F456802

General Info

Members Datasets Scaffolds Average Seq Length
508 338 481 192

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10054518|Ga0105248_100545186
Length 216
Sequence VPVDAGVGARLLAAMPALRLIVGLGNPGPDYARTRHNAGFWWIDALAEQVGARFGIDSKLQAESAKVVIGGEPVMLLRPLTFMNHSGRAVNAALRYWKIEPEQMLVAHDELDLPPGTARLKFDGGHGGQNGLRDIVALLGHGKFHRLRIGIGHPGHKDKVTPWVLGRPGRDDEAAMLRAIDDALAVLPLAVAGDTNEAMKRLHTKAADREQGTGNG

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
15 2734482264 Dyella sp. AD052 Isolate Unclassified
16 2738543009 Luteibacter sp. OK325 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
19 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
20 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
21 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
22 2919085039 Luteibacter sp. 1214 Isolate Unclassified
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
25 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
26 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
105 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
106 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
107 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
108 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
109 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
110 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
111 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
203 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
237 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
238 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
239 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
254 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.11
Metatranscriptomes 1.57
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 0
Rhizoplane 6.1
Rhizosphere 74.21
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001487 3300001904 Bacteria 4286
2 JGI24736J21556_1001801 3300001904 Bacteria 3846
3 JGI24741J21665_1005708 3300001915 Bacteria 2568
4 JGI24740J21852_10012039 3300001979 Bacteria 3271
5 JGI24738J21930_10000208 3300002075 Bacteria 15688
6 JGI25152J39213_1000480 3300002773 Bacteria 22834
7 JGI25150J39212_1000356 3300002774 Bacteria 22473
8 JGI25150J39212_1001076 3300002774 Bacteria 8305
9 JGI25151J46595_10000924 3300003187 Bacteria 22834
10 JGI25153J46596_10000050 3300003215 Bacteria 140710
11 Ga0055526_1000124 3300003771 Bacteria 68139
12 Ga0055526_1007780 3300003771 Bacteria 5497
13 Ga0055537_1000351 3300003773 Bacteria 31332
14 Ga0055524_1000188 3300003775 Bacteria 68244
15 Ga0055524_1012221 3300003775 Bacteria 3308
16 Ga0055524_1037152 3300003775 Bacteria 1296
17 Ga0055536_1052057 3300003781 Bacteria 894
18 Ga0055534_1000108 3300003784 Bacteria 61496
19 Ga0055528_1000102 3300003790 Bacteria 68139
20 Ga0055530_10003355 3300003791 Bacteria 9178
21 Ga0055531_10009978 3300003794 Bacteria 4787
22 Ga0055531_10022581 3300003794 Bacteria 2392
23 Ga0055531_10026708 3300003794 Bacteria 2049
24 Ga0055531_10042494 3300003794 Bacteria 1299
25 Ga0055531_10053433 3300003794 Bacteria 1043
26 Ga0055531_10061109 3300003794 Bacteria 920
27 Ga0065715_10122124 3300005293 Bacteria 2213
28 Ga0065715_10185859 3300005293 Bacteria 1446
29 Ga0070683_100015303 3300005329 Bacteria 6735
30 Ga0070683_100808040 3300005329 Bacteria 899
31 Ga0070690_100015749 3300005330 Bacteria 4518
32 Ga0070670_100579527 3300005331 Bacteria 1003
33 Ga0068869_100021838 3300005334 Bacteria 4404
34 Ga0070666_10004410 3300005335 Bacteria 8570
35 Ga0070680_100040040 3300005336 Bacteria 3792
36 Ga0070680_100751294 3300005336 Bacteria 840
37 Ga0070680_101141825 3300005336 Bacteria 673
38 Ga0070682_100223120 3300005337 Bacteria 1343
39 Ga0068868_100387333 3300005338 Bacteria 1204
40 Ga0070660_100288604 3300005339 Bacteria 1343
41 Ga0070660_100339268 3300005339 Bacteria 1236
42 Ga0070661_100302959 3300005344 Bacteria 1244
43 Ga0070692_10000651 3300005345 Bacteria 11020
44 Ga0070671_100012856 3300005355 Bacteria 6750
45 Ga0070674_100560787 3300005356 Bacteria 960
46 Ga0070673_100191967 3300005364 Bacteria 1755
47 Ga0070659_100014837 3300005366 Bacteria 5826
48 Ga0070659_100389843 3300005366 Bacteria 1174
49 Ga0070667_100084950 3300005367 Bacteria 2714
50 Ga0070709_10039793 3300005434 Bacteria 2887
51 Ga0070714_100173138 3300005435 Bacteria 1960
52 Ga0070713_100037359 3300005436 Bacteria 3926
53 Ga0070710_10012772 3300005437 Bacteria 4182
54 Ga0070711_100391016 3300005439 Bacteria 1127
55 Ga0070705_100029117 3300005440 Bacteria 3033
56 Ga0070678_100002188 3300005456 Bacteria 10626
57 Ga0070679_100055347 3300005530 Bacteria 3950
58 Ga0070684_100004415 3300005535 Bacteria 10705
59 Ga0070684_100006211 3300005535 Bacteria 9221
60 Ga0070672_100004167 3300005543 Bacteria 9437
61 Ga0070696_100121986 3300005546 Bacteria 1887
62 Ga0070696_100297937 3300005546 Bacteria 1234
63 Ga0070693_100050744 3300005547 Bacteria 2373
64 Ga0070665_100583679 3300005548 Bacteria 1130
65 Ga0070704_100081076 3300005549 Bacteria 2389
66 Ga0070664_100100573 3300005564 Bacteria 2514
67 Ga0068857_100102805 3300005577 Bacteria 2565
68 Ga0068857_100133236 3300005577 Bacteria 2242
69 Ga0068854_100225912 3300005578 Bacteria 1483
70 Ga0068854_100227301 3300005578 Bacteria 1479
71 Ga0068856_100000022 3300005614 Bacteria 142768
72 Ga0068856_100223444 3300005614 Bacteria 1898
73 Ga0068852_100017201 3300005616 Bacteria 5668
74 Ga0068859_100092261 3300005617 Bacteria 3080
75 Ga0068864_100048154 3300005618 Bacteria 3663
76 Ga0068866_10025556 3300005718 Bacteria 2777
77 Ga0068861_100184720 3300005719 Bacteria 1738
78 Ga0068861_100271269 3300005719 Bacteria 1457
79 Ga0068851_10062833 3300005834 Bacteria 1906
80 Ga0068863_100531527 3300005841 Bacteria 1160
81 Ga0068860_100049203 3300005843 Bacteria 4016
82 Ga0068862_100083610 3300005844 Bacteria 2772
83 Ga0075364_10005259 3300006051 Bacteria 7512
84 Ga0070715_10000377 3300006163 Bacteria 11155
85 Ga0070712_100014028 3300006175 Bacteria 5136
86 Ga0097621_100004496 3300006237 Bacteria 9723
87 Ga0068871_100008248 3300006358 Bacteria 7488
88 Ga0068865_100045505 3300006881 Bacteria 3009
89 Ga0075436_100054620 3300006914 Bacteria 2758
90 Ga0097620_100092260 3300006931 Bacteria 3080
91 Ga0099794_10217979 3300007265 Bacteria 980
92 Ga0105240_10392011 3300009093 Bacteria 1566
93 Ga0105240_11038053 3300009093 Bacteria 875
94 Ga0105245_10013508 3300009098 Bacteria 7111
95 Ga0105247_10053022 3300009101 Bacteria 2501
96 Ga0105241_10426989 3300009174 Bacteria 1168
97 Ga0105242_10002609 3300009176 Bacteria 14132
98 Ga0105248_10054518 3300009177 Bacteria 4483
99 Ga0105248_10060061 3300009177 Bacteria 4268
100 Ga0099796_10012654 3300010159 Bacteria 2389
101 Ga0105239_10127578 3300010375 Bacteria 2828
102 Ga0105239_10393874 3300010375 Bacteria 1567
103 Ga0157336_1001113 3300012477 Bacteria 1344
104 Ga0157318_1001010 3300012482 Bacteria 1344
105 Ga0157323_1002283 3300012495 Bacteria 1053
106 Ga0157347_1020760 3300012502 Bacteria 768
107 Ga0157315_1002054 3300012508 Bacteria 1211
108 Ga0157316_1000607 3300012510 Bacteria 1941
109 Ga0157327_1001022 3300012512 Bacteria 1661
110 Ga0157327_1011044 3300012512 Bacteria 865
111 Ga0157338_1009055 3300012515 Bacteria 978
112 Ga0157373_10002076 3300013100 Bacteria 15179
113 Ga0157373_10654777 3300013100 Bacteria 767
114 Ga0157371_10543073 3300013102 Bacteria 861
115 Ga0157370_10000272 3300013104 Bacteria 65739
116 Ga0157370_10022679 3300013104 Bacteria 6247
117 Ga0157370_11122369 3300013104 Bacteria 710
118 Ga0157369_10000706 3300013105 Bacteria 43083
119 Ga0157369_10040166 3300013105 Bacteria 5109
120 Ga0157369_10056779 3300013105 Bacteria 4224
121 Ga0157374_10002953 3300013296 Bacteria 14242
122 Ga0157374_10456745 3300013296 Bacteria 1279
123 Ga0157378_10089008 3300013297 Bacteria 2803
124 Ga0163162_10047440 3300013306 Bacteria 4305
125 Ga0157372_10009738 3300013307 Bacteria 10220
126 Ga0157372_10551623 3300013307 Bacteria 1343
127 Ga0157375_10008845 3300013308 Bacteria 8819
128 Ga0157375_10237851 3300013308 Bacteria 1980
129 Ga0157380_10246581 3300014326 Bacteria 1614
130 Ga0157380_10514375 3300014326 Bacteria 1166
131 Ga0157380_10883228 3300014326 Bacteria 919
132 Ga0182008_10040297 3300014497 Bacteria 2332
133 Ga0157379_10025108 3300014968 Bacteria 5291
134 Ga0182006_1000563 3300015261 Bacteria 27731
135 Ga0182005_1000362 3300015265 Bacteria 25350
136 Ga0182005_1002947 3300015265 Bacteria 5900
137 Ga0183360_10001 3300015689 Bacteria 3943671
138 Ga0163161_10109856 3300017792 Bacteria 2060
139 Ga0206356_10028907 3300020070 Bacteria 2827
140 Ga0206354_10060913 3300020081 Bacteria 6183
141 Ga0206353_10309227 3300020082 Bacteria 4028
142 Ga0154015_1087267 3300020610 Bacteria 5918
143 Ga0213873_10003266 3300021358 Bacteria 2905
144 Ga0207425_1000117 3300025245 Bacteria 74911
145 Ga0207425_1016989 3300025245 Bacteria 1607
146 Ga0209129_1000011 3300025258 Bacteria 568657
147 Ga0209129_1003121 3300025258 Bacteria 7444
148 Ga0209565_1000001 3300025263 Bacteria 2950419
149 Ga0209673_1000001 3300025273 Bacteria 3176258
150 Ga0209673_1016931 3300025273 Bacteria 2705
151 Ga0209130_1009639 3300025284 Bacteria 2731
152 Ga0209675_1000001 3300025291 Bacteria 2950293
153 Ga0209675_1009635 3300025291 Bacteria 3390
154 Ga0209675_1042019 3300025291 Bacteria 993
155 Ga0209676_1001557 3300025292 Bacteria 20542
156 Ga0209676_1005445 3300025292 Bacteria 6651
157 Ga0209676_1054366 3300025292 Bacteria 1032
158 Ga0209025_1000002 3300025294 Bacteria 1393142
159 Ga0209025_1000006 3300025294 Bacteria 1153444
160 Ga0209025_1004073 3300025294 Bacteria 13042
161 Ga0209025_1084772 3300025294 Bacteria 1060
162 Ga0209025_1107572 3300025294 Bacteria 865
163 Ga0209564_1000001 3300025295 Bacteria 3176258
164 Ga0209564_1006399 3300025295 Bacteria 6362
165 Ga0209758_1000003 3300025297 Bacteria 1398533
166 Ga0209758_1090260 3300025297 Bacteria 899
167 Ga0209050_1006874 3300025298 Bacteria 6600
168 Ga0209050_1048399 3300025298 Bacteria 1099
169 Ga0209256_1000006 3300025299 Bacteria 1250310
170 Ga0209256_1002733 3300025299 Bacteria 13643
171 Ga0209256_1009960 3300025299 Bacteria 4069
172 Ga0209256_1014424 3300025299 Bacteria 2844
173 Ga0209051_1002516 3300025303 Bacteria 13004
174 Ga0209257_1000343 3300025304 Bacteria 96876
175 Ga0209257_1000567 3300025304 Bacteria 62634
176 Ga0209257_1000788 3300025304 Bacteria 46352
177 Ga0209257_1016412 3300025304 Bacteria 2997
178 Ga0209257_1047840 3300025304 Bacteria 1227
179 Ga0207692_10023530 3300025898 Bacteria 2850
180 Ga0207642_10015835 3300025899 Bacteria 2823
181 Ga0207647_10000415 3300025904 Bacteria 35115
182 Ga0207647_10000845 3300025904 Bacteria 23756
183 Ga0207647_10415343 3300025904 Bacteria 757
184 Ga0207705_10002560 3300025909 Bacteria 13984
185 Ga0207705_10044506 3300025909 Bacteria 3190
186 Ga0207654_10322270 3300025911 Bacteria 1057
187 Ga0207707_10000184 3300025912 Bacteria 65784
188 Ga0207707_10002500 3300025912 Bacteria 16548
189 Ga0207695_10022985 3300025913 Bacteria 7061
190 Ga0207695_10046420 3300025913 Bacteria 4605
191 Ga0207695_10185807 3300025913 Bacteria 1997
192 Ga0207693_10000309 3300025915 Bacteria 45500
193 Ga0207660_10002616 3300025917 Bacteria 11814
194 Ga0207660_10015330 3300025917 Bacteria 5056
195 Ga0207660_10608191 3300025917 Bacteria 890
196 Ga0207657_10040428 3300025919 Bacteria 4132
197 Ga0207657_10168905 3300025919 Bacteria 1773
198 Ga0207657_10183155 3300025919 Bacteria 1692
199 Ga0207649_10004358 3300025920 Bacteria 7681
200 Ga0207649_10014225 3300025920 Bacteria 4452
201 Ga0207649_10193751 3300025920 Bacteria 1431
202 Ga0207652_10004286 3300025921 Bacteria 11635
203 Ga0207652_10014993 3300025921 Bacteria 6287
204 Ga0207646_10586587 3300025922 Unclassified 1001
205 Ga0207650_10171216 3300025925 Bacteria 1726
206 Ga0207650_10320564 3300025925 Bacteria 1269
207 Ga0207700_10035052 3300025928 Bacteria 3610
208 Ga0207644_10034788 3300025931 Bacteria 3526
209 Ga0207644_10094519 3300025931 Bacteria 2233
210 Ga0207690_10165365 3300025932 Bacteria 1653
211 Ga0207704_10938006 3300025938 Bacteria 729
212 Ga0207691_10206802 3300025940 Bacteria 1706
213 Ga0207711_10016115 3300025941 Bacteria 6203
214 Ga0207711_10255980 3300025941 Bacteria 1608
215 Ga0207689_10175963 3300025942 Bacteria 1764
216 Ga0207661_10002037 3300025944 Bacteria 13942
217 Ga0207661_10194099 3300025944 Bacteria 1781
218 Ga0207667_10014147 3300025949 Bacteria 9108
219 Ga0207667_10052651 3300025949 Bacteria 4285
220 Ga0207640_10002439 3300025981 Bacteria 9946
221 Ga0207640_10016624 3300025981 Bacteria 4285
222 Ga0207658_10110541 3300025986 Bacteria 2171
223 Ga0207677_10034774 3300026023 Bacteria 3266
224 Ga0207703_10213118 3300026035 Bacteria 1723
225 Ga0207639_10061352 3300026041 Bacteria 2904
226 Ga0207639_10192383 3300026041 Bacteria 1743
227 Ga0207639_10347318 3300026041 Bacteria 1324
228 Ga0207678_10193364 3300026067 Bacteria 1739
229 Ga0207678_10200512 3300026067 Bacteria 1706
230 Ga0207678_10383081 3300026067 Bacteria 1216
231 Ga0207702_10000852 3300026078 Bacteria 31897
232 Ga0207702_10001953 3300026078 Bacteria 20099
233 Ga0207702_10058260 3300026078 Bacteria 3287
234 Ga0207702_10280769 3300026078 Bacteria 1574
235 Ga0207641_10116499 3300026088 Bacteria 2377
236 Ga0207641_10131242 3300026088 Bacteria 2250
237 Ga0207648_10149870 3300026089 Bacteria 2058
238 Ga0207676_10091181 3300026095 Bacteria 2503
239 Ga0207674_10012399 3300026116 Bacteria 9530
240 Ga0207674_10090054 3300026116 Bacteria 3059
241 Ga0207674_10206185 3300026116 Bacteria 1915
242 Ga0207675_100136230 3300026118 Bacteria 2330
243 Ga0207683_10002168 3300026121 Bacteria 17238
244 Ga0207698_10001409 3300026142 Bacteria 13947
245 Ga0207698_10002115 3300026142 Bacteria 11711
246 Ga0207698_11208195 3300026142 Bacteria 770
247 Ga0209969_1003702 3300027360 Bacteria 2121
248 Ga0209967_1002954 3300027364 Bacteria 2226
249 Ga0209981_1017045 3300027378 Bacteria 1024
250 Ga0209984_1008812 3300027424 Bacteria 1274
251 Ga0209995_1014812 3300027471 Bacteria 1279
252 Ga0209999_1000513 3300027543 Bacteria 6040
253 Ga0209983_1003578 3300027665 Bacteria 3297
254 Ga0209983_1070892 3300027665 Bacteria 777
255 Ga0209971_1002324 3300027682 Bacteria 4597
256 Ga0209974_10036024 3300027876 Bacteria 1643
257 Ga0268266_10120135 3300028379 Bacteria 2338
258 Ga0268266_10324948 3300028379 Bacteria 1441
259 Ga0268265_10188059 3300028380 Bacteria 1781
260 Ga0268265_10189410 3300028380 Bacteria 1775
261 Ga0268264_10074406 3300028381 Bacteria 2885
262 Ga0314311_1048888 3300030733 Bacteria 1952
263 Ga0316178_1104819 3300030735 Bacteria 3410
264 Ga0316182_1135616 3300030745 Bacteria 769
265 Ga0307513_10024815 3300031456 Bacteria 6969
266 Ga0307509_10189456 3300031507 Bacteria 1910
267 Ga0307408_100796263 3300031548 Bacteria 857
268 Ga0316575_10032367 3300031665 Bacteria 2048
269 Ga0316579_10286380 3300031691 Bacteria 796
270 Ga0316576_10110908 3300031727 Bacteria 2056
271 Ga0316578_10049276 3300031728 Bacteria 2461
272 Ga0307516_10007119 3300031730 Bacteria 12924
273 Ga0307405_10592663 3300031731 Bacteria 903
274 Ga0307413_10063997 3300031824 Bacteria 2283
275 Ga0307413_10214665 3300031824 Bacteria 1400
276 Ga0307410_10293429 3300031852 Bacteria 1280
277 Ga0307406_10008962 3300031901 Bacteria 5594
278 Ga0307406_10085207 3300031901 Bacteria 2112
279 Ga0307406_10398950 3300031901 Bacteria 1090
280 Ga0307407_10761000 3300031903 Bacteria 734
281 Ga0307412_10001032 3300031911 Bacteria 15910
282 Ga0307412_10057798 3300031911 Bacteria 2591
283 Ga0307412_10149278 3300031911 Bacteria 1722
284 Ga0307412_10149760 3300031911 Bacteria 1720
285 Ga0307412_10317441 3300031911 Bacteria 1238
286 Ga0307412_10323802 3300031911 Bacteria 1227
287 Ga0307412_11017345 3300031911 Bacteria 733
288 Ga0307414_10001926 3300032004 Bacteria 10746
289 Ga0307414_10003486 3300032004 Bacteria 8405
290 Ga0307414_10265403 3300032004 Bacteria 1435
291 Ga0307414_10366131 3300032004 Bacteria 1242
292 Ga0307414_10447479 3300032004 Bacteria 1132
293 Ga0307411_10177390 3300032005 Bacteria 1613
294 Ga0307415_100223269 3300032126 Bacteria 1512
295 Ga0316593_10126920 3300032168 Bacteria 919
296 Ga0316596_1026026 3300033541 Bacteria 1507
297 Ga0373944_0145547 3300035089 Bacteria 832
298 Ga0373956_0242247 3300035119 Bacteria 857
299 Ga0373943_0140555 3300035170 Bacteria 1300
300 Ga0373955_0121411 3300035172 Bacteria 1519
301 Ga0316574_0134170 3300035398 Bacteria 1594
302 Ga0373927_0010393 3300035695 Bacteria 6211
303 Ga0373947_0109659 3300035725 Bacteria 1743
304 Ga0373937_0387507 3300036401 Bacteria 1326
305 Ga0316582_0041767 3300036647 Bacteria 2868
306 Ga0373925_0074520 3300037068 Bacteria 2571
307 Ga0395899_0284105 3300037312 Bacteria 1125
308 Ga0395898_0129490 3300037466 Bacteria 2418
309 Ga0395898_0173334 3300037466 Bacteria 2062
310 Ga0395898_0490245 3300037466 Bacteria 1169
311 Ga0395905_0075829 3300037471 Bacteria 3152
312 Ga0395905_0121377 3300037471 Bacteria 2456
313 Ga0395905_0522526 3300037471 Bacteria 1087
314 Ga0395905_0878712 3300037471 Bacteria 799
315 Ga0395901_0092855 3300038443 Bacteria 3159
316 Ga0237819_00412 3300038705 Bacteria 14816
317 Ga0436360_0242755 3300039438 Bacteria 1916
318 Ga0436363_0272180 3300039450 Bacteria 5607
319 Ga0436363_0830800 3300039450 Bacteria 8859
320 Ga0436362_0507180 3300039453 Bacteria 3374
321 Ga0439436_0000109 3300041404 Bacteria 19183
322 Ga0439436_0005125 3300041404 Bacteria 4016
323 Ga0439436_0021567 3300041404 Bacteria 1913
324 Ga0439436_0022662 3300041404 Bacteria 1860
325 Ga0439436_0024264 3300041404 Bacteria 1791
326 Ga0439439_0016836 3300041406 Bacteria 1793
327 Ga0439439_0058408 3300041406 Bacteria 1021
328 Ga0439447_002340 3300041407 Bacteria 6931
329 Ga0439461_0130175 3300041410 Bacteria 636
330 Ga0439465_0001938 3300041413 Bacteria 6788
331 Ga0439465_0011446 3300041413 Bacteria 2784
332 Ga0439465_0130934 3300041413 Bacteria 885
333 Ga0439465_0233304 3300041413 Bacteria 677
334 Ga0451789_1286101 3300041443 Bacteria 1268
335 Ga0451791_1274919 3300041451 Bacteria 1210
336 Ga0451793_1712095 3300041452 Bacteria 1233
337 Ga0451795_1416188 3300041456 Unclassified 1010
338 Ga0451807_0822463 3300041486 Bacteria 1288
339 Ga0451807_0904569 3300041486 Bacteria 979
340 Ga0451807_1988829 3300041486 Bacteria 1553
341 Ga0451837_0903999 3300041494 Bacteria 973
342 Ga0439433_0041040 3300041999 Bacteria 1077
343 Ga0439445_0014188 3300042004 Bacteria 1937
344 Ga0439445_0060348 3300042004 Bacteria 1036
345 Ga0439445_0063262 3300042004 Bacteria 1014
346 Ga0439432_015781 3300042006 Bacteria 2546
347 Ga0439432_029707 3300042006 Bacteria 1775
348 Ga0439449_0000413 3300042007 Bacteria 15802
349 Ga0439449_0005783 3300042007 Bacteria 4731
350 Ga0439449_0020151 3300042007 Bacteria 2499
351 Ga0439449_0143507 3300042007 Bacteria 889
352 Ga0439452_010124 3300042010 Bacteria 2755
353 Ga0439462_0006706 3300042015 Bacteria 2872
354 Ga0439462_0100987 3300042015 Bacteria 795
355 Ga0450898_022996 3300042134 Bacteria 1107
356 Ga0450908_000269 3300042184 Bacteria 10213
357 Ga0451577_0031680 3300042876 Bacteria 4770
358 Ga0451577_0031713 3300042876 Bacteria 4767
359 Ga0451577_0308057 3300042876 Bacteria 1435
360 Ga0453684_0001075 3300044712 Bacteria 86968
361 Ga0451576_0000025 3300045051 Bacteria 427980
362 Ga0466967_0869862 3300045976 Bacteria 896
363 Ga0495638_0113775 3300046460 Bacteria 1605
364 Ga0495638_0344883 3300046460 Bacteria 788
365 Ga0495650_0001294 3300046471 Bacteria 25431
366 Ga0495580_0013301 3300046472 Bacteria 6287
367 Ga0495605_0045287 3300046474 Bacteria 2169
368 Ga0495584_0004523 3300046491 Bacteria 7466
369 Ga0495585_0001164 3300046492 Bacteria 21400
370 Ga0495607_0001296 3300046501 Bacteria 22305
371 Ga0495606_0002600 3300046507 Bacteria 20645
372 Ga0495610_0006598 3300046512 Bacteria 7930
373 Ga0495610_0009553 3300046512 Bacteria 6117
374 Ga0495616_0006200 3300046513 Bacteria 7271
375 Ga0495618_0240838 3300046514 Bacteria 1137
376 Ga0495620_0058355 3300046515 Bacteria 1615
377 Ga0495628_0343022 3300046516 Bacteria 1099
378 Ga0495631_0000153 3300046518 Bacteria 47259
379 Ga0495631_0001341 3300046518 Bacteria 15064
380 Ga0495643_0063565 3300046522 Bacteria 1952
381 Ga0495648_0005663 3300046524 Bacteria 10336
382 Ga0495648_0009304 3300046524 Bacteria 7635
383 Ga0495663_0000627 3300046525 Bacteria 12316
384 Ga0495663_0095122 3300046525 Bacteria 975
385 Ga0495665_0053039 3300046531 Bacteria 2146
386 Ga0495621_0015980 3300046539 Bacteria 2401
387 Ga0495621_0094066 3300046539 Bacteria 1133
388 Ga0495633_0007036 3300046558 Bacteria 6554
389 Ga0495656_0020362 3300046615 Bacteria 2572
390 Ga0495656_0023325 3300046615 Bacteria 2434
391 Ga0495656_0079486 3300046615 Bacteria 1476
392 Ga0495656_0227955 3300046615 Bacteria 934
393 Ga0495668_0005870 3300046616 Bacteria 8181
394 Ga0495611_0000076 3300046648 Bacteria 69480
395 Ga0495625_0176262 3300046660 Bacteria 1424
396 Ga0495661_0001341 3300046665 Bacteria 20869
397 Ga0495599_0259165 3300046678 Bacteria 1057
398 Ga0495670_0008473 3300046691 Bacteria 5057
399 Ga0495670_0157301 3300046691 Bacteria 1193
400 Ga0495671_0096783 3300046692 Bacteria 1444
401 Ga0495636_0008680 3300047318 Bacteria 4006
402 Ga0495636_0009214 3300047318 Bacteria 3885
403 Ga0495636_0044848 3300047318 Bacteria 1842
404 Ga0495636_0059910 3300047318 Bacteria 1607
405 Ga0495683_0003452 3300047323 Bacteria 9220
406 Ga0495673_0000175 3300047469 Bacteria 105273
407 Ga0495673_0000548 3300047469 Bacteria 38312
408 Ga0495686_0001999 3300047472 Bacteria 20216
409 Ga0495686_0047803 3300047472 Bacteria 2700
410 Ga0495686_0221948 3300047472 Bacteria 1074
411 Ga0496101_0001399 3300048904 Bacteria 14442
412 Ga0496101_0136423 3300048904 Bacteria 1867
413 Ga0496101_0140374 3300048904 Bacteria 1841
414 Ga0496102_0081654 3300048905 Bacteria 2980
415 Ga0496102_0104102 3300048905 Bacteria 2640
416 Ga0496102_0249638 3300048905 Bacteria 1673
417 Ga0496103_0060620 3300048906 Bacteria 2352
418 Ga0496103_0101642 3300048906 Bacteria 1820
419 Ga0496104_0215939 3300048907 Bacteria 1829
420 Ga0496105_0078549 3300048908 Bacteria 2724
421 Ga0496106_0010118 3300048909 Bacteria 6965
422 Ga0496106_0075896 3300048909 Bacteria 2575
423 Ga0496107_0038377 3300048910 Bacteria 3436
424 Ga0496107_0230674 3300048910 Bacteria 1377
425 Ga0496108_0007461 3300048911 Bacteria 8866
426 Ga0496109_0121252 3300048912 Bacteria 2436
427 Ga0496110_0006955 3300048913 Bacteria 8999
428 Ga0496110_0453596 3300048913 Bacteria 1168
429 Ga0496111_0076140 3300048914 Bacteria 2445
430 Ga0496112_0148083 3300048915 Bacteria 2315
431 Ga0496113_0037719 3300048916 Bacteria 3549
432 Ga0496113_0040660 3300048916 Bacteria 3427
433 Ga0496114_0007080 3300048917 Bacteria 8850
434 Ga0496114_0014430 3300048917 Bacteria 6343
435 Ga0496116_0215845 3300048919 Bacteria 989
436 Ga0496117_0031599 3300048920 Bacteria 4038
437 Ga0496117_0185003 3300048920 Bacteria 1193
438 Ga0496118_0247522 3300048921 Bacteria 1015
439 Ga0496121_0000290 3300048924 Bacteria 104280
440 Ga0496121_0015404 3300048924 Bacteria 8013
441 Ga0496121_0040985 3300048924 Bacteria 4054
442 Ga0496122_0032223 3300048925 Bacteria 4340
443 Ga0496122_0184448 3300048925 Bacteria 1240
444 Ga0496125_0040218 3300048928 Bacteria 4013
445 Ga0496126_0117984 3300048929 Bacteria 2304
446 Ga0496126_0134329 3300048929 Bacteria 2135
447 Ga0501306_007573 3300049127 Bacteria 1303
448 Ga0501310_002906 3300049130 Bacteria 1653
449 Ga0495678_155661 3300049459 Bacteria 734
450 Ga0495682_0003660 3300049460 Bacteria 6776
451 Ga0501031_0003184 3300049568 Bacteria 10532
452 Ga0501032_0021757 3300049569 Bacteria 4455
453 Ga0501032_0107666 3300049569 Bacteria 1846
454 Ga0501034_0009035 3300049571 Bacteria 10465
455 Ga0501034_0046740 3300049571 Bacteria 4373
456 Ga0501034_0591077 3300049571 Bacteria 1016
457 Ga0501034_0789807 3300049571 Bacteria 843
458 Ga0501034_0966985 3300049571 Bacteria 736
459 Ga0501036_0043311 3300049572 Bacteria 3811
460 Ga0501036_0578104 3300049572 Bacteria 933
461 Ga0501037_0002429 3300049573 Bacteria 13472
462 Ga0501038_0004283 3300049574 Bacteria 13267
463 Ga0501039_0020002 3300049575 Bacteria 5131
464 Ga0501043_0038380 3300049579 Bacteria 3766
465 Ga0501043_0391785 3300049579 Bacteria 1050
466 Ga0501047_0060812 3300049581 Bacteria 3644
467 Ga0501069_0226222 3300049585 Bacteria 1088
468 Ga0501070_0004462 3300049586 Bacteria 12020
469 Ga0501070_0102516 3300049586 Bacteria 2367
470 Ga0501070_0323831 3300049586 Bacteria 1253
471 Ga0501073_0087884 3300049589 Bacteria 2161
472 Ga0501077_0012889 3300049593 Bacteria 5237
473 Ga0501080_0015994 3300049742 Bacteria 6922
474 Ga0501035_0028854 3300049822 Bacteria 5062
475 Ga0501044_0008077 3300049823 Bacteria 11558
476 nmdc:mga00v17_21547_c1 3300050491 Bacteria 3706
477 Ga0495612_0036532 3300053078 Bacteria 1994
478 Ga0500651_0421483 3300053093 Bacteria 747
479 Ga0500633_0002927 3300053160 Bacteria 3623
480 Ga0500634_0016015 3300053161 Bacteria 3995
481 Ga0500645_022571 3300053730 Bacteria 1934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10586587 Ga0207646_105865872 168
2 3300001904 JGI24736J21556_1001801 JGI24736J21556_10018012 174
3 3300002075 JGI24738J21930_10000208 JGI24738J21930_100002086 174
4 3300005344 Ga0070661_100302959 Ga0070661_1003029592 174
5 3300013104 Ga0157370_10000272 Ga0157370_1000027255 174
6 3300013104 Ga0157370_10022679 Ga0157370_100226793 174
7 3300013105 Ga0157369_10000706 Ga0157369_1000070627 174
8 3300015261 Ga0182006_1000563 Ga0182006_100056310 174
9 3300015265 Ga0182005_1000362 Ga0182005_100036221 174
10 3300015265 Ga0182005_1002947 Ga0182005_10029473 174
11 3300025258 Ga0209129_1003121 Ga0209129_10031214 174
12 3300025299 Ga0209256_1014424 Ga0209256_10144242 174
13 3300025904 Ga0207647_10000415 Ga0207647_1000041522 174
14 3300025920 Ga0207649_10193751 Ga0207649_101937512 174
15 3300026067 Ga0207678_10383081 Ga0207678_103830812 174
16 3300031731 Ga0307405_10592663 Ga0307405_105926631 174
17 3300031911 Ga0307412_10001032 Ga0307412_1000103211 174
18 3300041404 Ga0439436_0000109 Ga0439436_0000109_5820_6416 174
19 3300042004 Ga0439445_0060348 Ga0439445_0060348_26_604 174
20 3300042015 Ga0439462_0100987 Ga0439462_0100987_13_591 174
21 3300042184 Ga0450908_000269 Ga0450908_000269_8478_9056 174
22 3300046471 Ga0495650_0001294 Ga0495650_0001294_6101_6679 174
23 3300046474 Ga0495605_0045287 Ga0495605_0045287_911_1489 174
24 3300046491 Ga0495584_0004523 Ga0495584_0004523_4574_5152 174
25 3300046492 Ga0495585_0001164 Ga0495585_0001164_6997_7575 174
26 3300046501 Ga0495607_0001296 Ga0495607_0001296_7623_8201 174
27 3300046507 Ga0495606_0002600 Ga0495606_0002600_13627_14205 174
28 3300046512 Ga0495610_0006598 Ga0495610_0006598_4133_4729 174
29 3300046512 Ga0495610_0009553 Ga0495610_0009553_1395_1973 174
30 3300046513 Ga0495616_0006200 Ga0495616_0006200_6434_7012 174
31 3300046515 Ga0495620_0058355 Ga0495620_0058355_25_603 174
32 3300046518 Ga0495631_0000153 Ga0495631_0000153_39952_40530 174
33 3300046518 Ga0495631_0001341 Ga0495631_0001341_8326_8904 174
34 3300046524 Ga0495648_0005663 Ga0495648_0005663_1300_1878 174
35 3300046524 Ga0495648_0009304 Ga0495648_0009304_15_593 174
36 3300046648 Ga0495611_0000076 Ga0495611_0000076_6101_6679 174
37 3300046660 Ga0495625_0176262 Ga0495625_0176262_265_843 174
38 3300046665 Ga0495661_0001341 Ga0495661_0001341_6541_7119 174
39 3300046691 Ga0495670_0008473 Ga0495670_0008473_3435_4013 174
40 3300047323 Ga0495683_0003452 Ga0495683_0003452_6877_7455 174
41 3300047469 Ga0495673_0000175 Ga0495673_0000175_7145_7723 174
42 3300047469 Ga0495673_0000548 Ga0495673_0000548_31085_31663 174
43 3300047472 Ga0495686_0001999 Ga0495686_0001999_19494_20072 174
44 3300047472 Ga0495686_0221948 Ga0495686_0221948_328_906 174
45 3300048904 Ga0496101_0001399 Ga0496101_0001399_5619_6197 174
46 3300048905 Ga0496102_0249638 Ga0496102_0249638_894_1472 174
47 3300048909 Ga0496106_0010118 Ga0496106_0010118_604_1182 174
48 3300048919 Ga0496116_0215845 Ga0496116_0215845_178_756 174
49 3300048920 Ga0496117_0031599 Ga0496117_0031599_1336_1914 174
50 3300048924 Ga0496121_0000290 Ga0496121_0000290_40255_40833 174
51 3300048924 Ga0496121_0015404 Ga0496121_0015404_6490_7068 174
52 3300048928 Ga0496125_0040218 Ga0496125_0040218_2252_2830 174
53 3300048929 Ga0496126_0134329 Ga0496126_0134329_1362_1940 174
54 3300049459 Ga0495678_155661 Ga0495678_155661_85_663 174
55 3300049460 Ga0495682_0003660 Ga0495682_0003660_541_1119 174
56 3300053093 Ga0500651_0421483 Ga0500651_0421483_108_695 174
57 3300053160 Ga0500633_0002927 Ga0500633_0002927_2002_2580 174
58 3300053730 Ga0500645_022571 Ga0500645_022571_1254_1832 174
59 3300005614 Ga0068856_100000022 Ga0068856_100000022122 176
60 3300013105 Ga0157369_10056779 Ga0157369_100567798 176
61 3300026078 Ga0207702_10000852 Ga0207702_100008529 176
62 3300031507 Ga0307509_10189456 Ga0307509_101894562 176
63 3300042876 Ga0451577_0031680 Ga0451577_0031680_1512_2111 176
64 3300044712 Ga0453684_0001075 Ga0453684_0001075_2365_2952 176
65 3300045051 Ga0451576_0000025 Ga0451576_0000025_83776_84363 176
66 3300049571 Ga0501034_0789807 Ga0501034_0789807_95_676 176
67 3300041456 Ga0451795_1416188 Ga0451795_1416188_13_564 179
68 3300031691 Ga0316579_10286380 Ga0316579_102863801 181
69 3300031727 Ga0316576_10110908 Ga0316576_101109083 181
70 3300031728 Ga0316578_10049276 Ga0316578_100492761 181
71 3300032168 Ga0316593_10126920 Ga0316593_101269201 181
72 3300033541 Ga0316596_1026026 Ga0316596_10260263 181
73 3300035398 Ga0316574_0134170 Ga0316574_0134170_758_1336 181
74 3300036647 Ga0316582_0041767 Ga0316582_0041767_1014_1592 181
75 3300031901 Ga0307406_10398950 Ga0307406_103989502 185
76 3300031911 Ga0307412_11017345 Ga0307412_110173452 185
77 3300032126 Ga0307415_100223269 Ga0307415_1002232692 185
78 iso_pu_bacteria 2593339239 2595451329 187
79 iso_pu_bacteria 2718218334 2721028652 187
80 iso_pu_bacteria 2738543009 2739227036 187
81 iso_pu_bacteria 2818991440 2819565877 187
82 iso_pu_bacteria 2842918807 2842922206 187
83 iso_pu_bacteria 2904463128 2904466148 187
84 iso_pu_bacteria 2919085039 2919086825 187
85 iso_pu_bacteria 2941471342 2941473877 187
86 iso_pu_bacteria 2995948881 2995950343 188
87 iso_pu_bacteria 8003014200 8003015023 188
88 iso_pu_bacteria 2524614729 2525556165 189
89 iso_pu_bacteria 2571042365 2572254555 189
90 iso_pu_bacteria 2627854209 2630649395 189
91 iso_pu_bacteria 2643221559 2643815637 189
92 iso_pu_bacteria 2643221573 2643882110 189
93 iso_pu_bacteria 2643221586 2643938221 189
94 iso_pu_bacteria 2643221593 2643976393 189
95 iso_pu_bacteria 2643221612 2644079860 189
96 iso_pu_bacteria 2643221695 2644528429 189
97 iso_pu_bacteria 2643221720 2644663181 189
98 iso_pu_bacteria 2643221727 2644695988 189
99 iso_pu_bacteria 2643221728 2644699656 189
100 iso_pu_bacteria 2747842501 2748018910 189
101 iso_pu_bacteria 2894414249 2894414487 189
102 iso_pu_bacteria 2941489479 2941490098 189
103 3300012512 Ga0157327_1011044 Ga0157327_10110442 190
104 iso_pu_bacteria 2734482264 2735835758 191
105 iso_pu_bacteria 2953994433 2953997323 191
106 3300003771 Ga0055526_1007780 Ga0055526_10077806 192
107 3300003775 Ga0055524_1037152 Ga0055524_10371522 192
108 3300003781 Ga0055536_1052057 Ga0055536_10520571 192
109 3300003791 Ga0055530_10003355 Ga0055530_100033559 192
110 3300003794 Ga0055531_10026708 Ga0055531_100267082 192
111 3300003794 Ga0055531_10053433 Ga0055531_100534332 192
112 3300005336 Ga0070680_100751294 Ga0070680_1007512941 192
113 3300005337 Ga0070682_100223120 Ga0070682_1002231202 192
114 3300005548 Ga0070665_100583679 Ga0070665_1005836792 192
115 3300006051 Ga0075364_10005259 Ga0075364_100052597 192
116 3300015689 Ga0183360_10001 Ga0183360_100012748 192
117 3300025273 Ga0209673_1016931 Ga0209673_10169313 192
118 3300025284 Ga0209130_1009639 Ga0209130_10096392 192
119 3300025291 Ga0209675_1009635 Ga0209675_10096353 192
120 3300025291 Ga0209675_1042019 Ga0209675_10420192 192
121 3300025292 Ga0209676_1001557 Ga0209676_10015572 192
122 3300025292 Ga0209676_1005445 Ga0209676_10054457 192
123 3300025292 Ga0209676_1054366 Ga0209676_10543661 192
124 3300025295 Ga0209564_1006399 Ga0209564_10063997 192
125 3300025297 Ga0209758_1090260 Ga0209758_10902601 192
126 3300025298 Ga0209050_1006874 Ga0209050_10068742 192
127 3300025298 Ga0209050_1048399 Ga0209050_10483992 192
128 3300025299 Ga0209256_1009960 Ga0209256_10099604 192
129 3300025303 Ga0209051_1002516 Ga0209051_100251610 192
130 3300025304 Ga0209257_1000343 Ga0209257_10003436 192
131 3300025304 Ga0209257_1047840 Ga0209257_10478402 192
132 3300025917 Ga0207660_10608191 Ga0207660_106081912 192
133 3300027364 Ga0209967_1002954 Ga0209967_10029543 192
134 3300028379 Ga0268266_10120135 Ga0268266_101201352 192
135 3300031730 Ga0307516_10007119 Ga0307516_1000711917 192
136 3300031852 Ga0307410_10293429 Ga0307410_102934291 192
137 3300031901 Ga0307406_10085207 Ga0307406_100852073 192
138 3300031911 Ga0307412_10323802 Ga0307412_103238022 192
139 3300041451 Ga0451791_1274919 Ga0451791_1274919_237_815 192
140 3300041452 Ga0451793_1712095 Ga0451793_1712095_371_949 192
141 3300041486 Ga0451807_1988829 Ga0451807_1988829_174_755 192
142 3300042007 Ga0439449_0000413 Ga0439449_0000413_12410_12988 192
143 3300042134 Ga0450898_022996 Ga0450898_022996_132_710 192
144 3300042876 Ga0451577_0031713 Ga0451577_0031713_3449_4027 192
145 3300046522 Ga0495643_0063565 Ga0495643_0063565_34_654 192
146 3300046525 Ga0495663_0000627 Ga0495663_0000627_2008_2628 192
147 3300046692 Ga0495671_0096783 Ga0495671_0096783_415_1035 192
148 3300048924 Ga0496121_0040985 Ga0496121_0040985_1456_2034 192
149 3300048925 Ga0496122_0184448 Ga0496122_0184448_98_676 192
150 3300049127 Ga0501306_007573 Ga0501306_007573_238_816 192
151 3300049568 Ga0501031_0003184 Ga0501031_0003184_9912_10490 192
152 3300049569 Ga0501032_0021757 Ga0501032_0021757_412_990 192
153 3300049571 Ga0501034_0009035 Ga0501034_0009035_7262_7885 192
154 3300049571 Ga0501034_0046740 Ga0501034_0046740_1159_1737 192
155 3300049571 Ga0501034_0966985 Ga0501034_0966985_27_605 192
156 3300049572 Ga0501036_0043311 Ga0501036_0043311_2672_3250 192
157 3300049572 Ga0501036_0578104 Ga0501036_0578104_44_667 192
158 3300049573 Ga0501037_0002429 Ga0501037_0002429_5146_5724 192
159 3300049574 Ga0501038_0004283 Ga0501038_0004283_10540_11118 192
160 3300049575 Ga0501039_0020002 Ga0501039_0020002_1935_2513 192
161 3300049579 Ga0501043_0391785 Ga0501043_0391785_128_706 192
162 3300049581 Ga0501047_0060812 Ga0501047_0060812_2809_3387 192
163 3300049589 Ga0501073_0087884 Ga0501073_0087884_1524_2102 192
164 3300049742 Ga0501080_0015994 Ga0501080_0015994_1365_1943 192
165 3300049822 Ga0501035_0028854 Ga0501035_0028854_2975_3553 192
166 3300049823 Ga0501044_0008077 Ga0501044_0008077_10618_11196 192
167 3300050491 nmdc:mga00v17_21547_c1 nmdc:mga00v17_21547_c1_1321_1899 192
168 3300002773 JGI25152J39213_1000480 JGI25152J39213_100048024 193
169 3300002774 JGI25150J39212_1000356 JGI25150J39212_10003563 193
170 3300002774 JGI25150J39212_1001076 JGI25150J39212_10010768 193
171 3300003187 JGI25151J46595_10000924 JGI25151J46595_1000092424 193
172 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050162 193
173 3300003771 Ga0055526_1000124 Ga0055526_10001245 193
174 3300003773 Ga0055537_1000351 Ga0055537_100035131 193
175 3300003775 Ga0055524_1000188 Ga0055524_10001885 193
176 3300003775 Ga0055524_1012221 Ga0055524_10122213 193
177 3300003784 Ga0055534_1000108 Ga0055534_100010853 193
178 3300003790 Ga0055528_1000102 Ga0055528_10001025 193
179 3300003794 Ga0055531_10009978 Ga0055531_100099785 193
180 3300003794 Ga0055531_10022581 Ga0055531_100225812 193
181 3300003794 Ga0055531_10042494 Ga0055531_100424942 193
182 3300003794 Ga0055531_10061109 Ga0055531_100611091 193
183 3300005293 Ga0065715_10122124 Ga0065715_101221243 193
184 3300005293 Ga0065715_10185859 Ga0065715_101858592 193
185 3300005329 Ga0070683_100808040 Ga0070683_1008080401 193
186 3300005331 Ga0070670_100579527 Ga0070670_1005795271 193
187 3300005338 Ga0068868_100387333 Ga0068868_1003873331 193
188 3300005356 Ga0070674_100560787 Ga0070674_1005607872 193
189 3300005364 Ga0070673_100191967 Ga0070673_1001919672 193
190 3300005366 Ga0070659_100389843 Ga0070659_1003898431 193
191 3300005367 Ga0070667_100084950 Ga0070667_1000849503 193
192 3300005435 Ga0070714_100173138 Ga0070714_1001731382 193
193 3300005530 Ga0070679_100055347 Ga0070679_1000553473 193
194 3300005547 Ga0070693_100050744 Ga0070693_1000507443 193
195 3300005618 Ga0068864_100048154 Ga0068864_1000481543 193
196 3300005719 Ga0068861_100184720 Ga0068861_1001847202 193
197 3300005719 Ga0068861_100271269 Ga0068861_1002712692 193
198 3300005841 Ga0068863_100531527 Ga0068863_1005315272 193
199 3300005844 Ga0068862_100083610 Ga0068862_1000836103 193
200 3300010375 Ga0105239_10393874 Ga0105239_103938742 193
201 3300012477 Ga0157336_1001113 Ga0157336_10011132 193
202 3300012482 Ga0157318_1001010 Ga0157318_10010102 193
203 3300012495 Ga0157323_1002283 Ga0157323_10022832 193
204 3300012502 Ga0157347_1020760 Ga0157347_10207602 193
205 3300012508 Ga0157315_1002054 Ga0157315_10020542 193
206 3300012510 Ga0157316_1000607 Ga0157316_10006072 193
207 3300012512 Ga0157327_1001022 Ga0157327_10010222 193
208 3300012515 Ga0157338_1009055 Ga0157338_10090552 193
209 3300013100 Ga0157373_10654777 Ga0157373_106547771 193
210 3300013105 Ga0157369_10040166 Ga0157369_100401666 193
211 3300013297 Ga0157378_10089008 Ga0157378_100890082 193
212 3300014326 Ga0157380_10246581 Ga0157380_102465813 193
213 3300014326 Ga0157380_10514375 Ga0157380_105143752 193
214 3300014326 Ga0157380_10883228 Ga0157380_108832282 193
215 3300014497 Ga0182008_10040297 Ga0182008_100402972 193
216 3300017792 Ga0163161_10109856 Ga0163161_101098563 193
217 3300025245 Ga0207425_1000117 Ga0207425_100011762 193
218 3300025245 Ga0207425_1016989 Ga0207425_10169892 193
219 3300025258 Ga0209129_1000011 Ga0209129_1000011319 193
220 3300025263 Ga0209565_1000001 Ga0209565_10000011125 193
221 3300025273 Ga0209673_1000001 Ga0209673_10000011125 193
222 3300025291 Ga0209675_1000001 Ga0209675_10000011408 193
223 3300025294 Ga0209025_1000002 Ga0209025_1000002479 193
224 3300025294 Ga0209025_1000006 Ga0209025_100000643 193
225 3300025294 Ga0209025_1004073 Ga0209025_10040737 193
226 3300025294 Ga0209025_1084772 Ga0209025_10847722 193
227 3300025294 Ga0209025_1107572 Ga0209025_11075721 193
228 3300025295 Ga0209564_1000001 Ga0209564_10000011570 193
229 3300025297 Ga0209758_1000003 Ga0209758_1000003486 193
230 3300025299 Ga0209256_1000006 Ga0209256_10000066 193
231 3300025299 Ga0209256_1002733 Ga0209256_10027332 193
232 3300025304 Ga0209257_1000567 Ga0209257_100056711 193
233 3300025304 Ga0209257_1000788 Ga0209257_100078845 193
234 3300025304 Ga0209257_1016412 Ga0209257_10164122 193
235 3300025919 Ga0207657_10040428 Ga0207657_100404285 193
236 3300025925 Ga0207650_10171216 Ga0207650_101712162 193
237 3300025925 Ga0207650_10320564 Ga0207650_103205642 193
238 3300025931 Ga0207644_10034788 Ga0207644_100347886 193
239 3300026023 Ga0207677_10034774 Ga0207677_100347745 193
240 3300026041 Ga0207639_10347318 Ga0207639_103473182 193
241 3300026088 Ga0207641_10131242 Ga0207641_101312422 193
242 3300026095 Ga0207676_10091181 Ga0207676_100911812 193
243 3300026116 Ga0207674_10206185 Ga0207674_102061852 193
244 3300026118 Ga0207675_100136230 Ga0207675_1001362302 193
245 3300027360 Ga0209969_1003702 Ga0209969_10037022 193
246 3300027378 Ga0209981_1017045 Ga0209981_10170452 193
247 3300027424 Ga0209984_1008812 Ga0209984_10088122 193
248 3300027471 Ga0209995_1014812 Ga0209995_10148122 193
249 3300027543 Ga0209999_1000513 Ga0209999_10005136 193
250 3300027665 Ga0209983_1003578 Ga0209983_10035786 193
251 3300027665 Ga0209983_1070892 Ga0209983_10708921 193
252 3300027682 Ga0209971_1002324 Ga0209971_10023244 193
253 3300027876 Ga0209974_10036024 Ga0209974_100360242 193
254 3300028379 Ga0268266_10324948 Ga0268266_103249482 193
255 3300028380 Ga0268265_10188059 Ga0268265_101880592 193
256 3300028380 Ga0268265_10189410 Ga0268265_101894102 193
257 3300030733 Ga0314311_1048888 Ga0314311_10488882 193
258 3300030735 Ga0316178_1104819 Ga0316178_11048192 193
259 3300030745 Ga0316182_1135616 Ga0316182_11356161 193
260 3300031456 Ga0307513_10024815 Ga0307513_100248152 193
261 3300031548 Ga0307408_100796263 Ga0307408_1007962631 193
262 3300031665 Ga0316575_10032367 Ga0316575_100323672 193
263 3300031824 Ga0307413_10063997 Ga0307413_100639972 193
264 3300031824 Ga0307413_10214665 Ga0307413_102146652 193
265 3300031901 Ga0307406_10008962 Ga0307406_100089623 193
266 3300031903 Ga0307407_10761000 Ga0307407_107610001 193
267 3300031911 Ga0307412_10057798 Ga0307412_100577982 193
268 3300031911 Ga0307412_10149278 Ga0307412_101492782 193
269 3300031911 Ga0307412_10149760 Ga0307412_101497602 193
270 3300031911 Ga0307412_10317441 Ga0307412_103174412 193
271 3300032004 Ga0307414_10001926 Ga0307414_100019265 193
272 3300032004 Ga0307414_10003486 Ga0307414_100034864 193
273 3300032004 Ga0307414_10265403 Ga0307414_102654032 193
274 3300032004 Ga0307414_10366131 Ga0307414_103661312 193
275 3300032004 Ga0307414_10447479 Ga0307414_104474792 193
276 3300032005 Ga0307411_10177390 Ga0307411_101773902 193
277 3300037312 Ga0395899_0284105 Ga0395899_0284105_176_757 193
278 3300037466 Ga0395898_0129490 Ga0395898_0129490_1354_1935 193
279 3300037466 Ga0395898_0173334 Ga0395898_0173334_1164_1745 193
280 3300037466 Ga0395898_0490245 Ga0395898_0490245_527_1108 193
281 3300037471 Ga0395905_0075829 Ga0395905_0075829_34_615 193
282 3300037471 Ga0395905_0121377 Ga0395905_0121377_1533_2114 193
283 3300037471 Ga0395905_0522526 Ga0395905_0522526_191_772 193
284 3300037471 Ga0395905_0878712 Ga0395905_0878712_184_765 193
285 3300038443 Ga0395901_0092855 Ga0395901_0092855_1303_1884 193
286 3300038705 Ga0237819_00412 Ga0237819_00412_12452_13033 193
287 3300041404 Ga0439436_0005125 Ga0439436_0005125_1266_1847 193
288 3300041404 Ga0439436_0021567 Ga0439436_0021567_355_936 193
289 3300041404 Ga0439436_0022662 Ga0439436_0022662_1227_1808 193
290 3300041404 Ga0439436_0024264 Ga0439436_0024264_1025_1606 193
291 3300041406 Ga0439439_0016836 Ga0439439_0016836_469_1050 193
292 3300041406 Ga0439439_0058408 Ga0439439_0058408_90_671 193
293 3300041407 Ga0439447_002340 Ga0439447_002340_1384_1965 193
294 3300041410 Ga0439461_0130175 Ga0439461_0130175_11_592 193
295 3300041413 Ga0439465_0001938 Ga0439465_0001938_5794_6375 193
296 3300041413 Ga0439465_0011446 Ga0439465_0011446_1345_1926 193
297 3300041413 Ga0439465_0130934 Ga0439465_0130934_35_616 193
298 3300041413 Ga0439465_0233304 Ga0439465_0233304_65_646 193
299 3300041443 Ga0451789_1286101 Ga0451789_1286101_77_658 193
300 3300041486 Ga0451807_0822463 Ga0451807_0822463_355_936 193
301 3300041486 Ga0451807_0904569 Ga0451807_0904569_304_894 193
302 3300041494 Ga0451837_0903999 Ga0451837_0903999_223_819 193
303 3300041999 Ga0439433_0041040 Ga0439433_0041040_200_781 193
304 3300042004 Ga0439445_0014188 Ga0439445_0014188_213_794 193
305 3300042004 Ga0439445_0063262 Ga0439445_0063262_408_989 193
306 3300042006 Ga0439432_015781 Ga0439432_015781_1573_2154 193
307 3300042006 Ga0439432_029707 Ga0439432_029707_299_880 193
308 3300042007 Ga0439449_0005783 Ga0439449_0005783_2184_2765 193
309 3300042007 Ga0439449_0020151 Ga0439449_0020151_542_1123 193
310 3300042007 Ga0439449_0143507 Ga0439449_0143507_32_613 193
311 3300042010 Ga0439452_010124 Ga0439452_010124_2135_2716 193
312 3300042015 Ga0439462_0006706 Ga0439462_0006706_1780_2361 193
313 3300045976 Ga0466967_0869862 Ga0466967_0869862_50_631 193
314 3300046460 Ga0495638_0113775 Ga0495638_0113775_13_594 193
315 3300046460 Ga0495638_0344883 Ga0495638_0344883_17_601 193
316 3300046525 Ga0495663_0095122 Ga0495663_0095122_174_761 193
317 3300046539 Ga0495621_0015980 Ga0495621_0015980_1325_1915 193
318 3300046539 Ga0495621_0094066 Ga0495621_0094066_500_1081 193
319 3300046558 Ga0495633_0007036 Ga0495633_0007036_4991_5572 193
320 3300046615 Ga0495656_0020362 Ga0495656_0020362_850_1431 193
321 3300046615 Ga0495656_0023325 Ga0495656_0023325_1364_1945 193
322 3300046615 Ga0495656_0079486 Ga0495656_0079486_710_1297 193
323 3300046615 Ga0495656_0227955 Ga0495656_0227955_102_689 193
324 3300046616 Ga0495668_0005870 Ga0495668_0005870_7474_8055 193
325 3300046691 Ga0495670_0157301 Ga0495670_0157301_304_885 193
326 3300047318 Ga0495636_0008680 Ga0495636_0008680_1867_2448 193
327 3300047318 Ga0495636_0009214 Ga0495636_0009214_613_1200 193
328 3300047318 Ga0495636_0044848 Ga0495636_0044848_618_1208 193
329 3300047318 Ga0495636_0059910 Ga0495636_0059910_698_1279 193
330 3300047472 Ga0495686_0047803 Ga0495686_0047803_1252_1833 193
331 3300048904 Ga0496101_0136423 Ga0496101_0136423_1232_1819 193
332 3300048904 Ga0496101_0140374 Ga0496101_0140374_493_1074 193
333 3300048905 Ga0496102_0104102 Ga0496102_0104102_938_1525 193
334 3300048909 Ga0496106_0075896 Ga0496106_0075896_1548_2135 193
335 3300048910 Ga0496107_0230674 Ga0496107_0230674_57_644 193
336 3300048912 Ga0496109_0121252 Ga0496109_0121252_390_971 193
337 3300048913 Ga0496110_0453596 Ga0496110_0453596_153_740 193
338 3300048915 Ga0496112_0148083 Ga0496112_0148083_1211_1792 193
339 3300048916 Ga0496113_0040660 Ga0496113_0040660_518_1099 193
340 3300048917 Ga0496114_0014430 Ga0496114_0014430_3785_4372 193
341 3300048921 Ga0496118_0247522 Ga0496118_0247522_110_694 193
342 3300048925 Ga0496122_0032223 Ga0496122_0032223_2530_3111 193
343 3300048929 Ga0496126_0117984 Ga0496126_0117984_337_918 193
344 3300049130 Ga0501310_002906 Ga0501310_002906_989_1570 193
345 3300049569 Ga0501032_0107666 Ga0501032_0107666_82_666 193
346 3300049571 Ga0501034_0591077 Ga0501034_0591077_156_740 193
347 3300049579 Ga0501043_0038380 Ga0501043_0038380_1192_1773 193
348 3300053161 Ga0500634_0016015 Ga0500634_0016015_523_1104 193
349 3300005330 Ga0070690_100015749 Ga0070690_1000157493 194
350 3300005335 Ga0070666_10004410 Ga0070666_100044109 194
351 3300005355 Ga0070671_100012856 Ga0070671_1000128563 194
352 3300005434 Ga0070709_10039793 Ga0070709_100397933 194
353 3300005436 Ga0070713_100037359 Ga0070713_1000373593 194
354 3300005437 Ga0070710_10012772 Ga0070710_100127725 194
355 3300005439 Ga0070711_100391016 Ga0070711_1003910162 194
356 3300005440 Ga0070705_100029117 Ga0070705_1000291172 194
357 3300005456 Ga0070678_100002188 Ga0070678_1000021883 194
358 3300005546 Ga0070696_100297937 Ga0070696_1002979371 194
359 3300005549 Ga0070704_100081076 Ga0070704_1000810763 194
360 3300005614 Ga0068856_100223444 Ga0068856_1002234442 194
361 3300005616 Ga0068852_100017201 Ga0068852_1000172013 194
362 3300005617 Ga0068859_100092261 Ga0068859_1000922612 194
363 3300005718 Ga0068866_10025556 Ga0068866_100255562 194
364 3300005843 Ga0068860_100049203 Ga0068860_1000492032 194
365 3300006163 Ga0070715_10000377 Ga0070715_1000037711 194
366 3300006175 Ga0070712_100014028 Ga0070712_1000140285 194
367 3300006237 Ga0097621_100004496 Ga0097621_1000044968 194
368 3300006358 Ga0068871_100008248 Ga0068871_1000082487 194
369 3300006881 Ga0068865_100045505 Ga0068865_1000455054 194
370 3300006914 Ga0075436_100054620 Ga0075436_1000546201 194
371 3300006931 Ga0097620_100092260 Ga0097620_1000922602 194
372 3300007265 Ga0099794_10217979 Ga0099794_102179791 194
373 3300009093 Ga0105240_10392011 Ga0105240_103920112 194
374 3300009098 Ga0105245_10013508 Ga0105245_100135083 194
375 3300009101 Ga0105247_10053022 Ga0105247_100530223 194
376 3300009174 Ga0105241_10426989 Ga0105241_104269892 194
377 3300009176 Ga0105242_10002609 Ga0105242_100026097 194
378 3300009177 Ga0105248_10060061 Ga0105248_100600612 194
379 3300010159 Ga0099796_10012654 Ga0099796_100126542 194
380 3300010375 Ga0105239_10127578 Ga0105239_101275782 194
381 3300013296 Ga0157374_10002953 Ga0157374_1000295312 194
382 3300013306 Ga0163162_10047440 Ga0163162_100474405 194
383 3300013308 Ga0157375_10237851 Ga0157375_102378512 194
384 3300014968 Ga0157379_10025108 Ga0157379_100251085 194
385 3300021358 Ga0213873_10003266 Ga0213873_100032664 194
386 3300025898 Ga0207692_10023530 Ga0207692_100235302 194
387 3300025899 Ga0207642_10015835 Ga0207642_100158352 194
388 3300025911 Ga0207654_10322270 Ga0207654_103222702 194
389 3300025913 Ga0207695_10185807 Ga0207695_101858072 194
390 3300025915 Ga0207693_10000309 Ga0207693_1000030942 194
391 3300025928 Ga0207700_10035052 Ga0207700_100350522 194
392 3300025931 Ga0207644_10094519 Ga0207644_100945193 194
393 3300025938 Ga0207704_10938006 Ga0207704_109380061 194
394 3300025941 Ga0207711_10255980 Ga0207711_102559802 194
395 3300025986 Ga0207658_10110541 Ga0207658_101105413 194
396 3300026035 Ga0207703_10213118 Ga0207703_102131182 194
397 3300026078 Ga0207702_10058260 Ga0207702_100582602 194
398 3300026088 Ga0207641_10116499 Ga0207641_101164993 194
399 3300026089 Ga0207648_10149870 Ga0207648_101498702 194
400 3300026121 Ga0207683_10002168 Ga0207683_1000216818 194
401 3300026142 Ga0207698_10001409 Ga0207698_100014094 194
402 3300028381 Ga0268264_10074406 Ga0268264_100744065 194
403 3300035089 Ga0373944_0145547 Ga0373944_0145547_201_800 194
404 3300035119 Ga0373956_0242247 Ga0373956_0242247_235_837 194
405 3300035170 Ga0373943_0140555 Ga0373943_0140555_204_806 194
406 3300035172 Ga0373955_0121411 Ga0373955_0121411_41_643 194
407 3300035695 Ga0373927_0010393 Ga0373927_0010393_3425_4027 194
408 3300035725 Ga0373947_0109659 Ga0373947_0109659_1048_1650 194
409 3300036401 Ga0373937_0387507 Ga0373937_0387507_666_1268 194
410 3300037068 Ga0373925_0074520 Ga0373925_0074520_591_1193 194
411 3300039438 Ga0436360_0242755 Ga0436360_0242755_1068_1679 194
412 3300039450 Ga0436363_0272180 Ga0436363_0272180_2991_3620 194
413 3300039450 Ga0436363_0830800 Ga0436363_0830800_933_1544 194
414 3300039453 Ga0436362_0507180 Ga0436362_0507180_894_1505 194
415 3300042876 Ga0451577_0308057 Ga0451577_0308057_748_1335 194
416 3300046472 Ga0495580_0013301 Ga0495580_0013301_4093_4695 194
417 3300046514 Ga0495618_0240838 Ga0495618_0240838_334_936 194
418 3300046516 Ga0495628_0343022 Ga0495628_0343022_282_884 194
419 3300046531 Ga0495665_0053039 Ga0495665_0053039_470_1072 194
420 3300046678 Ga0495599_0259165 Ga0495599_0259165_33_635 194
421 3300048905 Ga0496102_0081654 Ga0496102_0081654_1082_1684 194
422 3300048906 Ga0496103_0060620 Ga0496103_0060620_45_647 194
423 3300048906 Ga0496103_0101642 Ga0496103_0101642_146_745 194
424 3300048907 Ga0496104_0215939 Ga0496104_0215939_1007_1609 194
425 3300048908 Ga0496105_0078549 Ga0496105_0078549_1040_1642 194
426 3300048910 Ga0496107_0038377 Ga0496107_0038377_98_700 194
427 3300048911 Ga0496108_0007461 Ga0496108_0007461_2226_2828 194
428 3300048913 Ga0496110_0006955 Ga0496110_0006955_2053_2655 194
429 3300048914 Ga0496111_0076140 Ga0496111_0076140_1782_2384 194
430 3300048916 Ga0496113_0037719 Ga0496113_0037719_115_717 194
431 3300048917 Ga0496114_0007080 Ga0496114_0007080_5574_6176 194
432 3300048920 Ga0496117_0185003 Ga0496117_0185003_329_928 194
433 3300053078 Ga0495612_0036532 Ga0495612_0036532_246_848 194
434 3300001904 JGI24736J21556_1001487 JGI24736J21556_10014873 195
435 3300001915 JGI24741J21665_1005708 JGI24741J21665_10057082 195
436 3300001979 JGI24740J21852_10012039 JGI24740J21852_100120393 195
437 3300005329 Ga0070683_100015303 Ga0070683_1000153034 195
438 3300005334 Ga0068869_100021838 Ga0068869_1000218381 195
439 3300005336 Ga0070680_100040040 Ga0070680_1000400405 195
440 3300005336 Ga0070680_101141825 Ga0070680_1011418251 195
441 3300005339 Ga0070660_100288604 Ga0070660_1002886042 195
442 3300005339 Ga0070660_100339268 Ga0070660_1003392681 195
443 3300005345 Ga0070692_10000651 Ga0070692_100006516 195
444 3300005366 Ga0070659_100014837 Ga0070659_1000148376 195
445 3300005535 Ga0070684_100004415 Ga0070684_1000044157 195
446 3300005535 Ga0070684_100006211 Ga0070684_1000062112 195
447 3300005543 Ga0070672_100004167 Ga0070672_1000041675 195
448 3300005546 Ga0070696_100121986 Ga0070696_1001219863 195
449 3300005564 Ga0070664_100100573 Ga0070664_1001005732 195
450 3300005577 Ga0068857_100102805 Ga0068857_1001028053 195
451 3300005577 Ga0068857_100133236 Ga0068857_1001332362 195
452 3300005578 Ga0068854_100225912 Ga0068854_1002259121 195
453 3300005578 Ga0068854_100227301 Ga0068854_1002273012 195
454 3300005834 Ga0068851_10062833 Ga0068851_100628332 195
455 3300009093 Ga0105240_11038053 Ga0105240_110380531 195
456 3300009177 Ga0105248_10054518 Ga0105248_100545186 195
457 3300013100 Ga0157373_10002076 Ga0157373_100020766 195
458 3300013102 Ga0157371_10543073 Ga0157371_105430731 195
459 3300013104 Ga0157370_11122369 Ga0157370_111223691 195
460 3300013296 Ga0157374_10456745 Ga0157374_104567452 195
461 3300013307 Ga0157372_10009738 Ga0157372_100097387 195
462 3300013307 Ga0157372_10551623 Ga0157372_105516232 195
463 3300013308 Ga0157375_10008845 Ga0157375_1000884511 195
464 3300020070 Ga0206356_10028907 Ga0206356_100289071 195
465 3300020081 Ga0206354_10060913 Ga0206354_100609132 195
466 3300020082 Ga0206353_10309227 Ga0206353_103092276 195
467 3300020610 Ga0154015_1087267 Ga0154015_10872672 195
468 3300025904 Ga0207647_10000845 Ga0207647_100008459 195
469 3300025904 Ga0207647_10415343 Ga0207647_104153431 195
470 3300025909 Ga0207705_10002560 Ga0207705_100025605 195
471 3300025909 Ga0207705_10044506 Ga0207705_100445061 195
472 3300025912 Ga0207707_10000184 Ga0207707_1000018440 195
473 3300025912 Ga0207707_10002500 Ga0207707_100025009 195
474 3300025913 Ga0207695_10022985 Ga0207695_100229853 195
475 3300025913 Ga0207695_10046420 Ga0207695_100464205 195
476 3300025917 Ga0207660_10002616 Ga0207660_100026169 195
477 3300025917 Ga0207660_10015330 Ga0207660_100153305 195
478 3300025919 Ga0207657_10168905 Ga0207657_101689052 195
479 3300025919 Ga0207657_10183155 Ga0207657_101831552 195
480 3300025920 Ga0207649_10004358 Ga0207649_100043583 195
481 3300025920 Ga0207649_10014225 Ga0207649_100142252 195
482 3300025921 Ga0207652_10004286 Ga0207652_100042867 195
483 3300025921 Ga0207652_10014993 Ga0207652_100149935 195
484 3300025932 Ga0207690_10165365 Ga0207690_101653652 195
485 3300025940 Ga0207691_10206802 Ga0207691_102068022 195
486 3300025941 Ga0207711_10016115 Ga0207711_100161155 195
487 3300025942 Ga0207689_10175963 Ga0207689_101759632 195
488 3300025944 Ga0207661_10002037 Ga0207661_100020378 195
489 3300025944 Ga0207661_10194099 Ga0207661_101940991 195
490 3300025949 Ga0207667_10014147 Ga0207667_100141476 195
491 3300025949 Ga0207667_10052651 Ga0207667_100526511 195
492 3300025981 Ga0207640_10002439 Ga0207640_100024394 195
493 3300025981 Ga0207640_10016624 Ga0207640_100166241 195
494 3300026041 Ga0207639_10061352 Ga0207639_100613521 195
495 3300026041 Ga0207639_10192383 Ga0207639_101923832 195
496 3300026067 Ga0207678_10193364 Ga0207678_101933641 195
497 3300026067 Ga0207678_10200512 Ga0207678_102005121 195
498 3300026078 Ga0207702_10001953 Ga0207702_1000195315 195
499 3300026078 Ga0207702_10280769 Ga0207702_102807692 195
500 3300026116 Ga0207674_10012399 Ga0207674_100123995 195
501 3300026116 Ga0207674_10090054 Ga0207674_100900543 195
502 3300026142 Ga0207698_10002115 Ga0207698_100021152 195
503 3300026142 Ga0207698_11208195 Ga0207698_112081952 195
504 3300049585 Ga0501069_0226222 Ga0501069_0226222_76_687 195
505 3300049586 Ga0501070_0004462 Ga0501070_0004462_1209_1820 195
506 3300049586 Ga0501070_0102516 Ga0501070_0102516_1697_2293 195
507 3300049586 Ga0501070_0323831 Ga0501070_0323831_474_1061 195
508 3300049593 Ga0501077_0012889 Ga0501077_0012889_2029_2616 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

20

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.965 1 190
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9639 4 193
8axp-assembly1.cif.gz_B neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. 0.9616 3 190
4qd3-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from pseudomonas aeruginosa with 5-azacytidine at 1.89 angstrom resolution 0.9613 1 191
6ix6-assembly1.cif.gz_A crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution 0.9613 4 190
ID Description Score Start End Superfamily
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9602 2 188 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9552 2 188 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.95 1 188 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9303 4 190 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9294 58 190 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A377E4Z3-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9867 3 107 GO:0004045
AF-A0A5C7PWZ3-F1-model_v4 Peptidyl-tRNA hydrolase 0.9854 3 105 GO:0004045
AF-A0A2J4V7Z6-F1-model_v4 deleted 0.9814 3 164
AF-A0A1G0GLW4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.981 1 190 GO:0004045
GO:0005737
GO:0006412
AF-A0A1E5JVW5-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9767 47 190 GO:0004045

Feature Viewer

pLDDT pTM Quality
93.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map