F457437

General Info

Members Datasets Scaffolds Average Seq Length
512 287 480 373

Family's Representative Sequence

Representative Sequence 3300027552|Ga0209982_1005646|Ga0209982_10056462
Length 416
Sequence VLQFRFDNQPYRVKLEFSVRESTMTLPATPLPRSKAPASKIAVRLTGLWKTYPGGTNPAVKDLSIDVLDGEILTLLGPSGCGKTTTLRMVAGLETPDAGDIFFGDQAVVMSSRQVSLPPNKRNVGMVFQSYAIWPHMTVAENVAFPLKARRFPKKEIKERVLRALDLVGLTGFEDRPGPLLSGGQQQRVAFARALVTEPRVLLLDEPFSNLDAKLREQMRISVKLLQKRLNIAMLFVTHDQIEALSLSNRIALMNFGVVQQQGDPRLLYEAPVNEFVRDFVGRTLLFKGTVHTSTPSGMIVIALAGARDCVVFGRSYNPAGVTAGESVYIGVRPEDVEIRAALGGEVPSGMIGGKVEAALFVGERIEYQVEVDGQGLIFIYGERHEPIEEGNKVWLKLRSEGHSAWSSDWSHKVEC

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2773857925 Microvirga vignae BR3299 Isolate Unclassified
6 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
7 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
8 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
9 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
10 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
11 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
12 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
13 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
14 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
15 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
16 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
17 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
18 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
19 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
20 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
21 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
22 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
23 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
24 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
25 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
26 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
27 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
28 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
29 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
133 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
134 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
135 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
285 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
286 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
287 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 5.08
Rhizoplane 2.73
Rhizosphere 86.33
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000038 3300002704 Bacteria 93696
2 JGI25156J39149_1000048 3300002705 Bacteria 93954
3 JGI25154J39366_1000071 3300002738 Bacteria 93822
4 JGI25157J39369_1000200 3300002741 Bacteria 50803
5 Ga0055532_1000571 3300003758 Bacteria 15378
6 Ga0065712_10069080 3300005290 Bacteria 8070
7 Ga0065715_10006436 3300005293 Bacteria 4500
8 Ga0065707_10091530 3300005295 Bacteria 3926
9 Ga0070658_10097657 3300005327 Bacteria 2425
10 Ga0070676_10011517 3300005328 Bacteria 4808
11 Ga0070683_100302758 3300005329 Bacteria 1521
12 Ga0070690_100021474 3300005330 Bacteria 3942
13 Ga0070670_100004243 3300005331 Bacteria 11991
14 Ga0068869_100015958 3300005334 Bacteria 5055
15 Ga0068869_100174757 3300005334 Bacteria 1680
16 Ga0070666_10103591 3300005335 Bacteria 1963
17 Ga0070680_100034644 3300005336 Bacteria 4071
18 Ga0070682_100007427 3300005337 Bacteria 6181
19 Ga0070682_100085807 3300005337 Bacteria 2049
20 Ga0068868_100141818 3300005338 Bacteria 1973
21 Ga0070689_100079293 3300005340 Bacteria 2575
22 Ga0070689_100231494 3300005340 Bacteria 1519
23 Ga0070691_10000599 3300005341 Bacteria 13800
24 Ga0070661_100003346 3300005344 Bacteria 11057
25 Ga0070668_100134959 3300005347 Bacteria 1984
26 Ga0070669_100005285 3300005353 Bacteria 9323
27 Ga0070671_100001934 3300005355 Bacteria 15879
28 Ga0070674_100129389 3300005356 Bacteria 1880
29 Ga0070673_100009901 3300005364 Bacteria 6422
30 Ga0070659_100194416 3300005366 Bacteria 1668
31 Ga0070709_10003006 3300005434 Bacteria 9077
32 Ga0070709_10016401 3300005434 Bacteria 4227
33 Ga0070709_10023291 3300005434 Bacteria 3633
34 Ga0070714_100000685 3300005435 Bacteria 23915
35 Ga0070714_100002782 3300005435 Bacteria 12896
36 Ga0070714_100024528 3300005435 Bacteria 4968
37 Ga0070714_100060953 3300005435 Bacteria 3239
38 Ga0070714_100163950 3300005435 Bacteria 2013
39 Ga0070713_100001510 3300005436 Bacteria 14826
40 Ga0070713_100016356 3300005436 Bacteria 5577
41 Ga0070713_100289661 3300005436 Bacteria 1504
42 Ga0070710_10006866 3300005437 Bacteria 5493
43 Ga0070710_10019725 3300005437 Bacteria 3489
44 Ga0070710_10221697 3300005437 Bacteria 1203
45 Ga0070701_10018993 3300005438 Bacteria 3241
46 Ga0070711_100028250 3300005439 Bacteria 3690
47 Ga0070705_100007985 3300005440 Bacteria 5229
48 Ga0070705_100026520 3300005440 Bacteria 3155
49 Ga0070705_100190249 3300005440 Bacteria 1398
50 Ga0070708_100000483 3300005445 Bacteria 30274
51 Ga0070708_100235473 3300005445 Bacteria 1718
52 Ga0070663_100001526 3300005455 Bacteria 12739
53 Ga0070678_100000819 3300005456 Bacteria 15745
54 Ga0070662_100170608 3300005457 Bacteria 1708
55 Ga0070681_10011623 3300005458 Bacteria 8716
56 Ga0070681_10013597 3300005458 Bacteria 8099
57 Ga0070681_10016898 3300005458 Bacteria 7289
58 Ga0070706_100273935 3300005467 Bacteria 1575
59 Ga0070706_100276707 3300005467 Bacteria 1566
60 Ga0070707_100031310 3300005468 Bacteria 5066
61 Ga0070707_100087944 3300005468 Bacteria 3005
62 Ga0070707_100094001 3300005468 Bacteria 2903
63 Ga0070707_100202276 3300005468 Bacteria 1936
64 Ga0070698_100003141 3300005471 Bacteria 18205
65 Ga0070698_100005255 3300005471 Bacteria 14163
66 Ga0070698_100054670 3300005471 Bacteria 4052
67 Ga0070698_100213710 3300005471 Bacteria 1863
68 Ga0070698_100286171 3300005471 Bacteria 1579
69 Ga0070698_100311550 3300005471 Bacteria 1505
70 Ga0070699_100000935 3300005518 Bacteria 27244
71 Ga0070699_100003959 3300005518 Bacteria 13091
72 Ga0070699_100169348 3300005518 Bacteria 1935
73 Ga0070679_100213460 3300005530 Bacteria 1893
74 Ga0070684_100003117 3300005535 Bacteria 12382
75 Ga0070684_100042987 3300005535 Bacteria 3902
76 Ga0070697_100026677 3300005536 Bacteria 4618
77 Ga0070697_100028158 3300005536 Bacteria 4498
78 Ga0070697_100248584 3300005536 Bacteria 1520
79 Ga0070686_100012410 3300005544 Bacteria 4852
80 Ga0070686_100026173 3300005544 Bacteria 3518
81 Ga0070695_100031805 3300005545 Bacteria 3295
82 Ga0070696_100014749 3300005546 Bacteria 5243
83 Ga0070696_100021766 3300005546 Bacteria 4349
84 Ga0070696_100065228 3300005546 Bacteria 2553
85 Ga0070693_100003252 3300005547 Bacteria 7541
86 Ga0070665_100016729 3300005548 Bacteria 7351
87 Ga0070665_100032848 3300005548 Bacteria 5221
88 Ga0070665_100105818 3300005548 Bacteria 2815
89 Ga0070704_100006328 3300005549 Bacteria 6975
90 Ga0070704_100010427 3300005549 Bacteria 5653
91 Ga0068855_100030721 3300005563 Bacteria 6422
92 Ga0068855_100114948 3300005563 Bacteria 3085
93 Ga0070664_100035094 3300005564 Bacteria 4209
94 Ga0070664_100156761 3300005564 Bacteria 2012
95 Ga0068857_100003486 3300005577 Bacteria 13122
96 Ga0068857_100077164 3300005577 Bacteria 2972
97 Ga0068857_100219050 3300005577 Bacteria 1738
98 Ga0068854_100012499 3300005578 Bacteria 5563
99 Ga0068854_100079494 3300005578 Bacteria 2417
100 Ga0068856_100020387 3300005614 Bacteria 6438
101 Ga0068852_100037571 3300005616 Bacteria 4061
102 Ga0068859_100172167 3300005617 Bacteria 2246
103 Ga0068858_100079346 3300005842 Bacteria 3050
104 Ga0068862_100006607 3300005844 Bacteria 9618
105 Ga0068862_100116579 3300005844 Bacteria 2350
106 Ga0081455_10001305 3300005937 Bacteria 30946
107 Ga0081455_10002371 3300005937 Bacteria 22500
108 Ga0081455_10008070 3300005937 Bacteria 10994
109 Ga0081538_10003737 3300005981 Bacteria 14254
110 Ga0081539_10000288 3300005985 Bacteria 113905
111 Ga0081539_10010690 3300005985 Bacteria 7400
112 Ga0070717_10074245 3300006028 Bacteria 2842
113 Ga0070717_10102792 3300006028 Bacteria 2428
114 Ga0070717_10183398 3300006028 Bacteria 1825
115 Ga0070716_100024985 3300006173 Bacteria 3182
116 Ga0070716_100029678 3300006173 Bacteria 2959
117 Ga0070716_100118598 3300006173 Bacteria 1652
118 Ga0070716_100144421 3300006173 Bacteria 1522
119 Ga0070712_100048992 3300006175 Bacteria 2931
120 Ga0075369_10007038 3300006186 Bacteria 4274
121 Ga0097621_100014750 3300006237 Bacteria 5858
122 Ga0068871_100002232 3300006358 Bacteria 13153
123 Ga0075428_100001507 3300006844 Bacteria 24923
124 Ga0075430_100069695 3300006846 Bacteria 2950
125 Ga0075431_100012063 3300006847 Bacteria 8720
126 Ga0075431_100015569 3300006847 Bacteria 7707
127 Ga0075431_100145166 3300006847 Bacteria 2445
128 Ga0075433_10016879 3300006852 Bacteria 6034
129 Ga0075433_10026648 3300006852 Bacteria 4897
130 Ga0075433_10058748 3300006852 Bacteria 3364
131 Ga0075433_10075909 3300006852 Bacteria 2959
132 Ga0075433_10094788 3300006852 Bacteria 2641
133 Ga0075434_100003058 3300006871 Bacteria 14892
134 Ga0075434_100003204 3300006871 Bacteria 14593
135 Ga0075434_100025717 3300006871 Bacteria 5761
136 Ga0075434_100043898 3300006871 Bacteria 4434
137 Ga0075434_100131500 3300006871 Bacteria 2522
138 Ga0075434_100142332 3300006871 Bacteria 2418
139 Ga0068865_100016403 3300006881 Bacteria 4739
140 Ga0097620_100172169 3300006931 Bacteria 2246
141 Ga0079104_1002622 3300006946 Bacteria 9400
142 Ga0075435_100003095 3300007076 Bacteria 11236
143 Ga0075435_100056142 3300007076 Bacteria 3183
144 Ga0075435_100130174 3300007076 Bacteria 2105
145 Ga0099794_10019870 3300007265 Bacteria 3034
146 Ga0099795_10033353 3300007788 Bacteria 1787
147 Ga0105240_10112128 3300009093 Bacteria 3298
148 Ga0111539_10001442 3300009094 Bacteria 31728
149 Ga0111539_10033206 3300009094 Bacteria 6267
150 Ga0111539_10115331 3300009094 Bacteria 3150
151 Ga0105245_10016162 3300009098 Bacteria 6503
152 Ga0105247_10011587 3300009101 Bacteria 5311
153 Ga0114129_10155161 3300009147 Bacteria 3131
154 Ga0105243_10030670 3300009148 Bacteria 4142
155 Ga0105243_10151277 3300009148 Bacteria 1991
156 Ga0105241_10004489 3300009174 Bacteria 10320
157 Ga0105241_10160996 3300009174 Bacteria 1845
158 Ga0105242_10058460 3300009176 Bacteria 3161
159 Ga0105248_10026140 3300009177 Bacteria 6494
160 Ga0105248_10221599 3300009177 Bacteria 2129
161 Ga0105237_10022216 3300009545 Bacteria 6510
162 Ga0105249_10032128 3300009553 Bacteria 4748
163 Ga0105249_10034017 3300009553 Bacteria 4616
164 Ga0105249_10074238 3300009553 Bacteria 3147
165 Ga0105249_10095266 3300009553 Bacteria 2791
166 Ga0105246_10003589 3300011119 Bacteria 9385
167 Ga0105246_10078897 3300011119 Bacteria 2340
168 Ga0157373_10016246 3300013100 Bacteria 5432
169 Ga0157369_10047634 3300013105 Bacteria 4653
170 Ga0157374_10012771 3300013296 Bacteria 7318
171 Ga0157374_10013502 3300013296 Bacteria 7128
172 Ga0157378_10231846 3300013297 Bacteria 1760
173 Ga0163162_10026299 3300013306 Bacteria 5751
174 Ga0163162_10027745 3300013306 Bacteria 5600
175 Ga0163162_10042933 3300013306 Bacteria 4526
176 Ga0157372_10052554 3300013307 Bacteria 4537
177 Ga0157375_10173709 3300013308 Bacteria 2303
178 Ga0157375_10470987 3300013308 Bacteria 1421
179 Ga0163163_10014779 3300014325 Bacteria 7185
180 Ga0157377_10008395 3300014745 Bacteria 5036
181 Ga0157376_10003405 3300014969 Bacteria 10944
182 Ga0157376_10008372 3300014969 Bacteria 7459
183 Ga0214544_1012884 3300021320 Bacteria 10561
184 Ga0214542_1012745 3300021321 Bacteria 10603
185 Ga0214545_1014166 3300021324 Bacteria 9419
186 Ga0214543_1013104 3300021327 Bacteria 10603
187 Ga0213876_10004431 3300021384 Bacteria 7875
188 Ga0213876_10055280 3300021384 Bacteria 2096
189 Ga0209435_100030 3300025206 Bacteria 170822
190 Ga0209147_100004 3300025229 Bacteria 1371850
191 Ga0209258_100893 3300025242 Bacteria 15485
192 Ga0209646_1000100 3300025246 Bacteria 170822
193 Ga0209026_1000091 3300025250 Bacteria 171170
194 Ga0209759_1000084 3300025256 Bacteria 169233
195 Ga0207697_10014287 3300025315 Bacteria 3295
196 Ga0207682_10022364 3300025893 Bacteria 2491
197 Ga0207692_10009508 3300025898 Bacteria 4065
198 Ga0207699_10002452 3300025906 Bacteria 8753
199 Ga0207699_10003664 3300025906 Bacteria 7336
200 Ga0207699_10108183 3300025906 Bacteria 1777
201 Ga0207645_10070191 3300025907 Bacteria 2241
202 Ga0207684_10089573 3300025910 Bacteria 2621
203 Ga0207684_10140990 3300025910 Bacteria 2072
204 Ga0207684_10191671 3300025910 Bacteria 1763
205 Ga0207707_10000920 3300025912 Bacteria 28595
206 Ga0207707_10091184 3300025912 Bacteria 2664
207 Ga0207707_10329135 3300025912 Bacteria 1318
208 Ga0207671_10025471 3300025914 Bacteria 4444
209 Ga0207693_10014905 3300025915 Bacteria 6243
210 Ga0207693_10019523 3300025915 Bacteria 5390
211 Ga0207663_10009670 3300025916 Bacteria 5104
212 Ga0207660_10029239 3300025917 Bacteria 3777
213 Ga0207657_10021994 3300025919 Bacteria 5987
214 Ga0207649_10057211 3300025920 Bacteria 2438
215 Ga0207649_10083425 3300025920 Bacteria 2074
216 Ga0207652_10051013 3300025921 Bacteria 3546
217 Ga0207652_10169834 3300025921 Bacteria 1957
218 Ga0207646_10001915 3300025922 Bacteria 25060
219 Ga0207646_10053007 3300025922 Bacteria 3629
220 Ga0207646_10154101 3300025922 Bacteria 2072
221 Ga0207646_10184059 3300025922 Bacteria 1887
222 Ga0207646_10273931 3300025922 Bacteria 1525
223 Ga0207694_10195765 3300025924 Bacteria 1643
224 Ga0207650_10002387 3300025925 Bacteria 13074
225 Ga0207659_10047818 3300025926 Bacteria 3027
226 Ga0207687_10026916 3300025927 Bacteria 3854
227 Ga0207700_10004451 3300025928 Bacteria 8262
228 Ga0207700_10004951 3300025928 Bacteria 7915
229 Ga0207700_10006886 3300025928 Bacteria 6910
230 Ga0207700_10358910 3300025928 Bacteria 1270
231 Ga0207664_10000956 3300025929 Bacteria 19483
232 Ga0207664_10001375 3300025929 Bacteria 15969
233 Ga0207664_10002280 3300025929 Bacteria 12643
234 Ga0207664_10047375 3300025929 Bacteria 3376
235 Ga0207664_10142634 3300025929 Bacteria 2028
236 Ga0207664_10212271 3300025929 Bacteria 1675
237 Ga0207644_10095973 3300025931 Bacteria 2218
238 Ga0207706_10029168 3300025933 Bacteria 4927
239 Ga0207706_10069675 3300025933 Bacteria 3093
240 Ga0207706_10182084 3300025933 Bacteria 1845
241 Ga0207709_10108361 3300025935 Bacteria 1852
242 Ga0207670_10037670 3300025936 Bacteria 3153
243 Ga0207704_10021936 3300025938 Bacteria 3412
244 Ga0207665_10026775 3300025939 Bacteria 3808
245 Ga0207665_10080747 3300025939 Bacteria 2237
246 Ga0207665_10175958 3300025939 Bacteria 1548
247 Ga0207691_10029431 3300025940 Bacteria 5138
248 Ga0207691_10085957 3300025940 Bacteria 2822
249 Ga0207711_10104148 3300025941 Bacteria 2514
250 Ga0207689_10033208 3300025942 Bacteria 4288
251 Ga0207679_10173140 3300025945 Bacteria 1779
252 Ga0207679_10192360 3300025945 Bacteria 1697
253 Ga0207667_10424045 3300025949 Bacteria 1353
254 Ga0207712_10113729 3300025961 Bacteria 2035
255 Ga0207712_10209916 3300025961 Bacteria 1550
256 Ga0207640_10036404 3300025981 Bacteria 3089
257 Ga0207640_10087137 3300025981 Bacteria 2151
258 Ga0207703_10016996 3300026035 Bacteria 5674
259 Ga0207678_10002126 3300026067 Bacteria 17944
260 Ga0207678_10013685 3300026067 Bacteria 7125
261 Ga0207702_10014978 3300026078 Bacteria 6433
262 Ga0207641_10044204 3300026088 Bacteria 3745
263 Ga0207676_10025085 3300026095 Bacteria 4421
264 Ga0207676_10172483 3300026095 Bacteria 1886
265 Ga0207674_10019663 3300026116 Bacteria 7313
266 Ga0207675_100049829 3300026118 Bacteria 3907
267 Ga0207675_100436164 3300026118 Bacteria 1296
268 Ga0207683_10000301 3300026121 Bacteria 44592
269 Ga0209982_1005646 3300027552 Bacteria 1809
270 Ga0209971_1007637 3300027682 Bacteria 2566
271 Ga0209966_1003320 3300027695 Bacteria 2704
272 Ga0209998_10015181 3300027717 Bacteria 1610
273 Ga0209974_10004338 3300027876 Bacteria 5043
274 Ga0209974_10004884 3300027876 Bacteria 4744
275 Ga0207428_10174079 3300027907 Bacteria 1629
276 Ga0268265_10101407 3300028380 Bacteria 2326
277 Ga0268265_10254131 3300028380 Bacteria 1559
278 Ga0268264_10045564 3300028381 Bacteria 3641
279 Ga0268264_10123710 3300028381 Bacteria 2283
280 Ga0268264_10299908 3300028381 Bacteria 1512
281 Ga0265340_10007977 3300031247 Bacteria 5737
282 Ga0265314_10141108 3300031711 Bacteria 1489
283 Ga0307405_10070748 3300031731 Bacteria 2242
284 Ga0307413_10146642 3300031824 Bacteria 1639
285 Ga0307412_10004107 3300031911 Bacteria 8117
286 Ga0307414_10011055 3300032004 Bacteria 5278
287 Ga0373929_0010291 3300035085 Bacteria 1747
288 Ga0373929_0012709 3300035085 Bacteria 1604
289 Ga0373934_0029085 3300035086 Bacteria 2156
290 Ga0373960_0003724 3300035121 Bacteria 3465
291 Ga0373931_0032587 3300035691 Bacteria 2697
292 Ga0395899_0081544 3300037312 Bacteria 2353
293 Ga0395900_0028793 3300037418 Bacteria 5694
294 Ga0395900_0140757 3300037418 Bacteria 2470
295 Ga0395898_0023116 3300037466 Bacteria 6285
296 Ga0395898_0071543 3300037466 Bacteria 3351
297 Ga0395898_0351660 3300037466 Bacteria 1405
298 Ga0395905_0042063 3300037471 Bacteria 4287
299 Ga0395905_0379811 3300037471 Bacteria 1307
300 Ga0436364_0448042 3300037853 Bacteria 59308
301 Ga0395901_0022720 3300038443 Bacteria 6431
302 Ga0395901_0317159 3300038443 Bacteria 1613
303 Ga0436365_0031184 3300039437 Bacteria 25821
304 Ga0436365_0345555 3300039437 Bacteria 1608
305 Ga0436365_1544050 3300039437 Bacteria 19397
306 Ga0436363_1445715 3300039450 Bacteria 4182
307 Ga0436362_0607211 3300039453 Bacteria 2382
308 Ga0439441_014749 3300042001 Bacteria 1374
309 Ga0439449_0028677 3300042007 Bacteria 2075
310 Ga0451577_0078875 3300042876 Bacteria 2935
311 Ga0451577_0266255 3300042876 Bacteria 1552
312 Ga0466972_0046488 3300044658 Bacteria 2101
313 Ga0453683_0035241 3300044673 Bacteria 3154
314 Ga0453684_0107906 3300044712 Bacteria 3389
315 Ga0466960_0003143 3300044901 Bacteria 6331
316 Ga0466960_0072689 3300044901 Bacteria 1715
317 Ga0451576_0034088 3300045051 Bacteria 5409
318 Ga0451576_0122376 3300045051 Bacteria 2709
319 Ga0466967_0048259 3300045976 Bacteria 3717
320 Ga0495580_0002735 3300046472 Bacteria 15211
321 Ga0495580_0110374 3300046472 Bacteria 1910
322 Ga0495652_0091377 3300046529 Bacteria 2489
323 Ga0495645_0026104 3300046543 Bacteria 4240
324 Ga0495633_0137585 3300046558 Bacteria 1130
325 Ga0495674_0004008 3300047319 Bacteria 14266
326 Ga0496100_0001090 3300048903 Bacteria 13118
327 Ga0496101_0005640 3300048904 Bacteria 7985
328 Ga0496103_0022790 3300048906 Bacteria 3772
329 Ga0496105_0002636 3300048908 Bacteria 13055
330 Ga0496106_0012376 3300048909 Bacteria 6298
331 Ga0496107_0010134 3300048910 Bacteria 6537
332 Ga0496108_0003653 3300048911 Bacteria 12340
333 Ga0496109_0014225 3300048912 Bacteria 6920
334 Ga0496109_0133143 3300048912 Bacteria 2322
335 Ga0496110_0021563 3300048913 Bacteria 5457
336 Ga0496112_0032492 3300048915 Bacteria 5068
337 Ga0496113_0020821 3300048916 Bacteria 4618
338 Ga0496113_0092574 3300048916 Bacteria 2332
339 Ga0496115_0010039 3300048918 Bacteria 7057
340 Ga0501031_0007332 3300049568 Bacteria 7192
341 Ga0501031_0034582 3300049568 Bacteria 3298
342 Ga0501031_0123827 3300049568 Bacteria 1689
343 Ga0501032_0008877 3300049569 Bacteria 7309
344 Ga0501033_0009068 3300049570 Bacteria 7675
345 Ga0501033_0072723 3300049570 Bacteria 2524
346 Ga0501036_0013788 3300049572 Bacteria 6723
347 Ga0501036_0016260 3300049572 Bacteria 6214
348 Ga0501036_0034099 3300049572 Bacteria 4305
349 Ga0501036_0197463 3300049572 Bacteria 1692
350 Ga0501037_0028149 3300049573 Bacteria 4151
351 Ga0501037_0055281 3300049573 Bacteria 2902
352 Ga0501038_0003680 3300049574 Bacteria 14280
353 Ga0501038_0009182 3300049574 Bacteria 9075
354 Ga0501038_0018851 3300049574 Bacteria 6230
355 Ga0501038_0036520 3300049574 Bacteria 4311
356 Ga0501039_0001499 3300049575 Bacteria 17176
357 Ga0501039_0047800 3300049575 Bacteria 3308
358 Ga0501039_0075764 3300049575 Bacteria 2615
359 Ga0501040_0000010 3300049576 Bacteria 80841
360 Ga0501040_0001118 3300049576 Bacteria 16987
361 Ga0501040_0015012 3300049576 Bacteria 5117
362 Ga0501040_0024408 3300049576 Bacteria 4057
363 Ga0501040_0041927 3300049576 Bacteria 3117
364 Ga0501040_0189698 3300049576 Bacteria 1458
365 Ga0501040_0250678 3300049576 Bacteria 1263
366 Ga0501041_0000496 3300049577 Bacteria 20203
367 Ga0501041_0005979 3300049577 Bacteria 7119
368 Ga0501041_0025958 3300049577 Bacteria 3522
369 Ga0501041_0117696 3300049577 Bacteria 1650
370 Ga0501042_0002645 3300049578 Bacteria 11016
371 Ga0501042_0004171 3300049578 Bacteria 9184
372 Ga0501042_0016461 3300049578 Bacteria 5074
373 Ga0501042_0050166 3300049578 Bacteria 2976
374 Ga0501043_0005902 3300049579 Bacteria 9851
375 Ga0501043_0012970 3300049579 Bacteria 6513
376 Ga0501043_0084418 3300049579 Bacteria 2496
377 Ga0501046_0033663 3300049580 Bacteria 4138
378 Ga0501046_0079699 3300049580 Bacteria 2531
379 Ga0501046_0083602 3300049580 Bacteria 2463
380 Ga0501047_0019722 3300049581 Bacteria 6471
381 Ga0501048_0001209 3300049582 Bacteria 19566
382 Ga0501048_0010510 3300049582 Bacteria 6908
383 Ga0501048_0077820 3300049582 Bacteria 2341
384 Ga0501068_0002917 3300049584 Bacteria 9101
385 Ga0501070_0026677 3300049586 Bacteria 4846
386 Ga0501070_0102824 3300049586 Bacteria 2363
387 Ga0501071_0001035 3300049587 Bacteria 15367
388 Ga0501071_0003736 3300049587 Bacteria 9562
389 Ga0501071_0030567 3300049587 Bacteria 3811
390 Ga0501071_0049182 3300049587 Bacteria 3034
391 Ga0501071_0058368 3300049587 Bacteria 2790
392 Ga0501072_0002049 3300049588 Bacteria 14985
393 Ga0501072_0026412 3300049588 Bacteria 4528
394 Ga0501072_0041002 3300049588 Bacteria 3635
395 Ga0501072_0180835 3300049588 Bacteria 1682
396 Ga0501073_0042872 3300049589 Bacteria 3192
397 Ga0501074_0000201 3300049590 Bacteria 32529
398 Ga0501074_0005017 3300049590 Bacteria 9497
399 Ga0501074_0010807 3300049590 Bacteria 6629
400 Ga0501074_0018630 3300049590 Bacteria 5044
401 Ga0501075_0000090 3300049591 Bacteria 41736
402 Ga0501075_0010683 3300049591 Bacteria 6461
403 Ga0501075_0032875 3300049591 Bacteria 3857
404 Ga0501075_0110046 3300049591 Bacteria 2094
405 Ga0501075_0153022 3300049591 Bacteria 1758
406 Ga0501076_0015816 3300049592 Bacteria 5708
407 Ga0501076_0027993 3300049592 Bacteria 4372
408 Ga0501076_0037603 3300049592 Bacteria 3797
409 Ga0501076_0046397 3300049592 Bacteria 3433
410 Ga0501076_0107346 3300049592 Bacteria 2254
411 Ga0501076_0288606 3300049592 Bacteria 1344
412 Ga0501077_0000321 3300049593 Bacteria 28664
413 Ga0501077_0001385 3300049593 Bacteria 14609
414 Ga0501077_0037147 3300049593 Bacteria 3103
415 Ga0501079_0000063 3300049741 Bacteria 48461
416 Ga0501079_0000705 3300049741 Bacteria 22580
417 Ga0501079_0004544 3300049741 Bacteria 10294
418 Ga0501079_0034639 3300049741 Bacteria 3885
419 Ga0501080_0003347 3300049742 Bacteria 14158
420 Ga0501080_0003842 3300049742 Bacteria 13268
421 Ga0501080_0046852 3300049742 Bacteria 4024
422 Ga0501080_0061128 3300049742 Bacteria 3507
423 Ga0501081_0000085 3300049743 Bacteria 37187
424 Ga0501081_0000206 3300049743 Bacteria 28944
425 Ga0501081_0011320 3300049743 Bacteria 5836
426 Ga0501083_0016441 3300049744 Bacteria 5179
427 Ga0501083_0017449 3300049744 Bacteria 5003
428 Ga0501035_0011789 3300049822 Bacteria 8093
429 Ga0501035_0138401 3300049822 Bacteria 2118
430 Ga0501044_0014918 3300049823 Bacteria 8378
431 Ga0501044_0160195 3300049823 Bacteria 2228
432 Ga0501045_0000411 3300049824 Bacteria 25957
433 Ga0501045_0001246 3300049824 Bacteria 16923
434 Ga0501045_0016235 3300049824 Bacteria 5285
435 Ga0501045_0113116 3300049824 Bacteria 2013
436 nmdc:mga05p37_219362_c1 3300050507 Bacteria 2296
437 nmdc:mga05p37_57205_c1 3300050507 Bacteria 4803
438 nmdc:mga09592_111883_c1 3300050508 Bacteria 2343
439 nmdc:mga0qj67_135727_c1 3300050509 Bacteria 1994
440 nmdc:mga06r32_35331_c1 3300050510 Bacteria 4716
441 nmdc:mga06r32_70035_c1 3300050510 Bacteria 3391
442 nmdc:mga08y16_115182_c1 3300050511 Bacteria 2798
443 nmdc:mga08y16_33431_c1 3300050511 Bacteria 5401
444 nmdc:mga0n895_117703_c1 3300050512 Bacteria 2677
445 nmdc:mga0n895_165874_c1 3300050512 Bacteria 2240
446 nmdc:mga0n895_18469_c1 3300050512 Bacteria 6453
447 nmdc:mga0n895_282625_c1 3300050512 Bacteria 1683
448 nmdc:mga0n895_3979_c1 3300050512 Bacteria 12016
449 nmdc:mga0n895_966_c1 3300050512 Bacteria 20843
450 nmdc:mga0rr50_176348_c1 3300050513 Bacteria 1745
451 nmdc:mga0rr50_46279_c1 3300050513 Bacteria 3203
452 nmdc:mga0rr50_6292_c1 3300050513 Bacteria 7208
453 nmdc:mga08x19_33482_c1 3300050514 Bacteria 3243
454 nmdc:mga0a205_10356_c1 3300050515 Bacteria 8570
455 nmdc:mga0a205_108914_c1 3300050515 Bacteria 2668
456 nmdc:mga0a205_154808_c1 3300050515 Bacteria 2191
457 nmdc:mga0a205_216701_c1 3300050515 Bacteria 1801
458 nmdc:mga0a205_47548_c1 3300050515 Bacteria 3618
459 nmdc:mga0a205_54994_c1 3300050515 Bacteria 3844
460 nmdc:mga0a205_85665_c1 3300050515 Bacteria 3043
461 nmdc:mga0sz30_618_c1 3300050516 Bacteria 13171
462 Ga0495601_0175771 3300053077 Bacteria 1400
463 Ga0500573_0095416 3300053140 Bacteria 1677
464 Ga0500622_0060047 3300053156 Bacteria 1941
465 Ga0501084_0002692 3300054114 Bacteria 14308
466 Ga0501084_0003324 3300054114 Bacteria 13010
467 Ga0501084_0006990 3300054114 Bacteria 9298
468 Ga0501084_0017417 3300054114 Bacteria 5972
469 Ga0501082_0001750 3300060353 Bacteria 19124
470 Ga0501082_0002602 3300060353 Bacteria 15775
471 Ga0501082_0015564 3300060353 Bacteria 6549
472 Ga0501082_0059694 3300060353 Bacteria 3286
473 Ga0501082_0192310 3300060353 Bacteria 1775
474 Ga0530510_0004298 3300061734 Bacteria 9856
475 Ga0530510_0004782 3300061734 Bacteria 9377
476 Ga0530510_0006183 3300061734 Bacteria 8322
477 Ga0530510_0020612 3300061734 Bacteria 4687
478 Ga0530510_0071580 3300061734 Bacteria 2516
479 Ga0530510_0071696 3300061734 Bacteria 2514
480 Ga0530510_0076849 3300061734 Bacteria 2426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0351660 Ga0395898_0351660_431_1372 296
2 3300049823 Ga0501044_0160195 Ga0501044_0160195_54_1037 299
3 3300021384 Ga0213876_10055280 Ga0213876_100552802 312
4 3300049592 Ga0501076_0037603 Ga0501076_0037603_1237_2430 314
5 3300049741 Ga0501079_0004544 Ga0501079_0004544_2061_3254 314
6 3300061734 Ga0530510_0004782 Ga0530510_0004782_4549_5742 314
7 3300061734 Ga0530510_0020612 Ga0530510_0020612_265_1425 314
8 3300049575 Ga0501039_0075764 Ga0501039_0075764_436_1548 318
9 3300049576 Ga0501040_0041927 Ga0501040_0041927_1967_3079 318
10 3300049587 Ga0501071_0030567 Ga0501071_0030567_932_2044 318
11 3300049588 Ga0501072_0026412 Ga0501072_0026412_772_1884 318
12 3300049591 Ga0501075_0032875 Ga0501075_0032875_158_1270 318
13 3300049592 Ga0501076_0107346 Ga0501076_0107346_241_1353 318
14 3300049824 Ga0501045_0113116 Ga0501045_0113116_149_1261 318
15 3300061734 Ga0530510_0071696 Ga0530510_0071696_98_1210 318
16 3300039437 Ga0436365_1544050 Ga0436365_1544050_17772_18818 320
17 3300046558 Ga0495633_0137585 Ga0495633_0137585_21_1067 321
18 3300006847 Ga0075431_100012063 Ga0075431_10001206311 323
19 3300039450 Ga0436363_1445715 Ga0436363_1445715_2500_3528 323
20 3300050510 nmdc:mga06r32_70035_c1 nmdc:mga06r32_70035_c1_93_1136 323
21 iso_pu_bacteria 2824671348 2824671573 329
22 iso_pu_bacteria 2824687955 2824688181 329
23 iso_pu_bacteria 2824696289 2824696464 329
24 3300005434 Ga0070709_10003006 Ga0070709_100030067 333
25 3300005435 Ga0070714_100024528 Ga0070714_1000245282 333
26 3300005437 Ga0070710_10006866 Ga0070710_100068665 333
27 3300005439 Ga0070711_100028250 Ga0070711_1000282504 333
28 3300005445 Ga0070708_100000483 Ga0070708_10000048321 333
29 3300005471 Ga0070698_100003141 Ga0070698_1000031414 333
30 3300005471 Ga0070698_100286171 Ga0070698_1002861711 333
31 3300005518 Ga0070699_100000935 Ga0070699_10000093518 333
32 3300005536 Ga0070697_100026677 Ga0070697_1000266772 333
33 3300006028 Ga0070717_10074245 Ga0070717_100742452 333
34 3300006173 Ga0070716_100024985 Ga0070716_1000249853 333
35 3300021320 Ga0214544_1012884 Ga0214544_10128848 333
36 3300021321 Ga0214542_1012745 Ga0214542_10127458 333
37 3300021324 Ga0214545_1014166 Ga0214545_10141665 333
38 3300021327 Ga0214543_1013104 Ga0214543_10131048 333
39 3300025906 Ga0207699_10002452 Ga0207699_100024523 333
40 3300025910 Ga0207684_10191671 Ga0207684_101916712 333
41 3300025915 Ga0207693_10014905 Ga0207693_100149057 333
42 3300025916 Ga0207663_10009670 Ga0207663_100096705 333
43 3300025922 Ga0207646_10001915 Ga0207646_1000191513 333
44 3300025928 Ga0207700_10004951 Ga0207700_100049513 333
45 3300025929 Ga0207664_10002280 Ga0207664_1000228012 333
46 3300025939 Ga0207665_10080747 Ga0207665_100807472 333
47 3300005445 Ga0070708_100235473 Ga0070708_1002354732 334
48 3300026118 Ga0207675_100436164 Ga0207675_1004361641 334
49 3300049581 Ga0501047_0019722 Ga0501047_0019722_2932_3984 334
50 3300049742 Ga0501080_0046852 Ga0501080_0046852_1744_2796 334
51 iso_pu_bacteria 2935703347 2935711260 334
52 iso_pu_bacteria 2935916978 2935925709 334
53 3300005295 Ga0065707_10091530 Ga0065707_100915304 335
54 3300005353 Ga0070669_100005285 Ga0070669_1000052854 335
55 3300005438 Ga0070701_10018993 Ga0070701_100189932 335
56 3300005457 Ga0070662_100170608 Ga0070662_1001706081 335
57 3300005467 Ga0070706_100276707 Ga0070706_1002767072 335
58 3300005536 Ga0070697_100248584 Ga0070697_1002485842 335
59 3300005549 Ga0070704_100010427 Ga0070704_1000104272 335
60 3300005617 Ga0068859_100172167 Ga0068859_1001721672 335
61 3300005844 Ga0068862_100006607 Ga0068862_1000066078 335
62 3300006931 Ga0097620_100172169 Ga0097620_1001721692 335
63 3300025910 Ga0207684_10140990 Ga0207684_101409902 335
64 3300025922 Ga0207646_10273931 Ga0207646_102739311 335
65 3300025933 Ga0207706_10029168 Ga0207706_100291683 335
66 3300025940 Ga0207691_10029431 Ga0207691_100294315 335
67 3300025941 Ga0207711_10104148 Ga0207711_101041482 335
68 3300025961 Ga0207712_10209916 Ga0207712_102099162 335
69 3300026095 Ga0207676_10172483 Ga0207676_101724832 335
70 3300026118 Ga0207675_100049829 Ga0207675_1000498293 335
71 3300027717 Ga0209998_10015181 Ga0209998_100151812 335
72 3300028381 Ga0268264_10045564 Ga0268264_100455642 335
73 3300028381 Ga0268264_10299908 Ga0268264_102999081 335
74 3300044673 Ga0453683_0035241 Ga0453683_0035241_1290_2378 335
75 iso_pu_bacteria 2874604998 2874609976 335
76 iso_pu_bacteria 2935777560 2935781777 335
77 iso_pu_bacteria 2935837841 2935846954 335
78 iso_pu_bacteria 2935908558 2935916381 335
79 iso_pu_bacteria 2935926038 2935933788 335
80 iso_pu_bacteria 2935934488 2935942404 335
81 iso_pu_bacteria 2935942939 2935950849 335
82 iso_pu_bacteria 2935951376 2935959305 335
83 iso_pu_bacteria 2935959822 2935967284 335
84 iso_pu_bacteria 2935967501 2935975558 335
85 iso_pu_bacteria 3005710791 3005717007 335
86 iso_pu_bacteria 8019576017 8019585499 335
87 iso_pu_bacteria 8019597564 8019597993 335
88 iso_pu_bacteria 8019608314 8019610388 335
89 iso_pu_bacteria 8019687851 8019692704 335
90 3300005329 Ga0070683_100302758 Ga0070683_1003027582 336
91 3300005334 Ga0068869_100015958 Ga0068869_1000159582 336
92 3300005337 Ga0070682_100007427 Ga0070682_1000074273 336
93 3300005340 Ga0070689_100079293 Ga0070689_1000792932 336
94 3300005341 Ga0070691_10000599 Ga0070691_100005992 336
95 3300005355 Ga0070671_100001934 Ga0070671_1000019347 336
96 3300005364 Ga0070673_100009901 Ga0070673_1000099012 336
97 3300005434 Ga0070709_10016401 Ga0070709_100164013 336
98 3300005434 Ga0070709_10023291 Ga0070709_100232912 336
99 3300005435 Ga0070714_100060953 Ga0070714_1000609532 336
100 3300005436 Ga0070713_100289661 Ga0070713_1002896612 336
101 3300005437 Ga0070710_10019725 Ga0070710_100197253 336
102 3300005440 Ga0070705_100007985 Ga0070705_1000079854 336
103 3300005456 Ga0070678_100000819 Ga0070678_1000008197 336
104 3300005458 Ga0070681_10011623 Ga0070681_100116235 336
105 3300005468 Ga0070707_100031310 Ga0070707_1000313105 336
106 3300005468 Ga0070707_100087944 Ga0070707_1000879442 336
107 3300005471 Ga0070698_100054670 Ga0070698_1000546704 336
108 3300005518 Ga0070699_100003959 Ga0070699_1000039592 336
109 3300005535 Ga0070684_100003117 Ga0070684_1000031174 336
110 3300005536 Ga0070697_100028158 Ga0070697_1000281585 336
111 3300005544 Ga0070686_100012410 Ga0070686_1000124102 336
112 3300005545 Ga0070695_100031805 Ga0070695_1000318052 336
113 3300005546 Ga0070696_100065228 Ga0070696_1000652282 336
114 3300005547 Ga0070693_100003252 Ga0070693_1000032524 336
115 3300005548 Ga0070665_100032848 Ga0070665_1000328482 336
116 3300005549 Ga0070704_100006328 Ga0070704_1000063285 336
117 3300005563 Ga0068855_100030721 Ga0068855_1000307214 336
118 3300005564 Ga0070664_100035094 Ga0070664_1000350942 336
119 3300005577 Ga0068857_100003486 Ga0068857_10000348610 336
120 3300005578 Ga0068854_100012499 Ga0068854_1000124992 336
121 3300005616 Ga0068852_100037571 Ga0068852_1000375712 336
122 3300005842 Ga0068858_100079346 Ga0068858_1000793462 336
123 3300006028 Ga0070717_10102792 Ga0070717_101027922 336
124 3300006028 Ga0070717_10183398 Ga0070717_101833982 336
125 3300006173 Ga0070716_100029678 Ga0070716_1000296783 336
126 3300006173 Ga0070716_100118598 Ga0070716_1001185982 336
127 3300006175 Ga0070712_100048992 Ga0070712_1000489922 336
128 3300006237 Ga0097621_100014750 Ga0097621_1000147505 336
129 3300006358 Ga0068871_100002232 Ga0068871_1000022322 336
130 3300009093 Ga0105240_10112128 Ga0105240_101121282 336
131 3300009098 Ga0105245_10016162 Ga0105245_100161623 336
132 3300009101 Ga0105247_10011587 Ga0105247_100115872 336
133 3300009148 Ga0105243_10151277 Ga0105243_101512772 336
134 3300009177 Ga0105248_10026140 Ga0105248_100261403 336
135 3300009545 Ga0105237_10022216 Ga0105237_100222164 336
136 3300009553 Ga0105249_10032128 Ga0105249_100321283 336
137 3300011119 Ga0105246_10003589 Ga0105246_100035897 336
138 3300013100 Ga0157373_10016246 Ga0157373_100162463 336
139 3300013105 Ga0157369_10047634 Ga0157369_100476341 336
140 3300013296 Ga0157374_10012771 Ga0157374_100127714 336
141 3300013306 Ga0163162_10042933 Ga0163162_100429333 336
142 3300013307 Ga0157372_10052554 Ga0157372_100525543 336
143 3300013308 Ga0157375_10470987 Ga0157375_104709872 336
144 3300014325 Ga0163163_10014779 Ga0163163_100147794 336
145 3300014745 Ga0157377_10008395 Ga0157377_100083951 336
146 3300014969 Ga0157376_10008372 Ga0157376_100083725 336
147 3300025898 Ga0207692_10009508 Ga0207692_100095083 336
148 3300025906 Ga0207699_10003664 Ga0207699_100036646 336
149 3300025906 Ga0207699_10108183 Ga0207699_101081832 336
150 3300025910 Ga0207684_10089573 Ga0207684_100895732 336
151 3300025912 Ga0207707_10329135 Ga0207707_103291352 336
152 3300025914 Ga0207671_10025471 Ga0207671_100254713 336
153 3300025920 Ga0207649_10057211 Ga0207649_100572112 336
154 3300025922 Ga0207646_10053007 Ga0207646_100530072 336
155 3300025922 Ga0207646_10154101 Ga0207646_101541012 336
156 3300025924 Ga0207694_10195765 Ga0207694_101957652 336
157 3300025927 Ga0207687_10026916 Ga0207687_100269161 336
158 3300025928 Ga0207700_10004451 Ga0207700_100044513 336
159 3300025928 Ga0207700_10358910 Ga0207700_103589102 336
160 3300025929 Ga0207664_10001375 Ga0207664_100013756 336
161 3300025929 Ga0207664_10142634 Ga0207664_101426342 336
162 3300025929 Ga0207664_10212271 Ga0207664_102122712 336
163 3300025931 Ga0207644_10095973 Ga0207644_100959732 336
164 3300025935 Ga0207709_10108361 Ga0207709_101083612 336
165 3300025936 Ga0207670_10037670 Ga0207670_100376701 336
166 3300025939 Ga0207665_10026775 Ga0207665_100267753 336
167 3300025939 Ga0207665_10175958 Ga0207665_101759582 336
168 3300025981 Ga0207640_10036404 Ga0207640_100364042 336
169 3300026035 Ga0207703_10016996 Ga0207703_100169963 336
170 3300026067 Ga0207678_10002126 Ga0207678_1000212614 336
171 3300026078 Ga0207702_10014978 Ga0207702_100149783 336
172 3300026088 Ga0207641_10044204 Ga0207641_100442042 336
173 3300026095 Ga0207676_10025085 Ga0207676_100250853 336
174 3300026121 Ga0207683_10000301 Ga0207683_1000030128 336
175 3300028381 Ga0268264_10123710 Ga0268264_101237102 336
176 3300035085 Ga0373929_0010291 Ga0373929_0010291_240_1322 336
177 3300035121 Ga0373960_0003724 Ga0373960_0003724_2271_3338 336
178 3300044901 Ga0466960_0003143 Ga0466960_0003143_2939_4006 336
179 3300048903 Ga0496100_0001090 Ga0496100_0001090_8940_10022 336
180 3300048904 Ga0496101_0005640 Ga0496101_0005640_3589_4671 336
181 3300048906 Ga0496103_0022790 Ga0496103_0022790_1825_2907 336
182 3300048908 Ga0496105_0002636 Ga0496105_0002636_1960_3042 336
183 3300048909 Ga0496106_0012376 Ga0496106_0012376_2144_3226 336
184 3300048910 Ga0496107_0010134 Ga0496107_0010134_3631_4713 336
185 3300048911 Ga0496108_0003653 Ga0496108_0003653_8734_9816 336
186 3300048912 Ga0496109_0014225 Ga0496109_0014225_2525_3607 336
187 3300048913 Ga0496110_0021563 Ga0496110_0021563_3420_4502 336
188 3300048916 Ga0496113_0020821 Ga0496113_0020821_1681_2763 336
189 3300048918 Ga0496115_0010039 Ga0496115_0010039_2925_4007 336
190 3300050514 nmdc:mga08x19_33482_c1 nmdc:mga08x19_33482_c1_1102_2184 336
191 3300005356 Ga0070674_100129389 Ga0070674_1001293892 337
192 3300005435 Ga0070714_100000685 Ga0070714_1000006858 337
193 3300005436 Ga0070713_100001510 Ga0070713_1000015109 337
194 3300031711 Ga0265314_10141108 Ga0265314_101411082 337
195 3300032004 Ga0307414_10011055 Ga0307414_100110553 337
196 3300035086 Ga0373934_0029085 Ga0373934_0029085_372_1484 337
197 3300042007 Ga0439449_0028677 Ga0439449_0028677_52_1116 337
198 3300044658 Ga0466972_0046488 Ga0466972_0046488_201_1325 337
199 3300044901 Ga0466960_0072689 Ga0466960_0072689_572_1693 337
200 3300045051 Ga0451576_0034088 Ga0451576_0034088_1197_2231 337
201 3300045976 Ga0466967_0048259 Ga0466967_0048259_848_1915 337
202 iso_pu_bacteria 2508501050 2508728412 337
203 iso_pu_bacteria 2508501114 2509078445 337
204 iso_pu_bacteria 2513237144 2513909436 337
205 iso_pu_bacteria 2773857925 2774873406 337
206 iso_pu_bacteria 2775506901 2776259661 337
207 iso_pu_bacteria 2835312727 2835317889 337
208 iso_pu_bacteria 2882456835 2882458232 337
209 iso_pu_bacteria 2884298095 2884299855 337
210 iso_pu_bacteria 2894232714 2894239700 337
211 3300005985 Ga0081539_10010690 Ga0081539_100106905 338
212 3300031247 Ga0265340_10007977 Ga0265340_100079772 338
213 3300037466 Ga0395898_0071543 Ga0395898_0071543_1441_2511 338
214 3300037471 Ga0395905_0042063 Ga0395905_0042063_3030_4100 338
215 3300038443 Ga0395901_0317159 Ga0395901_0317159_347_1417 338
216 iso_pu_bacteria 2861691609 2861696088 338
217 3300005437 Ga0070710_10221697 Ga0070710_102216971 339
218 3300005467 Ga0070706_100273935 Ga0070706_1002739351 339
219 3300005468 Ga0070707_100094001 Ga0070707_1000940013 339
220 3300005471 Ga0070698_100005255 Ga0070698_10000525510 339
221 3300005518 Ga0070699_100169348 Ga0070699_1001693482 339
222 3300005985 Ga0081539_10000288 Ga0081539_1000028860 339
223 3300007788 Ga0099795_10033353 Ga0099795_100333532 339
224 3300025915 Ga0207693_10019523 Ga0207693_100195232 339
225 3300025929 Ga0207664_10047375 Ga0207664_100473752 339
226 3300037418 Ga0395900_0028793 Ga0395900_0028793_1933_3012 339
227 3300037471 Ga0395905_0379811 Ga0395905_0379811_126_1205 339
228 3300046529 Ga0495652_0091377 Ga0495652_0091377_1219_2295 339
229 3300046543 Ga0495645_0026104 Ga0495645_0026104_591_1667 339
230 3300047319 Ga0495674_0004008 Ga0495674_0004008_4714_5790 339
231 3300053077 Ga0495601_0175771 Ga0495601_0175771_11_1087 339
232 3300005340 Ga0070689_100231494 Ga0070689_1002314942 340
233 3300005440 Ga0070705_100190249 Ga0070705_1001902491 340
234 3300005471 Ga0070698_100311550 Ga0070698_1003115502 340
235 3300005548 Ga0070665_100016729 Ga0070665_1000167294 340
236 3300006844 Ga0075428_100001507 Ga0075428_10000150717 340
237 3300006852 Ga0075433_10026648 Ga0075433_100266483 340
238 3300006871 Ga0075434_100003058 Ga0075434_10000305810 340
239 3300006871 Ga0075434_100043898 Ga0075434_1000438982 340
240 3300009094 Ga0111539_10001442 Ga0111539_100014428 340
241 3300009148 Ga0105243_10030670 Ga0105243_100306702 340
242 3300009174 Ga0105241_10004489 Ga0105241_100044897 340
243 3300009174 Ga0105241_10160996 Ga0105241_101609962 340
244 3300009177 Ga0105248_10221599 Ga0105248_102215992 340
245 3300009553 Ga0105249_10034017 Ga0105249_100340174 340
246 3300009553 Ga0105249_10095266 Ga0105249_100952664 340
247 3300013297 Ga0157378_10231846 Ga0157378_102318462 340
248 3300013306 Ga0163162_10027745 Ga0163162_100277452 340
249 3300013308 Ga0157375_10173709 Ga0157375_101737092 340
250 3300028380 Ga0268265_10254131 Ga0268265_102541312 340
251 3300042876 Ga0451577_0266255 Ga0451577_0266255_288_1376 340
252 3300045051 Ga0451576_0122376 Ga0451576_0122376_66_1154 340
253 3300046472 Ga0495580_0002735 Ga0495580_0002735_10504_11592 340
254 3300050512 nmdc:mga0n895_282625_c1 nmdc:mga0n895_282625_c1_75_1163 340
255 3300050512 nmdc:mga0n895_3979_c1 nmdc:mga0n895_3979_c1_3265_4365 340
256 3300050513 nmdc:mga0rr50_6292_c1 nmdc:mga0rr50_6292_c1_4497_5597 340
257 3300050515 nmdc:mga0a205_10356_c1 nmdc:mga0a205_10356_c1_365_1453 340
258 3300050515 nmdc:mga0a205_47548_c1 nmdc:mga0a205_47548_c1_446_1546 340
259 3300050516 nmdc:mga0sz30_618_c1 nmdc:mga0sz30_618_c1_5968_7065 340
260 3300050515 nmdc:mga0a205_54994_c1 nmdc:mga0a205_54994_c1_2126_3232 341
261 3300005844 Ga0068862_100116579 Ga0068862_1001165792 343
262 3300005937 Ga0081455_10001305 Ga0081455_1000130515 343
263 3300021384 Ga0213876_10004431 Ga0213876_100044315 343
264 3300028380 Ga0268265_10101407 Ga0268265_101014072 343
265 3300053156 Ga0500622_0060047 Ga0500622_0060047_195_1283 343
266 3300005435 Ga0070714_100002782 Ga0070714_1000027829 344
267 3300006186 Ga0075369_10007038 Ga0075369_100070382 344
268 3300025929 Ga0207664_10000956 Ga0207664_100009566 344
269 3300031824 Ga0307413_10146642 Ga0307413_101466422 344
270 3300049586 Ga0501070_0102824 Ga0501070_0102824_403_1548 344
271 3300005937 Ga0081455_10002371 Ga0081455_1000237114 345
272 3300006846 Ga0075430_100069695 Ga0075430_1000696952 345
273 3300007265 Ga0099794_10019870 Ga0099794_100198702 345
274 3300039437 Ga0436365_0345555 Ga0436365_0345555_361_1476 345
275 3300049575 Ga0501039_0047800 Ga0501039_0047800_534_1727 345
276 iso_pu_bacteria 2857591370 2857592129 345
277 3300005435 Ga0070714_100163950 Ga0070714_1001639502 346
278 3300005436 Ga0070713_100016356 Ga0070713_1000163564 346
279 3300005458 Ga0070681_10016898 Ga0070681_100168984 346
280 3300005546 Ga0070696_100014749 Ga0070696_1000147492 346
281 3300005577 Ga0068857_100077164 Ga0068857_1000771642 346
282 3300006852 Ga0075433_10016879 Ga0075433_100168792 346
283 3300006871 Ga0075434_100003204 Ga0075434_1000032042 346
284 3300007076 Ga0075435_100003095 Ga0075435_1000030959 346
285 3300025928 Ga0207700_10006886 Ga0207700_100068866 346
286 3300026116 Ga0207674_10019663 Ga0207674_100196637 346
287 3300049568 Ga0501031_0123827 Ga0501031_0123827_42_1163 346
288 3300049572 Ga0501036_0034099 Ga0501036_0034099_2504_3625 346
289 3300049574 Ga0501038_0003680 Ga0501038_0003680_4328_5449 346
290 3300049575 Ga0501039_0001499 Ga0501039_0001499_8803_9924 346
291 3300049576 Ga0501040_0001118 Ga0501040_0001118_7133_8254 346
292 3300049576 Ga0501040_0250678 Ga0501040_0250678_79_1203 346
293 3300049577 Ga0501041_0000496 Ga0501041_0000496_8814_9935 346
294 3300049578 Ga0501042_0004171 Ga0501042_0004171_4895_6016 346
295 3300049580 Ga0501046_0033663 Ga0501046_0033663_939_2060 346
296 3300049582 Ga0501048_0001209 Ga0501048_0001209_7683_8804 346
297 3300049584 Ga0501068_0002917 Ga0501068_0002917_1787_2908 346
298 3300049587 Ga0501071_0001035 Ga0501071_0001035_7812_8933 346
299 3300049588 Ga0501072_0002049 Ga0501072_0002049_4329_5450 346
300 3300049590 Ga0501074_0010807 Ga0501074_0010807_1169_2290 346
301 3300049591 Ga0501075_0010683 Ga0501075_0010683_1012_2133 346
302 3300049592 Ga0501076_0015816 Ga0501076_0015816_4329_5450 346
303 3300049593 Ga0501077_0000321 Ga0501077_0000321_21463_22584 346
304 3300049741 Ga0501079_0000705 Ga0501079_0000705_12835_13956 346
305 3300049742 Ga0501080_0003842 Ga0501080_0003842_4352_5473 346
306 3300049743 Ga0501081_0000206 Ga0501081_0000206_19093_20214 346
307 3300049744 Ga0501083_0016441 Ga0501083_0016441_2939_4060 346
308 3300049824 Ga0501045_0001246 Ga0501045_0001246_7068_8189 346
309 3300050512 nmdc:mga0n895_117703_c1 nmdc:mga0n895_117703_c1_702_1826 346
310 3300050515 nmdc:mga0a205_154808_c1 nmdc:mga0a205_154808_c1_369_1493 346
311 3300053140 Ga0500573_0095416 Ga0500573_0095416_168_1280 346
312 3300054114 Ga0501084_0003324 Ga0501084_0003324_8844_9965 346
313 3300060353 Ga0501082_0002602 Ga0501082_0002602_6067_7188 346
314 3300061734 Ga0530510_0004298 Ga0530510_0004298_585_1706 346
315 3300061734 Ga0530510_0006183 Ga0530510_0006183_2101_3228 346
316 3300009094 Ga0111539_10115331 Ga0111539_101153312 348
317 3300037853 Ga0436364_0448042 Ga0436364_0448042_40828_41931 348
318 3300039437 Ga0436365_0031184 Ga0436365_0031184_6689_7792 348
319 3300039453 Ga0436362_0607211 Ga0436362_0607211_59_1162 348
320 3300050511 nmdc:mga08y16_115182_c1 nmdc:mga08y16_115182_c1_798_1904 348
321 3300005468 Ga0070707_100202276 Ga0070707_1002022762 349
322 3300005471 Ga0070698_100213710 Ga0070698_1002137102 349
323 3300006852 Ga0075433_10075909 Ga0075433_100759092 349
324 3300006173 Ga0070716_100144421 Ga0070716_1001444211 350
325 3300025922 Ga0207646_10184059 Ga0207646_101840591 350
326 3300005458 Ga0070681_10013597 Ga0070681_100135976 351
327 3300005530 Ga0070679_100213460 Ga0070679_1002134602 351
328 3300005937 Ga0081455_10008070 Ga0081455_100080705 351
329 3300006847 Ga0075431_100015569 Ga0075431_1000155694 351
330 3300006847 Ga0075431_100145166 Ga0075431_1001451662 351
331 3300006871 Ga0075434_100131500 Ga0075434_1001315002 351
332 3300025912 Ga0207707_10000920 Ga0207707_1000092018 351
333 3300025921 Ga0207652_10169834 Ga0207652_101698342 351
334 3300042001 Ga0439441_014749 Ga0439441_014749_83_1258 351
335 3300049592 Ga0501076_0288606 Ga0501076_0288606_21_1211 351
336 3300050510 nmdc:mga06r32_35331_c1 nmdc:mga06r32_35331_c1_2929_4104 351
337 3300050512 nmdc:mga0n895_165874_c1 nmdc:mga0n895_165874_c1_292_1491 351
338 3300027552 Ga0209982_1005646 Ga0209982_10056462 352
339 3300027695 Ga0209966_1003320 Ga0209966_10033202 352
340 3300027876 Ga0209974_10004884 Ga0209974_100048843 352
341 3300005290 Ga0065712_10069080 Ga0065712_100690807 353
342 3300005293 Ga0065715_10006436 Ga0065715_100064362 353
343 3300005327 Ga0070658_10097657 Ga0070658_100976572 353
344 3300005328 Ga0070676_10011517 Ga0070676_100115172 353
345 3300005330 Ga0070690_100021474 Ga0070690_1000214742 353
346 3300005331 Ga0070670_100004243 Ga0070670_10000424310 353
347 3300005334 Ga0068869_100174757 Ga0068869_1001747572 353
348 3300005335 Ga0070666_10103591 Ga0070666_101035912 353
349 3300005336 Ga0070680_100034644 Ga0070680_1000346443 353
350 3300005337 Ga0070682_100085807 Ga0070682_1000858072 353
351 3300005338 Ga0068868_100141818 Ga0068868_1001418181 353
352 3300005344 Ga0070661_100003346 Ga0070661_1000033462 353
353 3300005347 Ga0070668_100134959 Ga0070668_1001349592 353
354 3300005366 Ga0070659_100194416 Ga0070659_1001944162 353
355 3300005440 Ga0070705_100026520 Ga0070705_1000265202 353
356 3300005455 Ga0070663_100001526 Ga0070663_1000015269 353
357 3300005535 Ga0070684_100042987 Ga0070684_1000429873 353
358 3300005544 Ga0070686_100026173 Ga0070686_1000261733 353
359 3300005546 Ga0070696_100021766 Ga0070696_1000217663 353
360 3300005548 Ga0070665_100105818 Ga0070665_1001058183 353
361 3300005563 Ga0068855_100114948 Ga0068855_1001149483 353
362 3300005564 Ga0070664_100156761 Ga0070664_1001567612 353
363 3300005577 Ga0068857_100219050 Ga0068857_1002190502 353
364 3300005578 Ga0068854_100079494 Ga0068854_1000794942 353
365 3300005614 Ga0068856_100020387 Ga0068856_1000203873 353
366 3300005981 Ga0081538_10003737 Ga0081538_100037376 353
367 3300006852 Ga0075433_10058748 Ga0075433_100587481 353
368 3300006852 Ga0075433_10094788 Ga0075433_100947881 353
369 3300006871 Ga0075434_100025717 Ga0075434_1000257174 353
370 3300006871 Ga0075434_100142332 Ga0075434_1001423323 353
371 3300006881 Ga0068865_100016403 Ga0068865_1000164032 353
372 3300007076 Ga0075435_100056142 Ga0075435_1000561422 353
373 3300007076 Ga0075435_100130174 Ga0075435_1001301742 353
374 3300009094 Ga0111539_10033206 Ga0111539_100332066 353
375 3300009147 Ga0114129_10155161 Ga0114129_101551612 353
376 3300009176 Ga0105242_10058460 Ga0105242_100584602 353
377 3300009553 Ga0105249_10074238 Ga0105249_100742382 353
378 3300011119 Ga0105246_10078897 Ga0105246_100788972 353
379 3300013296 Ga0157374_10013502 Ga0157374_100135022 353
380 3300013306 Ga0163162_10026299 Ga0163162_100262994 353
381 3300014969 Ga0157376_10003405 Ga0157376_100034057 353
382 3300025315 Ga0207697_10014287 Ga0207697_100142872 353
383 3300025893 Ga0207682_10022364 Ga0207682_100223642 353
384 3300025907 Ga0207645_10070191 Ga0207645_100701912 353
385 3300025912 Ga0207707_10091184 Ga0207707_100911842 353
386 3300025917 Ga0207660_10029239 Ga0207660_100292392 353
387 3300025919 Ga0207657_10021994 Ga0207657_100219942 353
388 3300025920 Ga0207649_10083425 Ga0207649_100834252 353
389 3300025921 Ga0207652_10051013 Ga0207652_100510133 353
390 3300025925 Ga0207650_10002387 Ga0207650_100023877 353
391 3300025926 Ga0207659_10047818 Ga0207659_100478183 353
392 3300025933 Ga0207706_10069675 Ga0207706_100696752 353
393 3300025933 Ga0207706_10182084 Ga0207706_101820842 353
394 3300025938 Ga0207704_10021936 Ga0207704_100219363 353
395 3300025940 Ga0207691_10085957 Ga0207691_100859571 353
396 3300025942 Ga0207689_10033208 Ga0207689_100332083 353
397 3300025945 Ga0207679_10173140 Ga0207679_101731401 353
398 3300025945 Ga0207679_10192360 Ga0207679_101923602 353
399 3300025949 Ga0207667_10424045 Ga0207667_104240451 353
400 3300025961 Ga0207712_10113729 Ga0207712_101137292 353
401 3300025981 Ga0207640_10087137 Ga0207640_100871371 353
402 3300026067 Ga0207678_10013685 Ga0207678_100136852 353
403 3300027682 Ga0209971_1007637 Ga0209971_10076372 353
404 3300027876 Ga0209974_10004338 Ga0209974_100043383 353
405 3300027907 Ga0207428_10174079 Ga0207428_101740792 353
406 3300031731 Ga0307405_10070748 Ga0307405_100707482 353
407 3300031911 Ga0307412_10004107 Ga0307412_100041072 353
408 3300035085 Ga0373929_0012709 Ga0373929_0012709_275_1468 353
409 3300035691 Ga0373931_0032587 Ga0373931_0032587_179_1372 353
410 3300037312 Ga0395899_0081544 Ga0395899_0081544_1081_2268 353
411 3300037418 Ga0395900_0140757 Ga0395900_0140757_850_2037 353
412 3300037466 Ga0395898_0023116 Ga0395898_0023116_434_1621 353
413 3300038443 Ga0395901_0022720 Ga0395901_0022720_3837_5024 353
414 3300042876 Ga0451577_0078875 Ga0451577_0078875_971_2164 353
415 3300044712 Ga0453684_0107906 Ga0453684_0107906_1516_2709 353
416 3300046472 Ga0495580_0110374 Ga0495580_0110374_635_1825 353
417 3300048912 Ga0496109_0133143 Ga0496109_0133143_910_2106 353
418 3300048915 Ga0496112_0032492 Ga0496112_0032492_447_1643 353
419 3300048916 Ga0496113_0092574 Ga0496113_0092574_1047_2243 353
420 3300049568 Ga0501031_0007332 Ga0501031_0007332_2584_3774 353
421 3300049568 Ga0501031_0034582 Ga0501031_0034582_1542_2714 353
422 3300049569 Ga0501032_0008877 Ga0501032_0008877_2027_3217 353
423 3300049570 Ga0501033_0009068 Ga0501033_0009068_4590_5780 353
424 3300049570 Ga0501033_0072723 Ga0501033_0072723_108_1319 353
425 3300049572 Ga0501036_0013788 Ga0501036_0013788_2276_3487 353
426 3300049572 Ga0501036_0016260 Ga0501036_0016260_2584_3774 353
427 3300049572 Ga0501036_0197463 Ga0501036_0197463_58_1230 353
428 3300049573 Ga0501037_0028149 Ga0501037_0028149_2432_3643 353
429 3300049573 Ga0501037_0055281 Ga0501037_0055281_797_1987 353
430 3300049574 Ga0501038_0009182 Ga0501038_0009182_713_1924 353
431 3300049574 Ga0501038_0018851 Ga0501038_0018851_879_2051 353
432 3300049574 Ga0501038_0036520 Ga0501038_0036520_1432_2622 353
433 3300049576 Ga0501040_0000010 Ga0501040_0000010_9159_10370 353
434 3300049576 Ga0501040_0015012 Ga0501040_0015012_929_2101 353
435 3300049576 Ga0501040_0024408 Ga0501040_0024408_706_1896 353
436 3300049576 Ga0501040_0189698 Ga0501040_0189698_136_1299 353
437 3300049577 Ga0501041_0005979 Ga0501041_0005979_5061_6272 353
438 3300049577 Ga0501041_0025958 Ga0501041_0025958_1371_2561 353
439 3300049577 Ga0501041_0117696 Ga0501041_0117696_344_1516 353
440 3300049578 Ga0501042_0002645 Ga0501042_0002645_3189_4400 353
441 3300049578 Ga0501042_0016461 Ga0501042_0016461_3441_4613 353
442 3300049578 Ga0501042_0050166 Ga0501042_0050166_1230_2420 353
443 3300049579 Ga0501043_0005902 Ga0501043_0005902_4293_5504 353
444 3300049579 Ga0501043_0012970 Ga0501043_0012970_70_1260 353
445 3300049579 Ga0501043_0084418 Ga0501043_0084418_566_1738 353
446 3300049580 Ga0501046_0079699 Ga0501046_0079699_622_1833 353
447 3300049580 Ga0501046_0083602 Ga0501046_0083602_1204_2394 353
448 3300049582 Ga0501048_0010510 Ga0501048_0010510_2024_3214 353
449 3300049582 Ga0501048_0077820 Ga0501048_0077820_67_1260 353
450 3300049586 Ga0501070_0026677 Ga0501070_0026677_623_1813 353
451 3300049587 Ga0501071_0003736 Ga0501071_0003736_859_2070 353
452 3300049587 Ga0501071_0049182 Ga0501071_0049182_413_1603 353
453 3300049587 Ga0501071_0058368 Ga0501071_0058368_1549_2721 353
454 3300049588 Ga0501072_0041002 Ga0501072_0041002_1356_2546 353
455 3300049588 Ga0501072_0180835 Ga0501072_0180835_387_1550 353
456 3300049589 Ga0501073_0042872 Ga0501073_0042872_1989_3179 353
457 3300049590 Ga0501074_0000201 Ga0501074_0000201_5322_6494 353
458 3300049590 Ga0501074_0005017 Ga0501074_0005017_3590_4780 353
459 3300049590 Ga0501074_0018630 Ga0501074_0018630_3574_4785 353
460 3300049591 Ga0501075_0000090 Ga0501075_0000090_6188_7399 353
461 3300049591 Ga0501075_0110046 Ga0501075_0110046_426_1616 353
462 3300049591 Ga0501075_0153022 Ga0501075_0153022_92_1255 353
463 3300049592 Ga0501076_0027993 Ga0501076_0027993_431_1642 353
464 3300049592 Ga0501076_0046397 Ga0501076_0046397_479_1669 353
465 3300049593 Ga0501077_0001385 Ga0501077_0001385_3930_5141 353
466 3300049593 Ga0501077_0037147 Ga0501077_0037147_1669_2859 353
467 3300049741 Ga0501079_0000063 Ga0501079_0000063_4284_5495 353
468 3300049741 Ga0501079_0034639 Ga0501079_0034639_533_1723 353
469 3300049742 Ga0501080_0003347 Ga0501080_0003347_1560_2771 353
470 3300049742 Ga0501080_0061128 Ga0501080_0061128_1356_2546 353
471 3300049743 Ga0501081_0000085 Ga0501081_0000085_33990_35201 353
472 3300049743 Ga0501081_0011320 Ga0501081_0011320_3696_4886 353
473 3300049744 Ga0501083_0017449 Ga0501083_0017449_70_1260 353
474 3300049822 Ga0501035_0011789 Ga0501035_0011789_4290_5480 353
475 3300049822 Ga0501035_0138401 Ga0501035_0138401_153_1325 353
476 3300049823 Ga0501044_0014918 Ga0501044_0014918_3860_5050 353
477 3300049824 Ga0501045_0000411 Ga0501045_0000411_5961_7172 353
478 3300049824 Ga0501045_0016235 Ga0501045_0016235_3345_4517 353
479 3300050507 nmdc:mga05p37_219362_c1 nmdc:mga05p37_219362_c1_917_2119 353
480 3300050507 nmdc:mga05p37_57205_c1 nmdc:mga05p37_57205_c1_830_2062 353
481 3300050508 nmdc:mga09592_111883_c1 nmdc:mga09592_111883_c1_270_1487 353
482 3300050509 nmdc:mga0qj67_135727_c1 nmdc:mga0qj67_135727_c1_715_1908 353
483 3300050511 nmdc:mga08y16_33431_c1 nmdc:mga08y16_33431_c1_1162_2352 353
484 3300050512 nmdc:mga0n895_18469_c1 nmdc:mga0n895_18469_c1_2393_3589 353
485 3300050512 nmdc:mga0n895_966_c1 nmdc:mga0n895_966_c1_5440_6630 353
486 3300050513 nmdc:mga0rr50_176348_c1 nmdc:mga0rr50_176348_c1_358_1575 353
487 3300050513 nmdc:mga0rr50_46279_c1 nmdc:mga0rr50_46279_c1_285_1475 353
488 3300050515 nmdc:mga0a205_108914_c1 nmdc:mga0a205_108914_c1_540_1736 353
489 3300050515 nmdc:mga0a205_216701_c1 nmdc:mga0a205_216701_c1_471_1661 353
490 3300050515 nmdc:mga0a205_85665_c1 nmdc:mga0a205_85665_c1_518_1750 353
491 3300054114 Ga0501084_0002692 Ga0501084_0002692_10668_11840 353
492 3300054114 Ga0501084_0006990 Ga0501084_0006990_3850_5061 353
493 3300054114 Ga0501084_0017417 Ga0501084_0017417_1573_2763 353
494 3300060353 Ga0501082_0001750 Ga0501082_0001750_4949_6160 353
495 3300060353 Ga0501082_0015564 Ga0501082_0015564_5115_6305 353
496 3300060353 Ga0501082_0059694 Ga0501082_0059694_1526_2698 353
497 3300060353 Ga0501082_0192310 Ga0501082_0192310_19_1191 353
498 3300061734 Ga0530510_0071580 Ga0530510_0071580_479_1669 353
499 3300061734 Ga0530510_0076849 Ga0530510_0076849_559_1770 353
500 iso_pu_bacteria 2511231026 2511384828 358
501 3300006946 Ga0079104_1002622 Ga0079104_10026222 362
502 3300002704 JGI25155J39150_1000038 JGI25155J39150_10000384 364
503 3300002705 JGI25156J39149_1000048 JGI25156J39149_100004876 364
504 3300002738 JGI25154J39366_1000071 JGI25154J39366_10000715 364
505 3300002741 JGI25157J39369_1000200 JGI25157J39369_10002006 364
506 3300003758 Ga0055532_1000571 Ga0055532_10005715 364
507 3300025206 Ga0209435_100030 Ga0209435_10003072 364
508 3300025229 Ga0209147_100004 Ga0209147_1000048 364
509 3300025242 Ga0209258_100893 Ga0209258_1008939 364
510 3300025246 Ga0209646_1000100 Ga0209646_100010072 364
511 3300025250 Ga0209026_1000091 Ga0209026_100009186 364
512 3300025256 Ga0209759_1000084 Ga0209759_100008470 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

60

209

0.96

PF08402

TOBE_2

TOBE domain

330

405

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9652 8 239
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9437 8 218
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9415 8 223
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9389 6 222
4mki-assembly1.cif.gz_B cobalt transporter atp-binding subunit 0.9372 6 228
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 6 223 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 8 242 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 6 223 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 8 241 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9584 8 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9837 8 227 GO:0005524
GO:0016887
GO:0055052
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9804 8 231 GO:0005524
GO:0016887
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9785 2 222 GO:0005524
GO:0016887
AF-A0A519YL00-F1-model_v4 deleted 0.9767 5 239
AF-A6DHY6-F1-model_v4 Putative multiple sugar transport protein 0.9743 8 218 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map