_c1 3300050513 Bacteria 2043
506 nmdc:mga0rr50_19216_c1 3300050513 Bacteria 4606
507 nmdc:mga0rr50_97753_c1 3300050513 Bacteria 2300
508 nmdc:mga08x19_15248_c1 3300050514 Bacteria 4674
509 nmdc:mga08x19_82128_c1 3300050514 Bacteria 2117
510 nmdc:mga0a205_37036_c1 3300050515 Bacteria 4690
511 nmdc:mga0a205_4174_c1 3300050515 Bacteria 12946
512 nmdc:mga0a205_4222_c1 3300050515 Bacteria 12890
513 Ga0495601_0000302 3300053077 Bacteria 26211
514 Ga0495601_0021961 3300053077 Bacteria 3914
515 Ga0495601_0167969 3300053077 Bacteria 1433
516 Ga0495612_0001502 3300053078 Bacteria 9606
517 Ga0495595_0007045 3300053084 Bacteria 4595
518 Ga0495619_0434221 3300053085 Bacteria 906
519 Ga0500627_0162072 3300053158 Bacteria 1009
520 Ga0501084_0325762 3300054114 Bacteria 1298
521 Ga0501084_0332830 3300054114 Unclassified 1282
522 Ga0590075_015800 3300059424 Bacteria 1854
523 Ga0501082_0214023 3300060353 Unclassified 1676
524 Ga0530510_0046979 3300061734 Unclassified 3119
525 Ga0530510_0238548 3300061734 Unclassified 1353
526 Ga0373923_0057475
527 JGI25406J46586_10057067
528 JGI26145J50221_1001167
529 JGI26141J51220_1003442
530 Ga0058862_10629301
531 Ga0065704_10101879
532 Ga0065704_10110373
533 Ga0065712_10086704
534 Ga0065712_10159828
535 Ga0065707_10033906
536 Ga0070683_100057429
537 Ga0070690_100050587
538 Ga0070670_100002918
539 Ga0070677_10006139
540 Ga0068869_100036779
541 Ga0068869_100119767
542 Ga0070666_10004669
543 Ga0070666_10485886
544 Ga0070680_100007840
545 Ga0070680_100041387
546 Ga0070680_100045583
547 Ga0068868_100167187
548 Ga0070660_100419324
549 Ga0070689_100004380
550 Ga0070689_100010250
551 Ga0070689_100065872
552 Ga0070691_10027950
553 Ga0070691_10195446
554 Ga0070687_100006861
555 Ga0070687_100015313
556 Ga0070687_100026453
557 Ga0070661_100043565
558 Ga0070668_100254314
559 Ga0070669_100007201
560 Ga0070669_100025550
561 Ga0070675_100093105
562 Ga0070675_100210918
563 Ga0070671_100030416
564 Ga0070674_100009159
565 Ga0070674_100086207
566 Ga0070673_100044773
567 Ga0070688_100008623
568 Ga0070688_100025547
569 Ga0070659_100006190
570 Ga0070667_100013708
571 Ga0070667_100289665
572 Ga0070667_100695946
573 Ga0070709_10062996
574 Ga0070709_10224905
575 Ga0070711_100018695
576 Ga0070711_100157537
577 Ga0070711_100350381
578 Ga0070705_100074042
579 Ga0070705_100116196
580 Ga0070705_100583989
581 Ga0070700_100002231
582 Ga0070694_100021002
583 Ga0070694_100131727
584 Ga0070694_100209223
585 Ga0070663_100055162
586 Ga0070678_100004964
587 Ga0070678_100054999
588 Ga0070678_100169193
589 Ga0070662_100062696
590 Ga0070681_10000059
591 Ga0070681_10013094
592 Ga0070681_10268184
593 Ga0068867_100015381
594 Ga0068867_100072509
595 Ga0070685_10002109
596 Ga0070707_100174993
597 Ga0070707_100224913
598 Ga0070707_100349536
599 Ga0070698_100053974
600 Ga0070679_100006336
601 Ga0070679_100060241
602 Ga0070679_100197618
603 Ga0070684_100377978
604 Ga0070684_100403059
605 Ga0070684_100525196
606 Ga0068853_100400640
607 Ga0070672_100009782
608 Ga0070672_100029222
609 Ga0070686_100002532
610 Ga0070686_100010944
611 Ga0070695_100001262
612 Ga0070695_100107657
613 Ga0070695_100144883
614 Ga0070696_100012763
615 Ga0070696_100043924
616 Ga0070696_100060441
617 Ga0070693_100041374
618 Ga0070665_100121296
619 Ga0070664_100000697
620 Ga0070664_100052240
621 Ga0068857_100047506
622 Ga0068854_100008853
623 Ga0068854_100233090
624 Ga0068856_100034319
625 Ga0068856_100119556
626 Ga0070702_100004005
627 Ga0070702_100114183
628 Ga0068852_100332673
629 Ga0068859_100041446
630 Ga0068864_100080947
631 Ga0068864_100139044
632 Ga0068866_10114965
633 Ga0068861_100098101
634 Ga0068870_10066377
635 Ga0068858_100060461
636 Ga0068860_100429549
637 Ga0068862_100010751
638 Ga0081455_10000641
639 Ga0081455_10011101
640 Ga0081455_10227957
641 Ga0081539_10003586
642 Ga0070717_10049379
643 Ga0070717_10413668
644 Ga0075365_10019054
645 Ga0075365_10362815
646 Ga0075363_100126073
647 Ga0075364_10111475
648 Ga0075432_10003144
649 Ga0070716_100070378
650 Ga0070716_100111807
651 Ga0070712_100118680
652 Ga0070712_100191015
653 Ga0070712_100232421
654 Ga0075362_10093148
655 Ga0075362_10119476
656 Ga0075367_10077364
657 Ga0075427_10002908
658 Ga0097621_100027577
659 Ga0097621_100118391
660 Ga0097621_100410822
661 Ga0075370_10085776
662 Ga0068871_100002019
663 Ga0068871_100159249
664 Ga0075428_100160501
665 Ga0075428_100385952
666 Ga0075430_100013053
667 Ga0075430_100014672
668 Ga0075430_100030205
669 Ga0075431_100009072
670 Ga0075431_100025136
671 Ga0075433_10008179
672 Ga0075434_100126215
673 Ga0075434_100195041
674 Ga0075434_100460581
675 Ga0075434_100461175
676 Ga0075429_100016353
677 Ga0075429_100046948
678 Ga0068865_100012797
679 Ga0068865_100047194
680 Ga0075436_100142015
681 Ga0097620_100041443
682 Ga0099794_10054314
683 Ga0111539_10018395
684 Ga0111539_10606385
685 Ga0111539_10911280
686 Ga0105245_10052671
687 Ga0114129_10014952
688 Ga0114129_10036362
689 Ga0114129_10211520
690 Ga0105243_10188559
691 Ga0105241_10041812
692 Ga0105241_10220412
693 Ga0105242_10007201
694 Ga0105242_10014118
695 Ga0105242_10142377
696 Ga0105242_10255192
697 Ga0105248_10004525
698 Ga0105248_10109756
699 Ga0105248_10572646
700 Ga0105237_10051931
701 Ga0105249_10009298
702 Ga0105249_10053950
703 Ga0105239_10137140
704 Ga0105246_10059287
705 Ga0157371_10057773
706 Ga0157369_10180418
707 Ga0157369_10229161
708 Ga0157374_10017318
709 Ga0157374_10032359
710 Ga0157374_10049278
711 Ga0157378_10001616
712 Ga0157378_10020393
713 Ga0157372_10215939
714 Ga0157372_10986539
715 Ga0157375_10012404
716 Ga0157375_10199656
717 Ga0157380_10083918
718 Ga0157377_10002800
719 Ga0157377_10003891
720 Ga0157379_10332736
721 Ga0157376_10001364
722 Ga0157376_10004403
723 Ga0157376_10170617
724 Ga0157376_10542579
725 Ga0163161_10012669
726 Ga0163161_10205250
727 Ga0206356_11777606
728 Ga0213875_10000996
729 Ga0213871_10000607
730 Ga0207697_10006965
731 Ga0207697_10028614
732 Ga0207682_10004002
733 Ga0207642_10071661
734 Ga0207688_10022741
735 Ga0207680_10033448
736 Ga0207680_10098967
737 Ga0207680_10240948
738 Ga0207699_10253981
739 Ga0207645_10000179
740 Ga0207643_10086853
741 Ga0207654_10066421
742 Ga0207654_10196820
743 Ga0207707_10000097
744 Ga0207707_10035355
745 Ga0207671_10175587
746 Ga0207693_10020016
747 Ga0207693_10020167
748 Ga0207693_10214466
749 Ga0207663_10039684
750 Ga0207663_10397197
751 Ga0207660_10005602
752 Ga0207660_10105480
753 Ga0207662_10000994
754 Ga0207662_10003549
755 Ga0207662_10033769
756 Ga0207649_10317465
757 Ga0207652_10004707
758 Ga0207646_10131843
759 Ga0207646_10230440
760 Ga0207681_10018112
761 Ga0207650_10005467
762 Ga0207659_10120955
763 Ga0207659_10298030
764 Ga0207659_10368727
765 Ga0207687_10014612
766 Ga0207700_10106553
767 Ga0207700_10121155
768 Ga0207664_10124351
769 Ga0207664_10262318
770 Ga0207644_10147572
771 Ga0207690_10056721
772 Ga0207706_10000210
773 Ga0207709_10016769
774 Ga0207670_10048764
775 Ga0207669_10097064
776 Ga0207704_10003044
777 Ga0207704_10023241
778 Ga0207691_10001052
779 Ga0207691_10031513
780 Ga0207711_10094146
781 Ga0207689_10002408
782 Ga0207661_10271330
783 Ga0207679_10002115
784 Ga0207640_10007050
785 Ga0207658_10071404
786 Ga0207658_10138307
787 Ga0207677_10364904
788 Ga0207677_10765852
789 Ga0207678_10160147
790 Ga0207702_10009731
791 Ga0207702_10067561
792 Ga0207702_10206371
793 Ga0207641_10146026
794 Ga0207648_10000719
795 Ga0207648_10009714
796 Ga0207676_10078420
797 Ga0207676_10200553
798 Ga0207674_10078204
799 Ga0207675_100008013
800 Ga0207683_10000066
801 Ga0207683_10068624
802 Ga0207698_10445751
803 Ga0209973_1002257
804 Ga0209973_1006650
805 Ga0209969_1000012
806 Ga0209967_1000677
807 Ga0209981_1000015
808 Ga0209996_1000425
809 Ga0209984_1000289
810 Ga0210000_1000355
811 Ga0209995_1000084
812 Ga0209179_1017929
813 Ga0209968_1000432
814 Ga0209999_1000076
815 Ga0209982_1000933
816 Ga0210002_1000011
817 Ga0209983_1000030
818 Ga0209971_1000049
819 Ga0209966_1000099
820 Ga0209998_10000099
821 Ga0209974_10000181
822 Ga0207428_10000707
823 Ga0207428_10011096
824 Ga0268266_10117474
825 Ga0268264_10012582
826 Ga0268264_10031283
827 Ga0265338_10009743
828 Ga0307408_100250474
829 Ga0307406_10041587
830 Ga0307407_10128676
831 Ga0307412_10008115
832 Ga0307416_100127192
833 Ga0307414_10189410
834 Ga0307415_100252621
835 Ga0373958_0089135
836 Ga0373934_0035175
837 Ga0373939_0092568
838 Ga0373941_0099033
839 Ga0373953_0030611
840 Ga0373954_0004578
841 Ga0373954_0061067
842 Ga0373957_0037913
843 Ga0373946_0037239
844 Ga0373955_0012155
845 Ga0373955_0120607
846 Ga0316574_0233413
847 Ga0373931_0054344
848 Ga0373935_0033072
849 Ga0373935_0047600
850 Ga0373927_0030661
851 Ga0373927_0149635
852 Ga0373927_0214579
853 Ga0373933_0114767
854 Ga0373947_0038381
855 Ga0373947_0341536
856 Ga0373937_0001284
857 Ga0373937_0014636
858 Ga0373937_0041426
859 Ga0373937_0051861
860 Ga0373937_0060331
861 Ga0373937_0094562
862 Ga0316582_0045487
863 Ga0373925_0034377
864 Ga0373925_0076960
865 Ga0395905_0036945
866 Ga0436364_0173786
867 Ga0436364_0730168
868 Ga0436364_1023442
869 Ga0242420_006544
870 Ga0436365_0297382
871 Ga0436365_0855784
872 Ga0436360_1189697
873 Ga0436360_1332330
874 Ga0436361_0057841
875 Ga0436361_0226867
876 Ga0436361_0340965
877 Ga0436362_0036921
878 Ga0439447_007615
879 Ga0439453_0052394
880 Ga0439466_0009337
881 Ga0439465_0035628
882 Ga0439431_0043459
883 Ga0439441_001529
884 Ga0439451_059883
885 Ga0439452_008548
886 Ga0439455_0036024
887 Ga0450890_018782
888 Ga0439446_0092703
889 Ga0439460_0067397
890 Ga0451576_0035085
891 Ga0451576_0139551
892 Ga0451576_0571758
893 Ga0495592_0046572
894 Ga0495603_0080096
895 Ga0495629_0291882
896 Ga0495651_0023995
897 Ga0495653_0099604
898 Ga0495664_0001373
899 Ga0495608_0010357
900 Ga0495628_0002364
901 Ga0495630_0268040
902 Ga0495652_0030385
903 Ga0495665_0002470
904 Ga0495640_0054176
905 Ga0495640_0135625
906 Ga0495587_0032238
907 Ga0495645_0000743
908 Ga0495622_0088706
909 Ga0495667_0025099
910 Ga0495667_0045503
911 Ga0495635_0031167
912 Ga0495588_0381162
913 Ga0495599_0031538
914 Ga0495669_0087685
915 Ga0495613_0229171
916 Ga0495600_0039500
917 Ga0495581_0013515
918 Ga0495581_0155138
919 Ga0495604_0001064
920 Ga0495674_0010943
921 Ga0495674_0335468
922 Ga0495680_0351589
923 Ga0495675_0003905
924 Ga0495675_0092556
925 Ga0495675_0097472
926 Ga0495684_0013916
927 Ga0495684_0207299
928 Ga0495593_0196000
929 Ga0495602_0000922
930 Ga0495602_0058773
931 Ga0495614_0141309
932 Ga0496102_0078513
933 Ga0496103_0217439
934 Ga0496104_0083853
935 Ga0496104_0291266
936 Ga0496104_0297496
937 Ga0496106_0138836
938 Ga0496112_0024265
939 Ga0496112_0316103
940 Ga0496114_0141424
941 Ga0496119_0013251
942 Ga0496126_0302672
943 Ga0501290_000607
944 Ga0501291_002810
945 Ga0501292_030926
946 Ga0501297_000281
947 Ga0501298_001361
948 Ga0501299_001354
949 Ga0501299_007930
950 Ga0501300_001899
951 Ga0501301_000107
952 Ga0501303_000464
953 Ga0501031_0142394
954 Ga0501033_0157513
955 Ga0501034_0908823
956 Ga0501039_0259865
957 Ga0501039_0267913
958 Ga0501043_0125805
959 Ga0501046_0165640
960 Ga0501048_0118524
961 Ga0501068_0046296
962 Ga0501070_0503602
963 Ga0501071_0329627
964 Ga0501072_0126384
965 Ga0501074_0069117
966 Ga0501075_0202333
967 Ga0501076_0098335
968 Ga0501198_003384
969 Ga0501199_000420
970 Ga0501202_001663
971 Ga0501206_001953
972 Ga0501207_001344
973 Ga0501208_000808
974 Ga0501222_012055
975 Ga0501223_004325
976 Ga0501235_003530
977 Ga0501236_000505
978 Ga0501243_000940
979 Ga0501246_002711
980 Ga0501249_002393
981 Ga0501252_006544
982 Ga0501253_006192
983 Ga0501257_002400
984 Ga0501259_005739
985 Ga0501260_000167
986 Ga0501261_001319
987 Ga0501219_000875
988 Ga0501221_001633
989 Ga0501225_0000445
990 Ga0501234_000803
991 Ga0501245_000939
992 Ga0501079_0250907
993 Ga0501080_0459656
994 Ga0501081_0234795
995 Ga0501083_0104337
996 Ga0501232_001629
997 Ga0501262_001763
998 Ga0501264_000598
999 Ga0501266_002650
1000 Ga0501270_000178
1001 Ga0501274_000144
1002 Ga0501279_000327
1003 Ga0501283_000055
1004 Ga0501035_0355081
1005 Ga0501045_0065050
1006 Ga0501204_001894
1007 Ga0501212_002903
1008 Ga0501226_001121
1009 nmdc:mga03683_126044_c1
1010 nmdc:mga0yw44_26838_c1
1011 nmdc:mga0yw44_30077_c1
1012 nmdc:mga06z11_68568_c1
1013 nmdc:mga07m45_24779_c2
1014 nmdc:mga05p37_164292_c1
1015 nmdc:mga05p37_597966_c1
1016 nmdc:mga09592_151994_c1
1017 nmdc:mga09592_30172_c1
1018 nmdc:mga09592_83723_c1
1019 nmdc:mga0qj67_210430_c1
1020 nmdc:mga0qj67_8701_c1
1021 nmdc:mga06r32_10284_c1
1022 nmdc:mga08y16_180099_c1
1023 nmdc:mga08y16_6058_c1
1024 nmdc:mga08y16_689911_c1
1025 nmdc:mga08y16_693784_c1
1026 nmdc:mga0n895_303598_c1
1027 nmdc:mga0n895_382563_c1
1028 nmdc:mga0n895_47408_c1
1029 nmdc:mga0n895_53167_c1
1030 nmdc:mga0rr50_126219_c1
1031 nmdc:mga0rr50_19216_c1
1032 nmdc:mga0rr50_97753_c1
1033 nmdc:mga08x19_15248_c1
1034 nmdc:mga08x19_82128_c1
1035 nmdc:mga0a205_37036_c1
1036 nmdc:mga0a205_4174_c1
1037 nmdc:mga0a205_4222_c1
1038 Ga0495601_0000302
1039 Ga0495601_0021961
1040 Ga0495601_0167969
1041 Ga0495612_0001502
1042 Ga0495595_0007045
1043 Ga0495619_0434221
1044 Ga0500627_0162072
1045 Ga0501084_0325762
1046 Ga0501084_0332830
1047 Ga0590075_015800
1048 Ga0501082_0214023
1049 Ga0530510_0046979
1050 Ga0530510_0238548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

239

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

292

0.92

PF08659

KR

KR domain

44

222

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9917 3 256
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9903 3 256
1iy8-assembly1.cif.gz_B crystal structure of levodione reductase 0.9888 3 257
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9829 6 256
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9819 3 256
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9917 3 256 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9889 3 257 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 3 256 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9772 1 256 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 3 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1E4LIT3-F1-model_v4 Oxidoreductase 0.9933 54 260
AF-A0A845DH81-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.993 1 78
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9915 1 185 GO:0016491
AF-A0A212TZJ1-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.99 54 257
AF-A0A3D3X3L6-F1-model_v4 3-oxoacyl-ACP reductase 0.9872 81 174 GO:0016616
GO:0030497

Map