F458236

General Info

Members Datasets Scaffolds Average Seq Length
518 330 1036 152

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10035647|Ga0099794_100356473
Length 176
Sequence MRAPDQRSDAACIHVAQMEDMAMRNFDLTPLWRSTVGFDRLFDRIEEVPQLTGEDNYPPYNIERTSEDAYRISLALAGFMPEEITVTAEQNLLTVEGRKAEKEDHQYLYQGISARPFRRQFNLADYVQVKGASFENGLLKIDLVREVPEAMKPRQIQIASGTAGNGNQQTEHKKAA

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
120 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
242 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
246 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
256 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
260 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
267 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
268 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
269 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
270 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
271 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
272 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
273 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
274 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
275 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
276 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
277 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
278 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
279 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
280 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
281 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
282 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
283 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
284 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
285 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
286 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
287 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
288 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
289 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
290 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
291 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
292 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
293 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
294 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
295 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
296 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
297 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
298 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
299 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
300 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
301 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
302 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
303 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
304 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
305 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
306 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
307 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
308 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
309 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
310 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
311 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
312 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
313 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
314 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
315 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
316 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
317 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
318 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
319 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
320 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
321 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
322 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
323 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
324 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
325 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
326 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
327 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
328 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
329 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
330 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.8
Metatranscriptomes 9.07
Isolates 13.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.02
Nodule 10.81
Rhizoplane 1.93
Rhizosphere 62.74
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10035647 3300007265 Bacteria 2349
2 Ga0006770J48903_1036700 3300003305 Bacteria 649
3 JGI25160J50197_1003895 3300003354 Bacteria 6544
4 Ga0007417J51691_1066316 3300003544 Bacteria 563
5 Ga0007417J51691_1077017 3300003544 Bacteria 578
6 Ga0007416J51690_1029463 3300003577 Bacteria 959
7 Ga0007416J51690_1034682 3300003577 Bacteria 567
8 Ga0007429J51699_1021022 3300003579 Bacteria 525
9 Ga0007429J51699_1035675 3300003579 Bacteria 604
10 Ga0058859_10001287 3300004798 Bacteria 517
11 Ga0065707_10207024 3300005295 Bacteria 1261
12 Ga0070658_10270539 3300005327 Bacteria 1445
13 Ga0070683_101461931 3300005329 Bacteria 657
14 Ga0070690_100714632 3300005330 Bacteria 770
15 Ga0068869_100538583 3300005334 Bacteria 979
16 Ga0070680_101929944 3300005336 Bacteria 512
17 Ga0070660_101193402 3300005339 Bacteria 645
18 Ga0070689_100702537 3300005340 Bacteria 883
19 Ga0070687_101153779 3300005343 Bacteria 569
20 Ga0070668_100155171 3300005347 Bacteria 1854
21 Ga0070673_100502582 3300005364 Bacteria 1097
22 Ga0070709_10840069 3300005434 Bacteria 723
23 Ga0070713_100302547 3300005436 Bacteria 1472
24 Ga0070711_100205416 3300005439 Bacteria 1523
25 Ga0070711_100526552 3300005439 Bacteria 978
26 Ga0070711_100920695 3300005439 Bacteria 747
27 Ga0070711_101533622 3300005439 Bacteria 582
28 Ga0070678_101852351 3300005456 Bacteria 569
29 Ga0070681_10190594 3300005458 Bacteria 1970
30 Ga0070707_101052138 3300005468 Bacteria 779
31 Ga0070698_100545715 3300005471 Bacteria 1098
32 Ga0070698_101201714 3300005471 Bacteria 707
33 Ga0070699_100195997 3300005518 Bacteria 1796
34 Ga0070679_100164287 3300005530 Bacteria 2194
35 Ga0070684_100224522 3300005535 Bacteria 1714
36 Ga0070697_100025407 3300005536 Bacteria 4725
37 Ga0068853_100454668 3300005539 Bacteria 1205
38 Ga0070686_100034007 3300005544 Bacteria 3137
39 Ga0070665_100088287 3300005548 Bacteria 3106
40 Ga0070665_100148941 3300005548 Bacteria 2343
41 Ga0068856_100711969 3300005614 Bacteria 1024
42 Ga0068859_101364642 3300005617 Bacteria 782
43 Ga0068864_100259817 3300005618 Bacteria 1615
44 Ga0068864_100994408 3300005618 Bacteria 832
45 Ga0068864_101241098 3300005618 Bacteria 745
46 Ga0068861_100348521 3300005719 Bacteria 1298
47 Ga0068863_101125626 3300005841 Bacteria 790
48 Ga0068860_100108802 3300005843 Bacteria 2649
49 Ga0081538_10059270 3300005981 Bacteria 2212
50 Ga0070717_10120459 3300006028 Bacteria 2247
51 Ga0070717_10377941 3300006028 Unclassified 1270
52 Ga0075365_10023764 3300006038 Bacteria 3858
53 Ga0075365_10144002 3300006038 Bacteria 1655
54 Ga0075365_10283940 3300006038 Bacteria 1165
55 Ga0075365_11291198 3300006038 Bacteria 513
56 Ga0075368_10003408 3300006042 Bacteria 5305
57 Ga0075368_10003653 3300006042 Bacteria 5155
58 Ga0075368_10173498 3300006042 Bacteria 907
59 Ga0075363_100014119 3300006048 Bacteria 3893
60 Ga0075363_100067269 3300006048 Bacteria 1941
61 Ga0075363_100659956 3300006048 Bacteria 630
62 Ga0075364_10008082 3300006051 Bacteria 6274
63 Ga0075364_10111574 3300006051 Bacteria 1825
64 Ga0075364_10176914 3300006051 Bacteria 1443
65 Ga0075364_10951211 3300006051 Bacteria 584
66 Ga0070715_10019955 3300006163 Bacteria 2578
67 Ga0070716_100590083 3300006173 Bacteria 834
68 Ga0070712_100428485 3300006175 Bacteria 1097
69 Ga0070712_100623394 3300006175 Bacteria 914
70 Ga0075362_10008643 3300006177 Bacteria 3908
71 Ga0075362_10083666 3300006177 Bacteria 1473
72 Ga0075362_10188879 3300006177 Bacteria 1000
73 Ga0075367_10011237 3300006178 Bacteria 4729
74 Ga0075367_10028587 3300006178 Bacteria 3182
75 Ga0075367_10176395 3300006178 Bacteria 1332
76 Ga0075369_10021003 3300006186 Bacteria 2678
77 Ga0075369_10432831 3300006186 Bacteria 622
78 Ga0075366_10031524 3300006195 Bacteria 3120
79 Ga0075366_10045766 3300006195 Bacteria 2593
80 Ga0075366_10051670 3300006195 Bacteria 2442
81 Ga0075366_10061832 3300006195 Bacteria 2226
82 Ga0097621_100173565 3300006237 Bacteria 1859
83 Ga0075370_10019535 3300006353 Bacteria 3692
84 Ga0075370_10160155 3300006353 Bacteria 1321
85 Ga0075370_10210666 3300006353 Bacteria 1147
86 Ga0075370_10213516 3300006353 Bacteria 1139
87 Ga0068871_100214480 3300006358 Bacteria 1666
88 Ga0075428_100049449 3300006844 Bacteria 4613
89 Ga0075428_101162022 3300006844 Bacteria 814
90 Ga0075428_101343353 3300006844 Bacteria 751
91 Ga0075431_100271602 3300006847 Bacteria 1718
92 Ga0075431_100714662 3300006847 Bacteria 979
93 Ga0075433_10105164 3300006852 Bacteria 2501
94 Ga0075433_10422049 3300006852 Bacteria 1176
95 Ga0075433_10860897 3300006852 Bacteria 791
96 Ga0075434_100901400 3300006871 Bacteria 899
97 Ga0075429_100224279 3300006880 Bacteria 1646
98 Ga0068865_100966406 3300006881 Bacteria 744
99 Ga0099824_1015098 3300006942 Bacteria 7446
100 Ga0099824_1038466 3300006942 Bacteria 1272
101 Ga0099822_1013855 3300006943 Bacteria 9374
102 Ga0099823_1080289 3300006944 Bacteria 1272
103 Ga0075435_100505927 3300007076 Bacteria 1044
104 Ga0105240_11004153 3300009093 Bacteria 892
105 Ga0105245_10714721 3300009098 Bacteria 1036
106 Ga0105247_10012942 3300009101 Bacteria 5003
107 Ga0105247_10625054 3300009101 Bacteria 801
108 Ga0114129_10177358 3300009147 Bacteria 2902
109 Ga0114129_10305775 3300009147 Bacteria 2118
110 Ga0114129_10685039 3300009147 Bacteria 1319
111 Ga0114129_11701299 3300009147 Bacteria 770
112 Ga0114129_12223881 3300009147 Bacteria 659
113 Ga0105241_10160101 3300009174 Bacteria 1850
114 Ga0105242_10423681 3300009176 Bacteria 1248
115 Ga0105248_10277496 3300009177 Bacteria 1887
116 Ga0105237_10001185 3300009545 Bacteria 34865
117 Ga0105237_10892175 3300009545 Bacteria 896
118 Ga0105238_10000896 3300009551 Bacteria 30640
119 Ga0105238_10040798 3300009551 Bacteria 4702
120 Ga0105239_10001229 3300010375 Bacteria 34896
121 Ga0105239_10399102 3300010375 Bacteria 1556
122 Ga0105239_10572122 3300010375 Bacteria 1287
123 Ga0105239_10654582 3300010375 Bacteria 1200
124 Ga0105239_11020606 3300010375 Bacteria 951
125 Ga0105239_11574994 3300010375 Bacteria 760
126 Ga0105239_12222595 3300010375 Bacteria 638
127 Ga0105246_10184523 3300011119 Bacteria 1609
128 Ga0105246_10332058 3300011119 Bacteria 1239
129 Ga0157378_10720630 3300013297 Bacteria 1018
130 Ga0163162_10000378 3300013306 Bacteria 40518
131 Ga0163162_10616620 3300013306 Unclassified 1210
132 Ga0157372_10581888 3300013307 Bacteria 1305
133 Ga0163163_11520105 3300014325 Bacteria 731
134 Ga0157380_11459029 3300014326 Bacteria 736
135 Ga0157379_11478939 3300014968 Bacteria 660
136 Ga0157379_11805295 3300014968 Bacteria 601
137 Ga0157376_10114943 3300014969 Bacteria 2375
138 Ga0197907_10514155 3300020069 Bacteria 640
139 Ga0206349_1384233 3300020075 Bacteria 631
140 Ga0206349_1758842 3300020075 Bacteria 723
141 Ga0206351_10231422 3300020077 Bacteria 575
142 Ga0206351_10249541 3300020077 Bacteria 649
143 Ga0206351_10783214 3300020077 Bacteria 560
144 Ga0206351_10865550 3300020077 Bacteria 639
145 Ga0206351_10878744 3300020077 Bacteria 1050
146 Ga0206351_10955207 3300020077 Bacteria 706
147 Ga0206351_10997162 3300020077 Bacteria 1408
148 Ga0206352_10269781 3300020078 Bacteria 540
149 Ga0206352_11314839 3300020078 Bacteria 661
150 Ga0206350_10033202 3300020080 Bacteria 569
151 Ga0206350_10168238 3300020080 Bacteria 531
152 Ga0206350_10434004 3300020080 Bacteria 771
153 Ga0206350_10744320 3300020080 Bacteria 771
154 Ga0206350_10748600 3300020080 Bacteria 733
155 Ga0206350_10828232 3300020080 Bacteria 827
156 Ga0206350_10908810 3300020080 Bacteria 632
157 Ga0206350_11166415 3300020080 Bacteria 725
158 Ga0206350_11236470 3300020080 Bacteria 1640
159 Ga0206350_11341683 3300020080 Bacteria 572
160 Ga0154015_1473506 3300020610 Bacteria 669
161 Ga0154015_1668854 3300020610 Bacteria 616
162 Ga0213876_10090876 3300021384 Bacteria 1617
163 Ga0224712_10045387 3300022467 Bacteria 1681
164 Ga0224712_10096115 3300022467 Bacteria 1249
165 Ga0224712_10099712 3300022467 Bacteria 1229
166 Ga0224712_10150473 3300022467 Bacteria 1031
167 Ga0224712_10197412 3300022467 Bacteria 913
168 Ga0224712_10230201 3300022467 Bacteria 851
169 Ga0224712_10260974 3300022467 Bacteria 802
170 Ga0224712_10424580 3300022467 Bacteria 636
171 Ga0224712_10526079 3300022467 Bacteria 573
172 Ga0224712_10532309 3300022467 Bacteria 570
173 Ga0224712_10534702 3300022467 Bacteria 569
174 Ga0224712_10551648 3300022467 Bacteria 560
175 Ga0224712_10578902 3300022467 Bacteria 547
176 Ga0209677_100542 3300025253 Bacteria 21020
177 Ga0209758_1000526 3300025297 Bacteria 61197
178 Ga0209758_1067310 3300025297 Bacteria 1146
179 Ga0207426_1000401 3300025302 Bacteria 73412
180 Ga0207426_1023298 3300025302 Bacteria 2114
181 Ga0209257_1049621 3300025304 Bacteria 1193
182 Ga0207697_10083334 3300025315 Bacteria 1349
183 Ga0207710_10034563 3300025900 Bacteria 2222
184 Ga0207705_10021867 3300025909 Bacteria 4563
185 Ga0207684_10311864 3300025910 Bacteria 1356
186 Ga0207654_10058416 3300025911 Bacteria 2245
187 Ga0207707_10345730 3300025912 Bacteria 1282
188 Ga0207695_10971718 3300025913 Bacteria 729
189 Ga0207671_10017639 3300025914 Bacteria 5498
190 Ga0207671_10076850 3300025914 Bacteria 2499
191 Ga0207693_10032231 3300025915 Bacteria 4136
192 Ga0207693_10343093 3300025915 Bacteria 1169
193 Ga0207660_10756079 3300025917 Bacteria 793
194 Ga0207660_11207178 3300025917 Bacteria 615
195 Ga0207652_10404963 3300025921 Bacteria 1231
196 Ga0207694_10016680 3300025924 Bacteria 5551
197 Ga0207694_10043951 3300025924 Bacteria 3448
198 Ga0207700_10143293 3300025928 Bacteria 1966
199 Ga0207664_11447157 3300025929 Unclassified 608
200 Ga0207644_10994867 3300025931 Bacteria 704
201 Ga0207686_10521696 3300025934 Bacteria 925
202 Ga0207665_10980680 3300025939 Bacteria 672
203 Ga0207711_10309028 3300025941 Bacteria 1459
204 Ga0207651_10420453 3300025960 Bacteria 1141
205 Ga0207668_10535523 3300025972 Bacteria 1012
206 Ga0207668_11402959 3300025972 Bacteria 630
207 Ga0207677_10432393 3300026023 Bacteria 1124
208 Ga0207676_10454573 3300026095 Bacteria 1208
209 Ga0207676_11049551 3300026095 Bacteria 804
210 Ga0207675_100424803 3300026118 Bacteria 1313
211 Ga0207683_10947692 3300026121 Bacteria 799
212 Ga0209389_1000054 3300027296 Bacteria 108815
213 Ga0209389_1003218 3300027296 Bacteria 13037
214 Ga0209389_1063640 3300027296 Bacteria 2205
215 Ga0209589_1000002 3300027357 Bacteria 708598
216 Ga0209489_100002 3300027361 Bacteria 708609
217 Ga0209489_107377 3300027361 Bacteria 16456
218 Ga0209489_108942 3300027361 Bacteria 13037
219 Ga0209489_109362 3300027361 Bacteria 12274
220 Ga0209700_100002 3300027363 Bacteria 708598
221 Ga0209700_100041 3300027363 Bacteria 168380
222 Ga0209813_10088365 3300027866 Bacteria 1036
223 Ga0268266_10000021 3300028379 Bacteria 522453
224 Ga0268266_10002120 3300028379 Bacteria 21911
225 Ga0268266_11498287 3300028379 Bacteria 650
226 Ga0268264_10081613 3300028381 Bacteria 2764
227 Ga0265330_10024357 3300031235 Bacteria 2745
228 Ga0265325_10150487 3300031241 Bacteria 1101
229 Ga0307510_10001447 3300033180 Bacteria 26132
230 Ga0315911_1000026 3300033442 Bacteria 88844
231 Ga0373934_0140402 3300035086 Bacteria 988
232 Ga0373934_0187280 3300035086 Bacteria 851
233 Ga0373923_0034198 3300035111 Bacteria 2062
234 Ga0373953_0005675 3300035117 Bacteria 4066
235 Ga0373954_0006164 3300035118 Bacteria 5225
236 Ga0373954_0014124 3300035118 Bacteria 3559
237 Ga0373954_0130169 3300035118 Bacteria 1225
238 Ga0373956_0050537 3300035119 Bacteria 1867
239 Ga0373956_0155887 3300035119 Bacteria 1075
240 Ga0373955_0055418 3300035172 Bacteria 2171
241 Ga0373961_0130742 3300035241 Bacteria 840
242 Ga0373931_0970038 3300035691 Bacteria 574
243 Ga0373935_0641172 3300035692 Bacteria 779
244 Ga0373937_0012526 3300036401 Bacteria 7461
245 Ga0373937_0167677 3300036401 Bacteria 2059
246 Ga0395900_0531174 3300037418 Bacteria 1123
247 Ga0395898_0074615 3300037466 Bacteria 3276
248 Ga0395898_0081740 3300037466 Bacteria 3115
249 Ga0395898_0119045 3300037466 Bacteria 2530
250 Ga0395898_0206959 3300037466 Bacteria 1872
251 Ga0395905_0015455 3300037471 Bacteria 7257
252 Ga0395905_0028610 3300037471 Bacteria 5253
253 Ga0436364_0140443 3300037853 Bacteria 713
254 Ga0436364_0226203 3300037853 Bacteria 786
255 Ga0395901_0106832 3300038443 Bacteria 2938
256 Ga0395901_0350779 3300038443 Bacteria 1523
257 Ga0395901_1255899 3300038443 Bacteria 704
258 Ga0436365_0076016 3300039437 Bacteria 2704
259 Ga0436365_1132685 3300039437 Bacteria 842
260 Ga0451835_0763402 3300041492 Bacteria 756
261 Ga0466965_0669039 3300044683 Bacteria 594
262 Ga0466966_0117484 3300044684 Bacteria 1636
263 Ga0466963_0066456 3300044694 Bacteria 2419
264 Ga0466963_0117885 3300044694 Bacteria 1825
265 Ga0466964_0144204 3300044706 Bacteria 1098
266 Ga0466964_0155949 3300044706 Bacteria 1063
267 Ga0466970_0468885 3300044765 Bacteria 723
268 Ga0466959_0043542 3300045049 Bacteria 3309
269 Ga0466967_0192442 3300045976 Bacteria 1928
270 Ga0466967_0215982 3300045976 Bacteria 1820
271 Ga0466967_0319063 3300045976 Bacteria 1498
272 Ga0466967_0469522 3300045976 Bacteria 1231
273 Ga0495592_0037162 3300046454 Bacteria 3666
274 Ga0495629_0074955 3300046459 Bacteria 2363
275 Ga0495651_0001758 3300046462 Bacteria 16722
276 Ga0495651_0119086 3300046462 Bacteria 1942
277 Ga0495653_0001841 3300046463 Bacteria 16738
278 Ga0495653_0148523 3300046463 Bacteria 1640
279 Ga0495650_0000564 3300046471 Bacteria 52182
280 Ga0495664_0125682 3300046477 Bacteria 1552
281 Ga0495608_0019007 3300046511 Bacteria 4735
282 Ga0495618_0119537 3300046514 Bacteria 1688
283 Ga0495618_0298799 3300046514 Bacteria 1001
284 Ga0495628_0025477 3300046516 Bacteria 4832
285 Ga0495628_0249285 3300046516 Bacteria 1326
286 Ga0495630_0926485 3300046517 Bacteria 663
287 Ga0495652_0008852 3300046529 Bacteria 9159
288 Ga0495652_0013641 3300046529 Bacteria 7312
289 Ga0495640_0141536 3300046533 Bacteria 1550
290 Ga0495586_0047704 3300046535 Bacteria 2313
291 Ga0495587_0002476 3300046536 Bacteria 12326
292 Ga0495587_0008294 3300046536 Bacteria 6689
293 Ga0495667_0001223 3300046559 Bacteria 16826
294 Ga0495667_0022097 3300046559 Bacteria 4288
295 Ga0495634_0112073 3300046642 Bacteria 1753
296 Ga0495625_0120776 3300046660 Bacteria 1783
297 Ga0495635_0001744 3300046663 Bacteria 14648
298 Ga0495635_0004206 3300046663 Bacteria 9984
299 Ga0495657_0001003 3300046675 Bacteria 24863
300 Ga0495657_0010953 3300046675 Bacteria 6801
301 Ga0495599_0001559 3300046678 Bacteria 13206
302 Ga0495599_0272327 3300046678 Bacteria 1027
303 Ga0495623_0000922 3300046679 Bacteria 19895
304 Ga0495613_0450775 3300046689 Bacteria 872
305 Ga0495613_0595783 3300046689 Bacteria 736
306 Ga0495600_0000450 3300046809 Bacteria 21272
307 Ga0495600_0009567 3300046809 Bacteria 5992
308 Ga0495600_0879453 3300046809 Bacteria 530
309 Ga0495604_0002102 3300047317 Bacteria 16026
310 Ga0495604_0091978 3300047317 Bacteria 2248
311 Ga0495674_0292981 3300047319 Bacteria 1330
312 Ga0495680_0009729 3300047322 Bacteria 8629
313 Ga0495680_0182762 3300047322 Bacteria 1512
314 Ga0495675_0000734 3300047444 Bacteria 20461
315 Ga0495675_0026570 3300047444 Bacteria 3691
316 Ga0495684_0005998 3300047471 Bacteria 9441
317 Ga0495684_0100632 3300047471 Bacteria 2185
318 Ga0495602_0010657 3300048088 Bacteria 9534
319 Ga0495602_0028432 3300048088 Bacteria 5350
320 Ga0495602_0470183 3300048088 Bacteria 884
321 Ga0496108_0209789 3300048911 Bacteria 1691
322 Ga0496108_0606886 3300048911 Bacteria 953
323 Ga0496109_0393173 3300048912 Bacteria 1310
324 Ga0496109_0971864 3300048912 Bacteria 787
325 Ga0496109_1430986 3300048912 Bacteria 627
326 Ga0496110_0441382 3300048913 Bacteria 1186
327 Ga0496112_0332191 3300048915 Bacteria 1464
328 Ga0496112_0434991 3300048915 Bacteria 1250
329 Ga0496112_1141910 3300048915 Bacteria 697
330 Ga0496115_0012608 3300048918 Bacteria 6368
331 Ga0496118_0136025 3300048921 Bacteria 1568
332 Ga0496119_0289664 3300048922 Bacteria 811
333 Ga0496121_0145942 3300048924 Bacteria 1748
334 Ga0496121_0182158 3300048924 Bacteria 1515
335 Ga0496121_0276734 3300048924 Bacteria 1150
336 Ga0496125_0026792 3300048928 Bacteria 5238
337 Ga0496125_0081778 3300048928 Bacteria 2466
338 Ga0496126_0027549 3300048929 Bacteria 5426
339 Ga0496126_0539027 3300048929 Bacteria 928
340 Ga0501031_0599038 3300049568 Bacteria 709
341 Ga0501032_0369788 3300049569 Bacteria 922
342 Ga0501033_0002965 3300049570 Bacteria 14174
343 Ga0501034_0084689 3300049571 Bacteria 3172
344 Ga0501034_0386226 3300049571 Bacteria 1324
345 Ga0501034_0623040 3300049571 Bacteria 983
346 Ga0501037_0037273 3300049573 Bacteria 3584
347 Ga0501038_0028883 3300049574 Bacteria 4922
348 Ga0501038_0130548 3300049574 Bacteria 2063
349 Ga0501038_0642039 3300049574 Bacteria 800
350 Ga0501039_0114369 3300049575 Bacteria 2111
351 Ga0501047_0003626 3300049581 Bacteria 14546
352 Ga0501047_0019144 3300049581 Bacteria 6567
353 Ga0501067_0020877 3300049583 Bacteria 3625
354 Ga0501068_0190283 3300049584 Bacteria 1299
355 Ga0501069_0092486 3300049585 Bacteria 1711
356 Ga0501070_0003564 3300049586 Bacteria 13464
357 Ga0501070_0045919 3300049586 Bacteria 3632
358 Ga0501071_0046737 3300049587 Bacteria 3109
359 Ga0501072_0011807 3300049588 Bacteria 6673
360 Ga0501072_0147136 3300049588 Bacteria 1878
361 Ga0501072_0321889 3300049588 Bacteria 1229
362 Ga0501073_0038309 3300049589 Bacteria 3401
363 Ga0501073_0076582 3300049589 Bacteria 2327
364 Ga0501073_0349953 3300049589 Bacteria 1020
365 Ga0501074_0027888 3300049590 Bacteria 4092
366 Ga0501075_0946472 3300049591 Bacteria 655
367 Ga0501076_0152927 3300049592 Bacteria 1877
368 Ga0501077_0123689 3300049593 Bacteria 1640
369 Ga0501079_0141816 3300049741 Bacteria 1872
370 Ga0501079_0161184 3300049741 Bacteria 1749
371 Ga0501080_0073720 3300049742 Bacteria 3175
372 Ga0501080_0204940 3300049742 Bacteria 1809
373 Ga0501080_0716242 3300049742 Bacteria 882
374 Ga0501081_0087941 3300049743 Bacteria 2183
375 Ga0501081_0248633 3300049743 Bacteria 1298
376 Ga0501083_0144750 3300049744 Bacteria 1556
377 Ga0501035_0008059 3300049822 Bacteria 9820
378 Ga0501044_0090685 3300049823 Bacteria 3083
379 Ga0501044_0124817 3300049823 Bacteria 2572
380 Ga0501045_0565684 3300049824 Bacteria 843
381 nmdc:mga03683_40372_c1 3300050489 Bacteria 1913
382 nmdc:mga03n38_235379_c1 3300050490 Bacteria 962
383 nmdc:mga03n38_493192_c1 3300050490 Bacteria 686
384 nmdc:mga03n38_91930_c1 3300050490 Bacteria 1446
385 nmdc:mga00v17_123925_c1 3300050491 Bacteria 1648
386 nmdc:mga00v17_349777_c1 3300050491 Bacteria 961
387 nmdc:mga0yw44_1197894_c1 3300050492 Bacteria 512
388 nmdc:mga0yw44_208578_c1 3300050492 Bacteria 1292
389 nmdc:mga0k408_109250_c1 3300050493 Bacteria 1634
390 nmdc:mga0k408_28122_c1 3300050493 Bacteria 3196
391 nmdc:mga0k408_47455_c1 3300050493 Bacteria 2482
392 nmdc:mga0k408_47541_c1 3300050493 Bacteria 1960
393 nmdc:mga06z11_285103_c1 3300050494 Bacteria 979
394 nmdc:mga06z11_382112_c1 3300050494 Bacteria 846
395 nmdc:mga06z11_60249_c1 3300050494 Bacteria 1976
396 nmdc:mga04h51_190157_c1 3300050495 Bacteria 803
397 nmdc:mga04h51_237392_c1 3300050495 Bacteria 727
398 nmdc:mga07m45_118689_c1 3300050496 Bacteria 1527
399 nmdc:mga07m45_332519_c1 3300050496 Bacteria 883
400 nmdc:mga07m45_33273_c1 3300050496 Bacteria 2862
401 nmdc:mga05p37_245998_c1 3300050507 Bacteria 2147
402 nmdc:mga05p37_925658_c1 3300050507 Bacteria 936
403 nmdc:mga09592_644480_c1 3300050508 Bacteria 905
404 nmdc:mga06r32_707248_c1 3300050510 Bacteria 973
405 nmdc:mga08y16_280285_c1 3300050511 Bacteria 1719
406 nmdc:mga0n895_1850720_c1 3300050512 Bacteria 563
407 nmdc:mga0n895_241846_c1 3300050512 Bacteria 1832
408 nmdc:mga0rr50_296003_c1 3300050513 Bacteria 1353
409 nmdc:mga0a205_450895_c1 3300050515 Bacteria 1146
410 nmdc:mga0sz30_117476_c1 3300050516 Bacteria 1168
411 nmdc:mga0sz30_3521_c1 3300050516 Bacteria 5646
412 Ga0495601_0198982 3300053077 Bacteria 1309
413 Ga0495601_0291191 3300053077 Bacteria 1064
414 Ga0495612_0077249 3300053078 Bacteria 1395
415 Ga0495595_0005233 3300053084 Bacteria 5238
416 Ga0495595_0120529 3300053084 Bacteria 1278
417 Ga0495619_0005628 3300053085 Bacteria 7950
418 Ga0495619_0027486 3300053085 Bacteria 3664
419 Ga0500643_000068 3300053087 Bacteria 117369
420 Ga0500646_0025379 3300053090 Bacteria 1600
421 Ga0500647_0031730 3300053091 Bacteria 2515
422 Ga0500583_0077509 3300053092 Bacteria 1600
423 Ga0500566_0080950 3300053094 Bacteria 1807
424 Ga0500640_192810 3300053095 Bacteria 722
425 Ga0500650_0335956 3300053098 Bacteria 663
426 Ga0500557_000029 3300053105 Bacteria 77152
427 Ga0500572_022195 3300053111 Bacteria 1690
428 Ga0500607_024013 3300053121 Bacteria 3409
429 Ga0500608_010352 3300053122 Bacteria 4001
430 Ga0500642_0000220 3300053130 Bacteria 22666
431 Ga0500559_0023936 3300053136 Bacteria 2594
432 Ga0500564_027769 3300053138 Bacteria 2605
433 Ga0500590_037283 3300053148 Bacteria 2512
434 Ga0500604_0020301 3300053151 Bacteria 1869
435 Ga0500619_018990 3300053154 Bacteria 1940
436 Ga0500638_092616 3300053162 Bacteria 1420
437 Ga0500636_0000112 3300053177 Bacteria 42041
438 Ga0500636_0091299 3300053177 Bacteria 1744
439 Ga0500637_0070441 3300053178 Bacteria 2011
440 Ga0500625_065913 3300053729 Bacteria 1627
441 Ga0500601_045978 3300053737 Bacteria 537
442 Ga0501084_0357427 3300054114 Bacteria 1234
443 Ga0501084_1316824 3300054114 Bacteria 605
444 Ga0590074_050633 3300059423 Bacteria 760
445 Ga0587073_0159829 3300059492 Bacteria 645
446 Ga0587111_0122797 3300060346 Bacteria 671
447 Ga0501082_0468134 3300060353 Bacteria 1101
448 Ga0501082_0707508 3300060353 Bacteria 882
449 Ga0501082_1073068 3300060353 Bacteria 704
450 Ga0530510_0039853 3300061734 Bacteria 3390
451 2509148045 2508501128 Bacteria 8613869
452 2513660555 2513237096 Bacteria 8722461
453 2513863423 2513237137 Bacteria 9558895
454 2513922396 2513237145 Bacteria 8979722
455 2517890844 2517572143 Bacteria 9484767
456 2793061815 2791355196 Bacteria 7323613
457 2793066177 2791355197 Bacteria 8420563
458 2824619180 2824617872 Bacteria 8814715
459 2824628171 2824626560 Bacteria 8813858
460 2824636867 2824635225 Bacteria 8785348
461 2824645749 2824644064 Bacteria 8743947
462 2824671052 2824661429 Bacteria 9877870
463 2824705984 2824704595 Bacteria 9667483
464 2824706421 2824704595 Bacteria 9667483
465 2824715928 2824714736 Bacteria 8717648
466 2824725330 2824723954 Bacteria 8758240
467 2824755061 2824753945 Bacteria 9787441
468 2824758846 2824753945 Bacteria 9787441
469 2824765087 2824763712 Bacteria 9792355
470 2824769317 2824763712 Bacteria 9792355
471 2842042484 2842038055 Bacteria 8002051
472 2842050527 2842045827 Bacteria 8006841
473 2844316712 2844315083 Bacteria 8138177
474 2847938756 2847930680 Bacteria 9342022
475 2857512388 2857509624 Bacteria 7472071
476 2874626248 2874620515 Bacteria 8290088
477 2879088269 2879083081 Bacteria 8587928
478 2881365887 2881364244 Bacteria 7710352
479 2885366719 2885366525 Bacteria 8326213
480 2888427005 2888419890 Bacteria 7857137
481 2903733767 2903727486 Bacteria 8281579
482 2904669266 2904666416 Bacteria 8226587
483 2904695060 2904690495 Bacteria 9412302
484 2904716474 2904711408 Bacteria 9771557
485 2904720110 2904711408 Bacteria 9771557
486 2906608049 2906602504 Bacteria 8295279
487 2908756925 2908756301 Bacteria 8864324
488 2935771276 2935769743 Bacteria 7878163
489 2935780890 2935777560 Bacteria 8077691
490 2935786023 2935785616 Bacteria 7962367
491 2935797794 2935793552 Bacteria 8012592
492 2937055669 2937049772 Bacteria 6757901
493 2957390516 2957388812 Bacteria 6778072
494 2964654050 2964649959 Bacteria 6675118
495 2967694294 2967693043 Bacteria 6804451
496 2970047053 2970040964 Bacteria 6731123
497 2970120232 2970116247 Bacteria 6501857
498 2970135630 2970129317 Bacteria 6806560
499 2970166689 2970164137 Bacteria 6861252
500 2977581149 2977579622 Bacteria 6772100
501 3005481940 3005474847 Bacteria 9259049
502 3005600576 3005594810 Bacteria 8716512
503 8006927919 8006926726 Bacteria 6749210
504 8016528435 8016522445 Bacteria 8156687
505 8016533590 8016530956 Bacteria 8155261
506 8016546818 8016539877 Bacteria 8155419
507 8016555303 8016548790 Bacteria 8155074
508 8016563662 8016557553 Bacteria 8154380
509 8016571925 8016566248 Bacteria 8158151
510 8016576132 8016575299 Bacteria 8154085
511 8016601395 8016595262 Bacteria 8149947
512 8016609039 8016603502 Bacteria 8731218
513 8016615864 8016613128 Bacteria 8794220
514 8016625368 8016622563 Bacteria 7999408
515 8019533377 8019530166 Bacteria 8155624
516 8019546288 8019538911 Bacteria 7872763
517 8019552414 8019547302 Bacteria 7996444
518 8056694972 8056689827 Bacteria 6712655
519 Ga0099794_10035647
520 Ga0006770J48903_1036700
521 JGI25160J50197_1003895
522 Ga0007417J51691_1066316
523 Ga0007417J51691_1077017
524 Ga0007416J51690_1029463
525 Ga0007416J51690_1034682
526 Ga0007429J51699_1021022
527 Ga0007429J51699_1035675
528 Ga0058859_10001287
529 Ga0065707_10207024
530 Ga0070658_10270539
531 Ga0070683_101461931
532 Ga0070690_100714632
533 Ga0068869_100538583
534 Ga0070680_101929944
535 Ga0070660_101193402
536 Ga0070689_100702537
537 Ga0070687_101153779
538 Ga0070668_100155171
539 Ga0070673_100502582
540 Ga0070709_10840069
541 Ga0070713_100302547
542 Ga0070711_100205416
543 Ga0070711_100526552
544 Ga0070711_100920695
545 Ga0070711_101533622
546 Ga0070678_101852351
547 Ga0070681_10190594
548 Ga0070707_101052138
549 Ga0070698_100545715
550 Ga0070698_101201714
551 Ga0070699_100195997
552 Ga0070679_100164287
553 Ga0070684_100224522
554 Ga0070697_100025407
555 Ga0068853_100454668
556 Ga0070686_100034007
557 Ga0070665_100088287
558 Ga0070665_100148941
559 Ga0068856_100711969
560 Ga0068859_101364642
561 Ga0068864_100259817
562 Ga0068864_100994408
563 Ga0068864_101241098
564 Ga0068861_100348521
565 Ga0068863_101125626
566 Ga0068860_100108802
567 Ga0081538_10059270
568 Ga0070717_10120459
569 Ga0070717_10377941
570 Ga0075365_10023764
571 Ga0075365_10144002
572 Ga0075365_10283940
573 Ga0075365_11291198
574 Ga0075368_10003408
575 Ga0075368_10003653
576 Ga0075368_10173498
577 Ga0075363_100014119
578 Ga0075363_100067269
579 Ga0075363_100659956
580 Ga0075364_10008082
581 Ga0075364_10111574
582 Ga0075364_10176914
583 Ga0075364_10951211
584 Ga0070715_10019955
585 Ga0070716_100590083
586 Ga0070712_100428485
587 Ga0070712_100623394
588 Ga0075362_10008643
589 Ga0075362_10083666
590 Ga0075362_10188879
591 Ga0075367_10011237
592 Ga0075367_10028587
593 Ga0075367_10176395
594 Ga0075369_10021003
595 Ga0075369_10432831
596 Ga0075366_10031524
597 Ga0075366_10045766
598 Ga0075366_10051670
599 Ga0075366_10061832
600 Ga0097621_100173565
601 Ga0075370_10019535
602 Ga0075370_10160155
603 Ga0075370_10210666
604 Ga0075370_10213516
605 Ga0068871_100214480
606 Ga0075428_100049449
607 Ga0075428_101162022
608 Ga0075428_101343353
609 Ga0075431_100271602
610 Ga0075431_100714662
611 Ga0075433_10105164
612 Ga0075433_10422049
613 Ga0075433_10860897
614 Ga0075434_100901400
615 Ga0075429_100224279
616 Ga0068865_100966406
617 Ga0099824_1015098
618 Ga0099824_1038466
619 Ga0099822_1013855
620 Ga0099823_1080289
621 Ga0075435_100505927
622 Ga0105240_11004153
623 Ga0105245_10714721
624 Ga0105247_10012942
625 Ga0105247_10625054
626 Ga0114129_10177358
627 Ga0114129_10305775
628 Ga0114129_10685039
629 Ga0114129_11701299
630 Ga0114129_12223881
631 Ga0105241_10160101
632 Ga0105242_10423681
633 Ga0105248_10277496
634 Ga0105237_10001185
635 Ga0105237_10892175
636 Ga0105238_10000896
637 Ga0105238_10040798
638 Ga0105239_10001229
639 Ga0105239_10399102
640 Ga0105239_10572122
641 Ga0105239_10654582
642 Ga0105239_11020606
643 Ga0105239_11574994
644 Ga0105239_12222595
645 Ga0105246_10184523
646 Ga0105246_10332058
647 Ga0157378_10720630
648 Ga0163162_10000378
649 Ga0163162_10616620
650 Ga0157372_10581888
651 Ga0163163_11520105
652 Ga0157380_11459029
653 Ga0157379_11478939
654 Ga0157379_11805295
655 Ga0157376_10114943
656 Ga0197907_10514155
657 Ga0206349_1384233
658 Ga0206349_1758842
659 Ga0206351_10231422
660 Ga0206351_10249541
661 Ga0206351_10783214
662 Ga0206351_10865550
663 Ga0206351_10878744
664 Ga0206351_10955207
665 Ga0206351_10997162
666 Ga0206352_10269781
667 Ga0206352_11314839
668 Ga0206350_10033202
669 Ga0206350_10168238
670 Ga0206350_10434004
671 Ga0206350_10744320
672 Ga0206350_10748600
673 Ga0206350_10828232
674 Ga0206350_10908810
675 Ga0206350_11166415
676 Ga0206350_11236470
677 Ga0206350_11341683
678 Ga0154015_1473506
679 Ga0154015_1668854
680 Ga0213876_10090876
681 Ga0224712_10045387
682 Ga0224712_10096115
683 Ga0224712_10099712
684 Ga0224712_10150473
685 Ga0224712_10197412
686 Ga0224712_10230201
687 Ga0224712_10260974
688 Ga0224712_10424580
689 Ga0224712_10526079
690 Ga0224712_10532309
691 Ga0224712_10534702
692 Ga0224712_10551648
693 Ga0224712_10578902
694 Ga0209677_100542
695 Ga0209758_1000526
696 Ga0209758_1067310
697 Ga0207426_1000401
698 Ga0207426_1023298
699 Ga0209257_1049621
700 Ga0207697_10083334
701 Ga0207710_10034563
702 Ga0207705_10021867
703 Ga0207684_10311864
704 Ga0207654_10058416
705 Ga0207707_10345730
706 Ga0207695_10971718
707 Ga0207671_10017639
708 Ga0207671_10076850
709 Ga0207693_10032231
710 Ga0207693_10343093
711 Ga0207660_10756079
712 Ga0207660_11207178
713 Ga0207652_10404963
714 Ga0207694_10016680
715 Ga0207694_10043951
716 Ga0207700_10143293
717 Ga0207664_11447157
718 Ga0207644_10994867
719 Ga0207686_10521696
720 Ga0207665_10980680
721 Ga0207711_10309028
722 Ga0207651_10420453
723 Ga0207668_10535523
724 Ga0207668_11402959
725 Ga0207677_10432393
726 Ga0207676_10454573
727 Ga0207676_11049551
728 Ga0207675_100424803
729 Ga0207683_10947692
730 Ga0209389_1000054
731 Ga0209389_1003218
732 Ga0209389_1063640
733 Ga0209589_1000002
734 Ga0209489_100002
735 Ga0209489_107377
736 Ga0209489_108942
737 Ga0209489_109362
738 Ga0209700_100002
739 Ga0209700_100041
740 Ga0209813_10088365
741 Ga0268266_10000021
742 Ga0268266_10002120
743 Ga0268266_11498287
744 Ga0268264_10081613
745 Ga0265330_10024357
746 Ga0265325_10150487
747 Ga0307510_10001447
748 Ga0315911_1000026
749 Ga0373934_0140402
750 Ga0373934_0187280
751 Ga0373923_0034198
752 Ga0373953_0005675
753 Ga0373954_0006164
754 Ga0373954_0014124
755 Ga0373954_0130169
756 Ga0373956_0050537
757 Ga0373956_0155887
758 Ga0373955_0055418
759 Ga0373961_0130742
760 Ga0373931_0970038
761 Ga0373935_0641172
762 Ga0373937_0012526
763 Ga0373937_0167677
764 Ga0395900_0531174
765 Ga0395898_0074615
766 Ga0395898_0081740
767 Ga0395898_0119045
768 Ga0395898_0206959
769 Ga0395905_0015455
770 Ga0395905_0028610
771 Ga0436364_0140443
772 Ga0436364_0226203
773 Ga0395901_0106832
774 Ga0395901_0350779
775 Ga0395901_1255899
776 Ga0436365_0076016
777 Ga0436365_1132685
778 Ga0451835_0763402
779 Ga0466965_0669039
780 Ga0466966_0117484
781 Ga0466963_0066456
782 Ga0466963_0117885
783 Ga0466964_0144204
784 Ga0466964_0155949
785 Ga0466970_0468885
786 Ga0466959_0043542
787 Ga0466967_0192442
788 Ga0466967_0215982
789 Ga0466967_0319063
790 Ga0466967_0469522
791 Ga0495592_0037162
792 Ga0495629_0074955
793 Ga0495651_0001758
794 Ga0495651_0119086
795 Ga0495653_0001841
796 Ga0495653_0148523
797 Ga0495650_0000564
798 Ga0495664_0125682
799 Ga0495608_0019007
800 Ga0495618_0119537
801 Ga0495618_0298799
802 Ga0495628_0025477
803 Ga0495628_0249285
804 Ga0495630_0926485
805 Ga0495652_0008852
806 Ga0495652_0013641
807 Ga0495640_0141536
808 Ga0495586_0047704
809 Ga0495587_0002476
810 Ga0495587_0008294
811 Ga0495667_0001223
812 Ga0495667_0022097
813 Ga0495634_0112073
814 Ga0495625_0120776
815 Ga0495635_0001744
816 Ga0495635_0004206
817 Ga0495657_0001003
818 Ga0495657_0010953
819 Ga0495599_0001559
820 Ga0495599_0272327
821 Ga0495623_0000922
822 Ga0495613_0450775
823 Ga0495613_0595783
824 Ga0495600_0000450
825 Ga0495600_0009567
826 Ga0495600_0879453
827 Ga0495604_0002102
828 Ga0495604_0091978
829 Ga0495674_0292981
830 Ga0495680_0009729
831 Ga0495680_0182762
832 Ga0495675_0000734
833 Ga0495675_0026570
834 Ga0495684_0005998
835 Ga0495684_0100632
836 Ga0495602_0010657
837 Ga0495602_0028432
838 Ga0495602_0470183
839 Ga0496108_0209789
840 Ga0496108_0606886
841 Ga0496109_0393173
842 Ga0496109_0971864
843 Ga0496109_1430986
844 Ga0496110_0441382
845 Ga0496112_0332191
846 Ga0496112_0434991
847 Ga0496112_1141910
848 Ga0496115_0012608
849 Ga0496118_0136025
850 Ga0496119_0289664
851 Ga0496121_0145942
852 Ga0496121_0182158
853 Ga0496121_0276734
854 Ga0496125_0026792
855 Ga0496125_0081778
856 Ga0496126_0027549
857 Ga0496126_0539027
858 Ga0501031_0599038
859 Ga0501032_0369788
860 Ga0501033_0002965
861 Ga0501034_0084689
862 Ga0501034_0386226
863 Ga0501034_0623040
864 Ga0501037_0037273
865 Ga0501038_0028883
866 Ga0501038_0130548
867 Ga0501038_0642039
868 Ga0501039_0114369
869 Ga0501047_0003626
870 Ga0501047_0019144
871 Ga0501067_0020877
872 Ga0501068_0190283
873 Ga0501069_0092486
874 Ga0501070_0003564
875 Ga0501070_0045919
876 Ga0501071_0046737
877 Ga0501072_0011807
878 Ga0501072_0147136
879 Ga0501072_0321889
880 Ga0501073_0038309
881 Ga0501073_0076582
882 Ga0501073_0349953
883 Ga0501074_0027888
884 Ga0501075_0946472
885 Ga0501076_0152927
886 Ga0501077_0123689
887 Ga0501079_0141816
888 Ga0501079_0161184
889 Ga0501080_0073720
890 Ga0501080_0204940
891 Ga0501080_0716242
892 Ga0501081_0087941
893 Ga0501081_0248633
894 Ga0501083_0144750
895 Ga0501035_0008059
896 Ga0501044_0090685
897 Ga0501044_0124817
898 Ga0501045_0565684
899 nmdc:mga03683_40372_c1
900 nmdc:mga03n38_235379_c1
901 nmdc:mga03n38_493192_c1
902 nmdc:mga03n38_91930_c1
903 nmdc:mga00v17_123925_c1
904 nmdc:mga00v17_349777_c1
905 nmdc:mga0yw44_1197894_c1
906 nmdc:mga0yw44_208578_c1
907 nmdc:mga0k408_109250_c1
908 nmdc:mga0k408_28122_c1
909 nmdc:mga0k408_47455_c1
910 nmdc:mga0k408_47541_c1
911 nmdc:mga06z11_285103_c1
912 nmdc:mga06z11_382112_c1
913 nmdc:mga06z11_60249_c1
914 nmdc:mga04h51_190157_c1
915 nmdc:mga04h51_237392_c1
916 nmdc:mga07m45_118689_c1
917 nmdc:mga07m45_332519_c1
918 nmdc:mga07m45_33273_c1
919 nmdc:mga05p37_245998_c1
920 nmdc:mga05p37_925658_c1
921 nmdc:mga09592_644480_c1
922 nmdc:mga06r32_707248_c1
923 nmdc:mga08y16_280285_c1
924 nmdc:mga0n895_1850720_c1
925 nmdc:mga0n895_241846_c1
926 nmdc:mga0rr50_296003_c1
927 nmdc:mga0a205_450895_c1
928 nmdc:mga0sz30_117476_c1
929 nmdc:mga0sz30_3521_c1
930 Ga0495601_0198982
931 Ga0495601_0291191
932 Ga0495612_0077249
933 Ga0495595_0005233
934 Ga0495595_0120529
935 Ga0495619_0005628
936 Ga0495619_0027486
937 Ga0500643_000068
938 Ga0500646_0025379
939 Ga0500647_0031730
940 Ga0500583_0077509
941 Ga0500566_0080950
942 Ga0500640_192810
943 Ga0500650_0335956
944 Ga0500557_000029
945 Ga0500572_022195
946 Ga0500607_024013
947 Ga0500608_010352
948 Ga0500642_0000220
949 Ga0500559_0023936
950 Ga0500564_027769
951 Ga0500590_037283
952 Ga0500604_0020301
953 Ga0500619_018990
954 Ga0500638_092616
955 Ga0500636_0000112
956 Ga0500636_0091299
957 Ga0500637_0070441
958 Ga0500625_065913
959 Ga0500601_045978
960 Ga0501084_0357427
961 Ga0501084_1316824
962 Ga0590074_050633
963 Ga0587073_0159829
964 Ga0587111_0122797
965 Ga0501082_0468134
966 Ga0501082_0707508
967 Ga0501082_1073068
968 Ga0530510_0039853
969 2509148045
970 2513660555
971 2513863423
972 2513922396
973 2517890844
974 2793061815
975 2793066177
976 2824619180
977 2824628171
978 2824636867
979 2824645749
980 2824671052
981 2824705984
982 2824706421
983 2824715928
984 2824725330
985 2824755061
986 2824758846
987 2824765087
988 2824769317
989 2842042484
990 2842050527
991 2844316712
992 2847938756
993 2857512388
994 2874626248
995 2879088269
996 2881365887
997 2885366719
998 2888427005
999 2903733767
1000 2904669266
1001 2904695060
1002 2904716474
1003 2904720110
1004 2906608049
1005 2908756925
1006 2935771276
1007 2935780890
1008 2935786023
1009 2935797794
1010 2937055669
1011 2957390516
1012 2964654050
1013 2967694294
1014 2970047053
1015 2970120232
1016 2970135630
1017 2970166689
1018 2977581149
1019 3005481940
1020 3005600576
1021 8006927919
1022 8016528435
1023 8016533590
1024 8016546818
1025 8016555303
1026 8016563662
1027 8016571925
1028 8016576132
1029 8016601395
1030 8016609039
1031 8016615864
1032 8016625368
1033 8019533377
1034 8019546288
1035 8019552414
1036 8056694972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

62

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zul-assembly1.cif.gz_C-2 small heat shock protein from mycobacterium marinum m : form-3 0.8112 37 125
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8106 37 123
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.803 37 123
7ck4-assembly1.cif.gz_F structural and functional analysis of small heat shock protein from synechococcus phage s-shm2 0.7913 37 127
4m5t-assembly3.cif.gz_C disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.7879 43 127
ID Description Score Start End Superfamily
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8566 36 138 2.60.40.790
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8506 37 124 2.60.40.790
2o7pB02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8462 106 123 3.40.430.10
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.834 36 138 2.60.40.790
af_Q8WXU2_4_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8287 38 125 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A4S0IBR2-F1-model_v4 deleted 0.8933 30 122
AF-A0A356NZ66-F1-model_v4 Heat-shock protein 0.854 21 140
AF-A0A382TAE1-F1-model_v4 SHSP domain-containing protein 0.8441 21 140
AF-A0A3M5ICQ6-F1-model_v4 deleted 0.8368 1 138
AF-A0A3M5ICQ6-F1-model_v4 deleted 0.8309 1 138

Map