F456802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 508 | 338 | 481 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10054518|Ga0105248_100545186 |
| Length | 216 |
| Sequence | VPVDAGVGARLLAAMPALRLIVGLGNPGPDYARTRHNAGFWWIDALAEQVGARFGIDSKLQAESAKVVIGGEPVMLLRPLTFMNHSGRAVNAALRYWKIEPEQMLVAHDELDLPPGTARLKFDGGHGGQNGLRDIVALLGHGKFHRLRIGIGHPGHKDKVTPWVLGRPGRDDEAAMLRAIDDALAVLPLAVAGDTNEAMKRLHTKAADREQGTGNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 8 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 9 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 10 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 13 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 14 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 15 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 16 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 19 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 20 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 21 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 22 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 23 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 24 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 25 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 26 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 29 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 106 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 107 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 108 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 111 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 197 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 198 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 203 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 206 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 237 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 238 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 239 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 254 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 336 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 338 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.11 |
| Metatranscriptomes | 1.57 |
| Isolates | 5.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.2 |
| Nodule | 0 |
| Rhizoplane | 6.1 |
| Rhizosphere | 74.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001487 | 3300001904 | Bacteria | 4286 |
| 2 | JGI24736J21556_1001801 | 3300001904 | Bacteria | 3846 |
| 3 | JGI24741J21665_1005708 | 3300001915 | Bacteria | 2568 |
| 4 | JGI24740J21852_10012039 | 3300001979 | Bacteria | 3271 |
| 5 | JGI24738J21930_10000208 | 3300002075 | Bacteria | 15688 |
| 6 | JGI25152J39213_1000480 | 3300002773 | Bacteria | 22834 |
| 7 | JGI25150J39212_1000356 | 3300002774 | Bacteria | 22473 |
| 8 | JGI25150J39212_1001076 | 3300002774 | Bacteria | 8305 |
| 9 | JGI25151J46595_10000924 | 3300003187 | Bacteria | 22834 |
| 10 | JGI25153J46596_10000050 | 3300003215 | Bacteria | 140710 |
| 11 | Ga0055526_1000124 | 3300003771 | Bacteria | 68139 |
| 12 | Ga0055526_1007780 | 3300003771 | Bacteria | 5497 |
| 13 | Ga0055537_1000351 | 3300003773 | Bacteria | 31332 |
| 14 | Ga0055524_1000188 | 3300003775 | Bacteria | 68244 |
| 15 | Ga0055524_1012221 | 3300003775 | Bacteria | 3308 |
| 16 | Ga0055524_1037152 | 3300003775 | Bacteria | 1296 |
| 17 | Ga0055536_1052057 | 3300003781 | Bacteria | 894 |
| 18 | Ga0055534_1000108 | 3300003784 | Bacteria | 61496 |
| 19 | Ga0055528_1000102 | 3300003790 | Bacteria | 68139 |
| 20 | Ga0055530_10003355 | 3300003791 | Bacteria | 9178 |
| 21 | Ga0055531_10009978 | 3300003794 | Bacteria | 4787 |
| 22 | Ga0055531_10022581 | 3300003794 | Bacteria | 2392 |
| 23 | Ga0055531_10026708 | 3300003794 | Bacteria | 2049 |
| 24 | Ga0055531_10042494 | 3300003794 | Bacteria | 1299 |
| 25 | Ga0055531_10053433 | 3300003794 | Bacteria | 1043 |
| 26 | Ga0055531_10061109 | 3300003794 | Bacteria | 920 |
| 27 | Ga0065715_10122124 | 3300005293 | Bacteria | 2213 |
| 28 | Ga0065715_10185859 | 3300005293 | Bacteria | 1446 |
| 29 | Ga0070683_100015303 | 3300005329 | Bacteria | 6735 |
| 30 | Ga0070683_100808040 | 3300005329 | Bacteria | 899 |
| 31 | Ga0070690_100015749 | 3300005330 | Bacteria | 4518 |
| 32 | Ga0070670_100579527 | 3300005331 | Bacteria | 1003 |
| 33 | Ga0068869_100021838 | 3300005334 | Bacteria | 4404 |
| 34 | Ga0070666_10004410 | 3300005335 | Bacteria | 8570 |
| 35 | Ga0070680_100040040 | 3300005336 | Bacteria | 3792 |
| 36 | Ga0070680_100751294 | 3300005336 | Bacteria | 840 |
| 37 | Ga0070680_101141825 | 3300005336 | Bacteria | 673 |
| 38 | Ga0070682_100223120 | 3300005337 | Bacteria | 1343 |
| 39 | Ga0068868_100387333 | 3300005338 | Bacteria | 1204 |
| 40 | Ga0070660_100288604 | 3300005339 | Bacteria | 1343 |
| 41 | Ga0070660_100339268 | 3300005339 | Bacteria | 1236 |
| 42 | Ga0070661_100302959 | 3300005344 | Bacteria | 1244 |
| 43 | Ga0070692_10000651 | 3300005345 | Bacteria | 11020 |
| 44 | Ga0070671_100012856 | 3300005355 | Bacteria | 6750 |
| 45 | Ga0070674_100560787 | 3300005356 | Bacteria | 960 |
| 46 | Ga0070673_100191967 | 3300005364 | Bacteria | 1755 |
| 47 | Ga0070659_100014837 | 3300005366 | Bacteria | 5826 |
| 48 | Ga0070659_100389843 | 3300005366 | Bacteria | 1174 |
| 49 | Ga0070667_100084950 | 3300005367 | Bacteria | 2714 |
| 50 | Ga0070709_10039793 | 3300005434 | Bacteria | 2887 |
| 51 | Ga0070714_100173138 | 3300005435 | Bacteria | 1960 |
| 52 | Ga0070713_100037359 | 3300005436 | Bacteria | 3926 |
| 53 | Ga0070710_10012772 | 3300005437 | Bacteria | 4182 |
| 54 | Ga0070711_100391016 | 3300005439 | Bacteria | 1127 |
| 55 | Ga0070705_100029117 | 3300005440 | Bacteria | 3033 |
| 56 | Ga0070678_100002188 | 3300005456 | Bacteria | 10626 |
| 57 | Ga0070679_100055347 | 3300005530 | Bacteria | 3950 |
| 58 | Ga0070684_100004415 | 3300005535 | Bacteria | 10705 |
| 59 | Ga0070684_100006211 | 3300005535 | Bacteria | 9221 |
| 60 | Ga0070672_100004167 | 3300005543 | Bacteria | 9437 |
| 61 | Ga0070696_100121986 | 3300005546 | Bacteria | 1887 |
| 62 | Ga0070696_100297937 | 3300005546 | Bacteria | 1234 |
| 63 | Ga0070693_100050744 | 3300005547 | Bacteria | 2373 |
| 64 | Ga0070665_100583679 | 3300005548 | Bacteria | 1130 |
| 65 | Ga0070704_100081076 | 3300005549 | Bacteria | 2389 |
| 66 | Ga0070664_100100573 | 3300005564 | Bacteria | 2514 |
| 67 | Ga0068857_100102805 | 3300005577 | Bacteria | 2565 |
| 68 | Ga0068857_100133236 | 3300005577 | Bacteria | 2242 |
| 69 | Ga0068854_100225912 | 3300005578 | Bacteria | 1483 |
| 70 | Ga0068854_100227301 | 3300005578 | Bacteria | 1479 |
| 71 | Ga0068856_100000022 | 3300005614 | Bacteria | 142768 |
| 72 | Ga0068856_100223444 | 3300005614 | Bacteria | 1898 |
| 73 | Ga0068852_100017201 | 3300005616 | Bacteria | 5668 |
| 74 | Ga0068859_100092261 | 3300005617 | Bacteria | 3080 |
| 75 | Ga0068864_100048154 | 3300005618 | Bacteria | 3663 |
| 76 | Ga0068866_10025556 | 3300005718 | Bacteria | 2777 |
| 77 | Ga0068861_100184720 | 3300005719 | Bacteria | 1738 |
| 78 | Ga0068861_100271269 | 3300005719 | Bacteria | 1457 |
| 79 | Ga0068851_10062833 | 3300005834 | Bacteria | 1906 |
| 80 | Ga0068863_100531527 | 3300005841 | Bacteria | 1160 |
| 81 | Ga0068860_100049203 | 3300005843 | Bacteria | 4016 |
| 82 | Ga0068862_100083610 | 3300005844 | Bacteria | 2772 |
| 83 | Ga0075364_10005259 | 3300006051 | Bacteria | 7512 |
| 84 | Ga0070715_10000377 | 3300006163 | Bacteria | 11155 |
| 85 | Ga0070712_100014028 | 3300006175 | Bacteria | 5136 |
| 86 | Ga0097621_100004496 | 3300006237 | Bacteria | 9723 |
| 87 | Ga0068871_100008248 | 3300006358 | Bacteria | 7488 |
| 88 | Ga0068865_100045505 | 3300006881 | Bacteria | 3009 |
| 89 | Ga0075436_100054620 | 3300006914 | Bacteria | 2758 |
| 90 | Ga0097620_100092260 | 3300006931 | Bacteria | 3080 |
| 91 | Ga0099794_10217979 | 3300007265 | Bacteria | 980 |
| 92 | Ga0105240_10392011 | 3300009093 | Bacteria | 1566 |
| 93 | Ga0105240_11038053 | 3300009093 | Bacteria | 875 |
| 94 | Ga0105245_10013508 | 3300009098 | Bacteria | 7111 |
| 95 | Ga0105247_10053022 | 3300009101 | Bacteria | 2501 |
| 96 | Ga0105241_10426989 | 3300009174 | Bacteria | 1168 |
| 97 | Ga0105242_10002609 | 3300009176 | Bacteria | 14132 |
| 98 | Ga0105248_10054518 | 3300009177 | Bacteria | 4483 |
| 99 | Ga0105248_10060061 | 3300009177 | Bacteria | 4268 |
| 100 | Ga0099796_10012654 | 3300010159 | Bacteria | 2389 |
| 101 | Ga0105239_10127578 | 3300010375 | Bacteria | 2828 |
| 102 | Ga0105239_10393874 | 3300010375 | Bacteria | 1567 |
| 103 | Ga0157336_1001113 | 3300012477 | Bacteria | 1344 |
| 104 | Ga0157318_1001010 | 3300012482 | Bacteria | 1344 |
| 105 | Ga0157323_1002283 | 3300012495 | Bacteria | 1053 |
| 106 | Ga0157347_1020760 | 3300012502 | Bacteria | 768 |
| 107 | Ga0157315_1002054 | 3300012508 | Bacteria | 1211 |
| 108 | Ga0157316_1000607 | 3300012510 | Bacteria | 1941 |
| 109 | Ga0157327_1001022 | 3300012512 | Bacteria | 1661 |
| 110 | Ga0157327_1011044 | 3300012512 | Bacteria | 865 |
| 111 | Ga0157338_1009055 | 3300012515 | Bacteria | 978 |
| 112 | Ga0157373_10002076 | 3300013100 | Bacteria | 15179 |
| 113 | Ga0157373_10654777 | 3300013100 | Bacteria | 767 |
| 114 | Ga0157371_10543073 | 3300013102 | Bacteria | 861 |
| 115 | Ga0157370_10000272 | 3300013104 | Bacteria | 65739 |
| 116 | Ga0157370_10022679 | 3300013104 | Bacteria | 6247 |
| 117 | Ga0157370_11122369 | 3300013104 | Bacteria | 710 |
| 118 | Ga0157369_10000706 | 3300013105 | Bacteria | 43083 |
| 119 | Ga0157369_10040166 | 3300013105 | Bacteria | 5109 |
| 120 | Ga0157369_10056779 | 3300013105 | Bacteria | 4224 |
| 121 | Ga0157374_10002953 | 3300013296 | Bacteria | 14242 |
| 122 | Ga0157374_10456745 | 3300013296 | Bacteria | 1279 |
| 123 | Ga0157378_10089008 | 3300013297 | Bacteria | 2803 |
| 124 | Ga0163162_10047440 | 3300013306 | Bacteria | 4305 |
| 125 | Ga0157372_10009738 | 3300013307 | Bacteria | 10220 |
| 126 | Ga0157372_10551623 | 3300013307 | Bacteria | 1343 |
| 127 | Ga0157375_10008845 | 3300013308 | Bacteria | 8819 |
| 128 | Ga0157375_10237851 | 3300013308 | Bacteria | 1980 |
| 129 | Ga0157380_10246581 | 3300014326 | Bacteria | 1614 |
| 130 | Ga0157380_10514375 | 3300014326 | Bacteria | 1166 |
| 131 | Ga0157380_10883228 | 3300014326 | Bacteria | 919 |
| 132 | Ga0182008_10040297 | 3300014497 | Bacteria | 2332 |
| 133 | Ga0157379_10025108 | 3300014968 | Bacteria | 5291 |
| 134 | Ga0182006_1000563 | 3300015261 | Bacteria | 27731 |
| 135 | Ga0182005_1000362 | 3300015265 | Bacteria | 25350 |
| 136 | Ga0182005_1002947 | 3300015265 | Bacteria | 5900 |
| 137 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 138 | Ga0163161_10109856 | 3300017792 | Bacteria | 2060 |
| 139 | Ga0206356_10028907 | 3300020070 | Bacteria | 2827 |
| 140 | Ga0206354_10060913 | 3300020081 | Bacteria | 6183 |
| 141 | Ga0206353_10309227 | 3300020082 | Bacteria | 4028 |
| 142 | Ga0154015_1087267 | 3300020610 | Bacteria | 5918 |
| 143 | Ga0213873_10003266 | 3300021358 | Bacteria | 2905 |
| 144 | Ga0207425_1000117 | 3300025245 | Bacteria | 74911 |
| 145 | Ga0207425_1016989 | 3300025245 | Bacteria | 1607 |
| 146 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 147 | Ga0209129_1003121 | 3300025258 | Bacteria | 7444 |
| 148 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 149 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 150 | Ga0209673_1016931 | 3300025273 | Bacteria | 2705 |
| 151 | Ga0209130_1009639 | 3300025284 | Bacteria | 2731 |
| 152 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 153 | Ga0209675_1009635 | 3300025291 | Bacteria | 3390 |
| 154 | Ga0209675_1042019 | 3300025291 | Bacteria | 993 |
| 155 | Ga0209676_1001557 | 3300025292 | Bacteria | 20542 |
| 156 | Ga0209676_1005445 | 3300025292 | Bacteria | 6651 |
| 157 | Ga0209676_1054366 | 3300025292 | Bacteria | 1032 |
| 158 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 159 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 160 | Ga0209025_1004073 | 3300025294 | Bacteria | 13042 |
| 161 | Ga0209025_1084772 | 3300025294 | Bacteria | 1060 |
| 162 | Ga0209025_1107572 | 3300025294 | Bacteria | 865 |
| 163 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 164 | Ga0209564_1006399 | 3300025295 | Bacteria | 6362 |
| 165 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 166 | Ga0209758_1090260 | 3300025297 | Bacteria | 899 |
| 167 | Ga0209050_1006874 | 3300025298 | Bacteria | 6600 |
| 168 | Ga0209050_1048399 | 3300025298 | Bacteria | 1099 |
| 169 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 170 | Ga0209256_1002733 | 3300025299 | Bacteria | 13643 |
| 171 | Ga0209256_1009960 | 3300025299 | Bacteria | 4069 |
| 172 | Ga0209256_1014424 | 3300025299 | Bacteria | 2844 |
| 173 | Ga0209051_1002516 | 3300025303 | Bacteria | 13004 |
| 174 | Ga0209257_1000343 | 3300025304 | Bacteria | 96876 |
| 175 | Ga0209257_1000567 | 3300025304 | Bacteria | 62634 |
| 176 | Ga0209257_1000788 | 3300025304 | Bacteria | 46352 |
| 177 | Ga0209257_1016412 | 3300025304 | Bacteria | 2997 |
| 178 | Ga0209257_1047840 | 3300025304 | Bacteria | 1227 |
| 179 | Ga0207692_10023530 | 3300025898 | Bacteria | 2850 |
| 180 | Ga0207642_10015835 | 3300025899 | Bacteria | 2823 |
| 181 | Ga0207647_10000415 | 3300025904 | Bacteria | 35115 |
| 182 | Ga0207647_10000845 | 3300025904 | Bacteria | 23756 |
| 183 | Ga0207647_10415343 | 3300025904 | Bacteria | 757 |
| 184 | Ga0207705_10002560 | 3300025909 | Bacteria | 13984 |
| 185 | Ga0207705_10044506 | 3300025909 | Bacteria | 3190 |
| 186 | Ga0207654_10322270 | 3300025911 | Bacteria | 1057 |
| 187 | Ga0207707_10000184 | 3300025912 | Bacteria | 65784 |
| 188 | Ga0207707_10002500 | 3300025912 | Bacteria | 16548 |
| 189 | Ga0207695_10022985 | 3300025913 | Bacteria | 7061 |
| 190 | Ga0207695_10046420 | 3300025913 | Bacteria | 4605 |
| 191 | Ga0207695_10185807 | 3300025913 | Bacteria | 1997 |
| 192 | Ga0207693_10000309 | 3300025915 | Bacteria | 45500 |
| 193 | Ga0207660_10002616 | 3300025917 | Bacteria | 11814 |
| 194 | Ga0207660_10015330 | 3300025917 | Bacteria | 5056 |
| 195 | Ga0207660_10608191 | 3300025917 | Bacteria | 890 |
| 196 | Ga0207657_10040428 | 3300025919 | Bacteria | 4132 |
| 197 | Ga0207657_10168905 | 3300025919 | Bacteria | 1773 |
| 198 | Ga0207657_10183155 | 3300025919 | Bacteria | 1692 |
| 199 | Ga0207649_10004358 | 3300025920 | Bacteria | 7681 |
| 200 | Ga0207649_10014225 | 3300025920 | Bacteria | 4452 |
| 201 | Ga0207649_10193751 | 3300025920 | Bacteria | 1431 |
| 202 | Ga0207652_10004286 | 3300025921 | Bacteria | 11635 |
| 203 | Ga0207652_10014993 | 3300025921 | Bacteria | 6287 |
| 204 | Ga0207646_10586587 | 3300025922 | Unclassified | 1001 |
| 205 | Ga0207650_10171216 | 3300025925 | Bacteria | 1726 |
| 206 | Ga0207650_10320564 | 3300025925 | Bacteria | 1269 |
| 207 | Ga0207700_10035052 | 3300025928 | Bacteria | 3610 |
| 208 | Ga0207644_10034788 | 3300025931 | Bacteria | 3526 |
| 209 | Ga0207644_10094519 | 3300025931 | Bacteria | 2233 |
| 210 | Ga0207690_10165365 | 3300025932 | Bacteria | 1653 |
| 211 | Ga0207704_10938006 | 3300025938 | Bacteria | 729 |
| 212 | Ga0207691_10206802 | 3300025940 | Bacteria | 1706 |
| 213 | Ga0207711_10016115 | 3300025941 | Bacteria | 6203 |
| 214 | Ga0207711_10255980 | 3300025941 | Bacteria | 1608 |
| 215 | Ga0207689_10175963 | 3300025942 | Bacteria | 1764 |
| 216 | Ga0207661_10002037 | 3300025944 | Bacteria | 13942 |
| 217 | Ga0207661_10194099 | 3300025944 | Bacteria | 1781 |
| 218 | Ga0207667_10014147 | 3300025949 | Bacteria | 9108 |
| 219 | Ga0207667_10052651 | 3300025949 | Bacteria | 4285 |
| 220 | Ga0207640_10002439 | 3300025981 | Bacteria | 9946 |
| 221 | Ga0207640_10016624 | 3300025981 | Bacteria | 4285 |
| 222 | Ga0207658_10110541 | 3300025986 | Bacteria | 2171 |
| 223 | Ga0207677_10034774 | 3300026023 | Bacteria | 3266 |
| 224 | Ga0207703_10213118 | 3300026035 | Bacteria | 1723 |
| 225 | Ga0207639_10061352 | 3300026041 | Bacteria | 2904 |
| 226 | Ga0207639_10192383 | 3300026041 | Bacteria | 1743 |
| 227 | Ga0207639_10347318 | 3300026041 | Bacteria | 1324 |
| 228 | Ga0207678_10193364 | 3300026067 | Bacteria | 1739 |
| 229 | Ga0207678_10200512 | 3300026067 | Bacteria | 1706 |
| 230 | Ga0207678_10383081 | 3300026067 | Bacteria | 1216 |
| 231 | Ga0207702_10000852 | 3300026078 | Bacteria | 31897 |
| 232 | Ga0207702_10001953 | 3300026078 | Bacteria | 20099 |
| 233 | Ga0207702_10058260 | 3300026078 | Bacteria | 3287 |
| 234 | Ga0207702_10280769 | 3300026078 | Bacteria | 1574 |
| 235 | Ga0207641_10116499 | 3300026088 | Bacteria | 2377 |
| 236 | Ga0207641_10131242 | 3300026088 | Bacteria | 2250 |
| 237 | Ga0207648_10149870 | 3300026089 | Bacteria | 2058 |
| 238 | Ga0207676_10091181 | 3300026095 | Bacteria | 2503 |
| 239 | Ga0207674_10012399 | 3300026116 | Bacteria | 9530 |
| 240 | Ga0207674_10090054 | 3300026116 | Bacteria | 3059 |
| 241 | Ga0207674_10206185 | 3300026116 | Bacteria | 1915 |
| 242 | Ga0207675_100136230 | 3300026118 | Bacteria | 2330 |
| 243 | Ga0207683_10002168 | 3300026121 | Bacteria | 17238 |
| 244 | Ga0207698_10001409 | 3300026142 | Bacteria | 13947 |
| 245 | Ga0207698_10002115 | 3300026142 | Bacteria | 11711 |
| 246 | Ga0207698_11208195 | 3300026142 | Bacteria | 770 |
| 247 | Ga0209969_1003702 | 3300027360 | Bacteria | 2121 |
| 248 | Ga0209967_1002954 | 3300027364 | Bacteria | 2226 |
| 249 | Ga0209981_1017045 | 3300027378 | Bacteria | 1024 |
| 250 | Ga0209984_1008812 | 3300027424 | Bacteria | 1274 |
| 251 | Ga0209995_1014812 | 3300027471 | Bacteria | 1279 |
| 252 | Ga0209999_1000513 | 3300027543 | Bacteria | 6040 |
| 253 | Ga0209983_1003578 | 3300027665 | Bacteria | 3297 |
| 254 | Ga0209983_1070892 | 3300027665 | Bacteria | 777 |
| 255 | Ga0209971_1002324 | 3300027682 | Bacteria | 4597 |
| 256 | Ga0209974_10036024 | 3300027876 | Bacteria | 1643 |
| 257 | Ga0268266_10120135 | 3300028379 | Bacteria | 2338 |
| 258 | Ga0268266_10324948 | 3300028379 | Bacteria | 1441 |
| 259 | Ga0268265_10188059 | 3300028380 | Bacteria | 1781 |
| 260 | Ga0268265_10189410 | 3300028380 | Bacteria | 1775 |
| 261 | Ga0268264_10074406 | 3300028381 | Bacteria | 2885 |
| 262 | Ga0314311_1048888 | 3300030733 | Bacteria | 1952 |
| 263 | Ga0316178_1104819 | 3300030735 | Bacteria | 3410 |
| 264 | Ga0316182_1135616 | 3300030745 | Bacteria | 769 |
| 265 | Ga0307513_10024815 | 3300031456 | Bacteria | 6969 |
| 266 | Ga0307509_10189456 | 3300031507 | Bacteria | 1910 |
| 267 | Ga0307408_100796263 | 3300031548 | Bacteria | 857 |
| 268 | Ga0316575_10032367 | 3300031665 | Bacteria | 2048 |
| 269 | Ga0316579_10286380 | 3300031691 | Bacteria | 796 |
| 270 | Ga0316576_10110908 | 3300031727 | Bacteria | 2056 |
| 271 | Ga0316578_10049276 | 3300031728 | Bacteria | 2461 |
| 272 | Ga0307516_10007119 | 3300031730 | Bacteria | 12924 |
| 273 | Ga0307405_10592663 | 3300031731 | Bacteria | 903 |
| 274 | Ga0307413_10063997 | 3300031824 | Bacteria | 2283 |
| 275 | Ga0307413_10214665 | 3300031824 | Bacteria | 1400 |
| 276 | Ga0307410_10293429 | 3300031852 | Bacteria | 1280 |
| 277 | Ga0307406_10008962 | 3300031901 | Bacteria | 5594 |
| 278 | Ga0307406_10085207 | 3300031901 | Bacteria | 2112 |
| 279 | Ga0307406_10398950 | 3300031901 | Bacteria | 1090 |
| 280 | Ga0307407_10761000 | 3300031903 | Bacteria | 734 |
| 281 | Ga0307412_10001032 | 3300031911 | Bacteria | 15910 |
| 282 | Ga0307412_10057798 | 3300031911 | Bacteria | 2591 |
| 283 | Ga0307412_10149278 | 3300031911 | Bacteria | 1722 |
| 284 | Ga0307412_10149760 | 3300031911 | Bacteria | 1720 |
| 285 | Ga0307412_10317441 | 3300031911 | Bacteria | 1238 |
| 286 | Ga0307412_10323802 | 3300031911 | Bacteria | 1227 |
| 287 | Ga0307412_11017345 | 3300031911 | Bacteria | 733 |
| 288 | Ga0307414_10001926 | 3300032004 | Bacteria | 10746 |
| 289 | Ga0307414_10003486 | 3300032004 | Bacteria | 8405 |
| 290 | Ga0307414_10265403 | 3300032004 | Bacteria | 1435 |
| 291 | Ga0307414_10366131 | 3300032004 | Bacteria | 1242 |
| 292 | Ga0307414_10447479 | 3300032004 | Bacteria | 1132 |
| 293 | Ga0307411_10177390 | 3300032005 | Bacteria | 1613 |
| 294 | Ga0307415_100223269 | 3300032126 | Bacteria | 1512 |
| 295 | Ga0316593_10126920 | 3300032168 | Bacteria | 919 |
| 296 | Ga0316596_1026026 | 3300033541 | Bacteria | 1507 |
| 297 | Ga0373944_0145547 | 3300035089 | Bacteria | 832 |
| 298 | Ga0373956_0242247 | 3300035119 | Bacteria | 857 |
| 299 | Ga0373943_0140555 | 3300035170 | Bacteria | 1300 |
| 300 | Ga0373955_0121411 | 3300035172 | Bacteria | 1519 |
| 301 | Ga0316574_0134170 | 3300035398 | Bacteria | 1594 |
| 302 | Ga0373927_0010393 | 3300035695 | Bacteria | 6211 |
| 303 | Ga0373947_0109659 | 3300035725 | Bacteria | 1743 |
| 304 | Ga0373937_0387507 | 3300036401 | Bacteria | 1326 |
| 305 | Ga0316582_0041767 | 3300036647 | Bacteria | 2868 |
| 306 | Ga0373925_0074520 | 3300037068 | Bacteria | 2571 |
| 307 | Ga0395899_0284105 | 3300037312 | Bacteria | 1125 |
| 308 | Ga0395898_0129490 | 3300037466 | Bacteria | 2418 |
| 309 | Ga0395898_0173334 | 3300037466 | Bacteria | 2062 |
| 310 | Ga0395898_0490245 | 3300037466 | Bacteria | 1169 |
| 311 | Ga0395905_0075829 | 3300037471 | Bacteria | 3152 |
| 312 | Ga0395905_0121377 | 3300037471 | Bacteria | 2456 |
| 313 | Ga0395905_0522526 | 3300037471 | Bacteria | 1087 |
| 314 | Ga0395905_0878712 | 3300037471 | Bacteria | 799 |
| 315 | Ga0395901_0092855 | 3300038443 | Bacteria | 3159 |
| 316 | Ga0237819_00412 | 3300038705 | Bacteria | 14816 |
| 317 | Ga0436360_0242755 | 3300039438 | Bacteria | 1916 |
| 318 | Ga0436363_0272180 | 3300039450 | Bacteria | 5607 |
| 319 | Ga0436363_0830800 | 3300039450 | Bacteria | 8859 |
| 320 | Ga0436362_0507180 | 3300039453 | Bacteria | 3374 |
| 321 | Ga0439436_0000109 | 3300041404 | Bacteria | 19183 |
| 322 | Ga0439436_0005125 | 3300041404 | Bacteria | 4016 |
| 323 | Ga0439436_0021567 | 3300041404 | Bacteria | 1913 |
| 324 | Ga0439436_0022662 | 3300041404 | Bacteria | 1860 |
| 325 | Ga0439436_0024264 | 3300041404 | Bacteria | 1791 |
| 326 | Ga0439439_0016836 | 3300041406 | Bacteria | 1793 |
| 327 | Ga0439439_0058408 | 3300041406 | Bacteria | 1021 |
| 328 | Ga0439447_002340 | 3300041407 | Bacteria | 6931 |
| 329 | Ga0439461_0130175 | 3300041410 | Bacteria | 636 |
| 330 | Ga0439465_0001938 | 3300041413 | Bacteria | 6788 |
| 331 | Ga0439465_0011446 | 3300041413 | Bacteria | 2784 |
| 332 | Ga0439465_0130934 | 3300041413 | Bacteria | 885 |
| 333 | Ga0439465_0233304 | 3300041413 | Bacteria | 677 |
| 334 | Ga0451789_1286101 | 3300041443 | Bacteria | 1268 |
| 335 | Ga0451791_1274919 | 3300041451 | Bacteria | 1210 |
| 336 | Ga0451793_1712095 | 3300041452 | Bacteria | 1233 |
| 337 | Ga0451795_1416188 | 3300041456 | Unclassified | 1010 |
| 338 | Ga0451807_0822463 | 3300041486 | Bacteria | 1288 |
| 339 | Ga0451807_0904569 | 3300041486 | Bacteria | 979 |
| 340 | Ga0451807_1988829 | 3300041486 | Bacteria | 1553 |
| 341 | Ga0451837_0903999 | 3300041494 | Bacteria | 973 |
| 342 | Ga0439433_0041040 | 3300041999 | Bacteria | 1077 |
| 343 | Ga0439445_0014188 | 3300042004 | Bacteria | 1937 |
| 344 | Ga0439445_0060348 | 3300042004 | Bacteria | 1036 |
| 345 | Ga0439445_0063262 | 3300042004 | Bacteria | 1014 |
| 346 | Ga0439432_015781 | 3300042006 | Bacteria | 2546 |
| 347 | Ga0439432_029707 | 3300042006 | Bacteria | 1775 |
| 348 | Ga0439449_0000413 | 3300042007 | Bacteria | 15802 |
| 349 | Ga0439449_0005783 | 3300042007 | Bacteria | 4731 |
| 350 | Ga0439449_0020151 | 3300042007 | Bacteria | 2499 |
| 351 | Ga0439449_0143507 | 3300042007 | Bacteria | 889 |
| 352 | Ga0439452_010124 | 3300042010 | Bacteria | 2755 |
| 353 | Ga0439462_0006706 | 3300042015 | Bacteria | 2872 |
| 354 | Ga0439462_0100987 | 3300042015 | Bacteria | 795 |
| 355 | Ga0450898_022996 | 3300042134 | Bacteria | 1107 |
| 356 | Ga0450908_000269 | 3300042184 | Bacteria | 10213 |
| 357 | Ga0451577_0031680 | 3300042876 | Bacteria | 4770 |
| 358 | Ga0451577_0031713 | 3300042876 | Bacteria | 4767 |
| 359 | Ga0451577_0308057 | 3300042876 | Bacteria | 1435 |
| 360 | Ga0453684_0001075 | 3300044712 | Bacteria | 86968 |
| 361 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 362 | Ga0466967_0869862 | 3300045976 | Bacteria | 896 |
| 363 | Ga0495638_0113775 | 3300046460 | Bacteria | 1605 |
| 364 | Ga0495638_0344883 | 3300046460 | Bacteria | 788 |
| 365 | Ga0495650_0001294 | 3300046471 | Bacteria | 25431 |
| 366 | Ga0495580_0013301 | 3300046472 | Bacteria | 6287 |
| 367 | Ga0495605_0045287 | 3300046474 | Bacteria | 2169 |
| 368 | Ga0495584_0004523 | 3300046491 | Bacteria | 7466 |
| 369 | Ga0495585_0001164 | 3300046492 | Bacteria | 21400 |
| 370 | Ga0495607_0001296 | 3300046501 | Bacteria | 22305 |
| 371 | Ga0495606_0002600 | 3300046507 | Bacteria | 20645 |
| 372 | Ga0495610_0006598 | 3300046512 | Bacteria | 7930 |
| 373 | Ga0495610_0009553 | 3300046512 | Bacteria | 6117 |
| 374 | Ga0495616_0006200 | 3300046513 | Bacteria | 7271 |
| 375 | Ga0495618_0240838 | 3300046514 | Bacteria | 1137 |
| 376 | Ga0495620_0058355 | 3300046515 | Bacteria | 1615 |
| 377 | Ga0495628_0343022 | 3300046516 | Bacteria | 1099 |
| 378 | Ga0495631_0000153 | 3300046518 | Bacteria | 47259 |
| 379 | Ga0495631_0001341 | 3300046518 | Bacteria | 15064 |
| 380 | Ga0495643_0063565 | 3300046522 | Bacteria | 1952 |
| 381 | Ga0495648_0005663 | 3300046524 | Bacteria | 10336 |
| 382 | Ga0495648_0009304 | 3300046524 | Bacteria | 7635 |
| 383 | Ga0495663_0000627 | 3300046525 | Bacteria | 12316 |
| 384 | Ga0495663_0095122 | 3300046525 | Bacteria | 975 |
| 385 | Ga0495665_0053039 | 3300046531 | Bacteria | 2146 |
| 386 | Ga0495621_0015980 | 3300046539 | Bacteria | 2401 |
| 387 | Ga0495621_0094066 | 3300046539 | Bacteria | 1133 |
| 388 | Ga0495633_0007036 | 3300046558 | Bacteria | 6554 |
| 389 | Ga0495656_0020362 | 3300046615 | Bacteria | 2572 |
| 390 | Ga0495656_0023325 | 3300046615 | Bacteria | 2434 |
| 391 | Ga0495656_0079486 | 3300046615 | Bacteria | 1476 |
| 392 | Ga0495656_0227955 | 3300046615 | Bacteria | 934 |
| 393 | Ga0495668_0005870 | 3300046616 | Bacteria | 8181 |
| 394 | Ga0495611_0000076 | 3300046648 | Bacteria | 69480 |
| 395 | Ga0495625_0176262 | 3300046660 | Bacteria | 1424 |
| 396 | Ga0495661_0001341 | 3300046665 | Bacteria | 20869 |
| 397 | Ga0495599_0259165 | 3300046678 | Bacteria | 1057 |
| 398 | Ga0495670_0008473 | 3300046691 | Bacteria | 5057 |
| 399 | Ga0495670_0157301 | 3300046691 | Bacteria | 1193 |
| 400 | Ga0495671_0096783 | 3300046692 | Bacteria | 1444 |
| 401 | Ga0495636_0008680 | 3300047318 | Bacteria | 4006 |
| 402 | Ga0495636_0009214 | 3300047318 | Bacteria | 3885 |
| 403 | Ga0495636_0044848 | 3300047318 | Bacteria | 1842 |
| 404 | Ga0495636_0059910 | 3300047318 | Bacteria | 1607 |
| 405 | Ga0495683_0003452 | 3300047323 | Bacteria | 9220 |
| 406 | Ga0495673_0000175 | 3300047469 | Bacteria | 105273 |
| 407 | Ga0495673_0000548 | 3300047469 | Bacteria | 38312 |
| 408 | Ga0495686_0001999 | 3300047472 | Bacteria | 20216 |
| 409 | Ga0495686_0047803 | 3300047472 | Bacteria | 2700 |
| 410 | Ga0495686_0221948 | 3300047472 | Bacteria | 1074 |
| 411 | Ga0496101_0001399 | 3300048904 | Bacteria | 14442 |
| 412 | Ga0496101_0136423 | 3300048904 | Bacteria | 1867 |
| 413 | Ga0496101_0140374 | 3300048904 | Bacteria | 1841 |
| 414 | Ga0496102_0081654 | 3300048905 | Bacteria | 2980 |
| 415 | Ga0496102_0104102 | 3300048905 | Bacteria | 2640 |
| 416 | Ga0496102_0249638 | 3300048905 | Bacteria | 1673 |
| 417 | Ga0496103_0060620 | 3300048906 | Bacteria | 2352 |
| 418 | Ga0496103_0101642 | 3300048906 | Bacteria | 1820 |
| 419 | Ga0496104_0215939 | 3300048907 | Bacteria | 1829 |
| 420 | Ga0496105_0078549 | 3300048908 | Bacteria | 2724 |
| 421 | Ga0496106_0010118 | 3300048909 | Bacteria | 6965 |
| 422 | Ga0496106_0075896 | 3300048909 | Bacteria | 2575 |
| 423 | Ga0496107_0038377 | 3300048910 | Bacteria | 3436 |
| 424 | Ga0496107_0230674 | 3300048910 | Bacteria | 1377 |
| 425 | Ga0496108_0007461 | 3300048911 | Bacteria | 8866 |
| 426 | Ga0496109_0121252 | 3300048912 | Bacteria | 2436 |
| 427 | Ga0496110_0006955 | 3300048913 | Bacteria | 8999 |
| 428 | Ga0496110_0453596 | 3300048913 | Bacteria | 1168 |
| 429 | Ga0496111_0076140 | 3300048914 | Bacteria | 2445 |
| 430 | Ga0496112_0148083 | 3300048915 | Bacteria | 2315 |
| 431 | Ga0496113_0037719 | 3300048916 | Bacteria | 3549 |
| 432 | Ga0496113_0040660 | 3300048916 | Bacteria | 3427 |
| 433 | Ga0496114_0007080 | 3300048917 | Bacteria | 8850 |
| 434 | Ga0496114_0014430 | 3300048917 | Bacteria | 6343 |
| 435 | Ga0496116_0215845 | 3300048919 | Bacteria | 989 |
| 436 | Ga0496117_0031599 | 3300048920 | Bacteria | 4038 |
| 437 | Ga0496117_0185003 | 3300048920 | Bacteria | 1193 |
| 438 | Ga0496118_0247522 | 3300048921 | Bacteria | 1015 |
| 439 | Ga0496121_0000290 | 3300048924 | Bacteria | 104280 |
| 440 | Ga0496121_0015404 | 3300048924 | Bacteria | 8013 |
| 441 | Ga0496121_0040985 | 3300048924 | Bacteria | 4054 |
| 442 | Ga0496122_0032223 | 3300048925 | Bacteria | 4340 |
| 443 | Ga0496122_0184448 | 3300048925 | Bacteria | 1240 |
| 444 | Ga0496125_0040218 | 3300048928 | Bacteria | 4013 |
| 445 | Ga0496126_0117984 | 3300048929 | Bacteria | 2304 |
| 446 | Ga0496126_0134329 | 3300048929 | Bacteria | 2135 |
| 447 | Ga0501306_007573 | 3300049127 | Bacteria | 1303 |
| 448 | Ga0501310_002906 | 3300049130 | Bacteria | 1653 |
| 449 | Ga0495678_155661 | 3300049459 | Bacteria | 734 |
| 450 | Ga0495682_0003660 | 3300049460 | Bacteria | 6776 |
| 451 | Ga0501031_0003184 | 3300049568 | Bacteria | 10532 |
| 452 | Ga0501032_0021757 | 3300049569 | Bacteria | 4455 |
| 453 | Ga0501032_0107666 | 3300049569 | Bacteria | 1846 |
| 454 | Ga0501034_0009035 | 3300049571 | Bacteria | 10465 |
| 455 | Ga0501034_0046740 | 3300049571 | Bacteria | 4373 |
| 456 | Ga0501034_0591077 | 3300049571 | Bacteria | 1016 |
| 457 | Ga0501034_0789807 | 3300049571 | Bacteria | 843 |
| 458 | Ga0501034_0966985 | 3300049571 | Bacteria | 736 |
| 459 | Ga0501036_0043311 | 3300049572 | Bacteria | 3811 |
| 460 | Ga0501036_0578104 | 3300049572 | Bacteria | 933 |
| 461 | Ga0501037_0002429 | 3300049573 | Bacteria | 13472 |
| 462 | Ga0501038_0004283 | 3300049574 | Bacteria | 13267 |
| 463 | Ga0501039_0020002 | 3300049575 | Bacteria | 5131 |
| 464 | Ga0501043_0038380 | 3300049579 | Bacteria | 3766 |
| 465 | Ga0501043_0391785 | 3300049579 | Bacteria | 1050 |
| 466 | Ga0501047_0060812 | 3300049581 | Bacteria | 3644 |
| 467 | Ga0501069_0226222 | 3300049585 | Bacteria | 1088 |
| 468 | Ga0501070_0004462 | 3300049586 | Bacteria | 12020 |
| 469 | Ga0501070_0102516 | 3300049586 | Bacteria | 2367 |
| 470 | Ga0501070_0323831 | 3300049586 | Bacteria | 1253 |
| 471 | Ga0501073_0087884 | 3300049589 | Bacteria | 2161 |
| 472 | Ga0501077_0012889 | 3300049593 | Bacteria | 5237 |
| 473 | Ga0501080_0015994 | 3300049742 | Bacteria | 6922 |
| 474 | Ga0501035_0028854 | 3300049822 | Bacteria | 5062 |
| 475 | Ga0501044_0008077 | 3300049823 | Bacteria | 11558 |
| 476 | nmdc:mga00v17_21547_c1 | 3300050491 | Bacteria | 3706 |
| 477 | Ga0495612_0036532 | 3300053078 | Bacteria | 1994 |
| 478 | Ga0500651_0421483 | 3300053093 | Bacteria | 747 |
| 479 | Ga0500633_0002927 | 3300053160 | Bacteria | 3623 |
| 480 | Ga0500634_0016015 | 3300053161 | Bacteria | 3995 |
| 481 | Ga0500645_022571 | 3300053730 | Bacteria | 1934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10586587 | Ga0207646_105865872 | 168 |
| 2 | 3300001904 | JGI24736J21556_1001801 | JGI24736J21556_10018012 | 174 |
| 3 | 3300002075 | JGI24738J21930_10000208 | JGI24738J21930_100002086 | 174 |
| 4 | 3300005344 | Ga0070661_100302959 | Ga0070661_1003029592 | 174 |
| 5 | 3300013104 | Ga0157370_10000272 | Ga0157370_1000027255 | 174 |
| 6 | 3300013104 | Ga0157370_10022679 | Ga0157370_100226793 | 174 |
| 7 | 3300013105 | Ga0157369_10000706 | Ga0157369_1000070627 | 174 |
| 8 | 3300015261 | Ga0182006_1000563 | Ga0182006_100056310 | 174 |
| 9 | 3300015265 | Ga0182005_1000362 | Ga0182005_100036221 | 174 |
| 10 | 3300015265 | Ga0182005_1002947 | Ga0182005_10029473 | 174 |
| 11 | 3300025258 | Ga0209129_1003121 | Ga0209129_10031214 | 174 |
| 12 | 3300025299 | Ga0209256_1014424 | Ga0209256_10144242 | 174 |
| 13 | 3300025904 | Ga0207647_10000415 | Ga0207647_1000041522 | 174 |
| 14 | 3300025920 | Ga0207649_10193751 | Ga0207649_101937512 | 174 |
| 15 | 3300026067 | Ga0207678_10383081 | Ga0207678_103830812 | 174 |
| 16 | 3300031731 | Ga0307405_10592663 | Ga0307405_105926631 | 174 |
| 17 | 3300031911 | Ga0307412_10001032 | Ga0307412_1000103211 | 174 |
| 18 | 3300041404 | Ga0439436_0000109 | Ga0439436_0000109_5820_6416 | 174 |
| 19 | 3300042004 | Ga0439445_0060348 | Ga0439445_0060348_26_604 | 174 |
| 20 | 3300042015 | Ga0439462_0100987 | Ga0439462_0100987_13_591 | 174 |
| 21 | 3300042184 | Ga0450908_000269 | Ga0450908_000269_8478_9056 | 174 |
| 22 | 3300046471 | Ga0495650_0001294 | Ga0495650_0001294_6101_6679 | 174 |
| 23 | 3300046474 | Ga0495605_0045287 | Ga0495605_0045287_911_1489 | 174 |
| 24 | 3300046491 | Ga0495584_0004523 | Ga0495584_0004523_4574_5152 | 174 |
| 25 | 3300046492 | Ga0495585_0001164 | Ga0495585_0001164_6997_7575 | 174 |
| 26 | 3300046501 | Ga0495607_0001296 | Ga0495607_0001296_7623_8201 | 174 |
| 27 | 3300046507 | Ga0495606_0002600 | Ga0495606_0002600_13627_14205 | 174 |
| 28 | 3300046512 | Ga0495610_0006598 | Ga0495610_0006598_4133_4729 | 174 |
| 29 | 3300046512 | Ga0495610_0009553 | Ga0495610_0009553_1395_1973 | 174 |
| 30 | 3300046513 | Ga0495616_0006200 | Ga0495616_0006200_6434_7012 | 174 |
| 31 | 3300046515 | Ga0495620_0058355 | Ga0495620_0058355_25_603 | 174 |
| 32 | 3300046518 | Ga0495631_0000153 | Ga0495631_0000153_39952_40530 | 174 |
| 33 | 3300046518 | Ga0495631_0001341 | Ga0495631_0001341_8326_8904 | 174 |
| 34 | 3300046524 | Ga0495648_0005663 | Ga0495648_0005663_1300_1878 | 174 |
| 35 | 3300046524 | Ga0495648_0009304 | Ga0495648_0009304_15_593 | 174 |
| 36 | 3300046648 | Ga0495611_0000076 | Ga0495611_0000076_6101_6679 | 174 |
| 37 | 3300046660 | Ga0495625_0176262 | Ga0495625_0176262_265_843 | 174 |
| 38 | 3300046665 | Ga0495661_0001341 | Ga0495661_0001341_6541_7119 | 174 |
| 39 | 3300046691 | Ga0495670_0008473 | Ga0495670_0008473_3435_4013 | 174 |
| 40 | 3300047323 | Ga0495683_0003452 | Ga0495683_0003452_6877_7455 | 174 |
| 41 | 3300047469 | Ga0495673_0000175 | Ga0495673_0000175_7145_7723 | 174 |
| 42 | 3300047469 | Ga0495673_0000548 | Ga0495673_0000548_31085_31663 | 174 |
| 43 | 3300047472 | Ga0495686_0001999 | Ga0495686_0001999_19494_20072 | 174 |
| 44 | 3300047472 | Ga0495686_0221948 | Ga0495686_0221948_328_906 | 174 |
| 45 | 3300048904 | Ga0496101_0001399 | Ga0496101_0001399_5619_6197 | 174 |
| 46 | 3300048905 | Ga0496102_0249638 | Ga0496102_0249638_894_1472 | 174 |
| 47 | 3300048909 | Ga0496106_0010118 | Ga0496106_0010118_604_1182 | 174 |
| 48 | 3300048919 | Ga0496116_0215845 | Ga0496116_0215845_178_756 | 174 |
| 49 | 3300048920 | Ga0496117_0031599 | Ga0496117_0031599_1336_1914 | 174 |
| 50 | 3300048924 | Ga0496121_0000290 | Ga0496121_0000290_40255_40833 | 174 |
| 51 | 3300048924 | Ga0496121_0015404 | Ga0496121_0015404_6490_7068 | 174 |
| 52 | 3300048928 | Ga0496125_0040218 | Ga0496125_0040218_2252_2830 | 174 |
| 53 | 3300048929 | Ga0496126_0134329 | Ga0496126_0134329_1362_1940 | 174 |
| 54 | 3300049459 | Ga0495678_155661 | Ga0495678_155661_85_663 | 174 |
| 55 | 3300049460 | Ga0495682_0003660 | Ga0495682_0003660_541_1119 | 174 |
| 56 | 3300053093 | Ga0500651_0421483 | Ga0500651_0421483_108_695 | 174 |
| 57 | 3300053160 | Ga0500633_0002927 | Ga0500633_0002927_2002_2580 | 174 |
| 58 | 3300053730 | Ga0500645_022571 | Ga0500645_022571_1254_1832 | 174 |
| 59 | 3300005614 | Ga0068856_100000022 | Ga0068856_100000022122 | 176 |
| 60 | 3300013105 | Ga0157369_10056779 | Ga0157369_100567798 | 176 |
| 61 | 3300026078 | Ga0207702_10000852 | Ga0207702_100008529 | 176 |
| 62 | 3300031507 | Ga0307509_10189456 | Ga0307509_101894562 | 176 |
| 63 | 3300042876 | Ga0451577_0031680 | Ga0451577_0031680_1512_2111 | 176 |
| 64 | 3300044712 | Ga0453684_0001075 | Ga0453684_0001075_2365_2952 | 176 |
| 65 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_83776_84363 | 176 |
| 66 | 3300049571 | Ga0501034_0789807 | Ga0501034_0789807_95_676 | 176 |
| 67 | 3300041456 | Ga0451795_1416188 | Ga0451795_1416188_13_564 | 179 |
| 68 | 3300031691 | Ga0316579_10286380 | Ga0316579_102863801 | 181 |
| 69 | 3300031727 | Ga0316576_10110908 | Ga0316576_101109083 | 181 |
| 70 | 3300031728 | Ga0316578_10049276 | Ga0316578_100492761 | 181 |
| 71 | 3300032168 | Ga0316593_10126920 | Ga0316593_101269201 | 181 |
| 72 | 3300033541 | Ga0316596_1026026 | Ga0316596_10260263 | 181 |
| 73 | 3300035398 | Ga0316574_0134170 | Ga0316574_0134170_758_1336 | 181 |
| 74 | 3300036647 | Ga0316582_0041767 | Ga0316582_0041767_1014_1592 | 181 |
| 75 | 3300031901 | Ga0307406_10398950 | Ga0307406_103989502 | 185 |
| 76 | 3300031911 | Ga0307412_11017345 | Ga0307412_110173452 | 185 |
| 77 | 3300032126 | Ga0307415_100223269 | Ga0307415_1002232692 | 185 |
| 78 | iso_pu_bacteria | 2593339239 | 2595451329 | 187 |
| 79 | iso_pu_bacteria | 2718218334 | 2721028652 | 187 |
| 80 | iso_pu_bacteria | 2738543009 | 2739227036 | 187 |
| 81 | iso_pu_bacteria | 2818991440 | 2819565877 | 187 |
| 82 | iso_pu_bacteria | 2842918807 | 2842922206 | 187 |
| 83 | iso_pu_bacteria | 2904463128 | 2904466148 | 187 |
| 84 | iso_pu_bacteria | 2919085039 | 2919086825 | 187 |
| 85 | iso_pu_bacteria | 2941471342 | 2941473877 | 187 |
| 86 | iso_pu_bacteria | 2995948881 | 2995950343 | 188 |
| 87 | iso_pu_bacteria | 8003014200 | 8003015023 | 188 |
| 88 | iso_pu_bacteria | 2524614729 | 2525556165 | 189 |
| 89 | iso_pu_bacteria | 2571042365 | 2572254555 | 189 |
| 90 | iso_pu_bacteria | 2627854209 | 2630649395 | 189 |
| 91 | iso_pu_bacteria | 2643221559 | 2643815637 | 189 |
| 92 | iso_pu_bacteria | 2643221573 | 2643882110 | 189 |
| 93 | iso_pu_bacteria | 2643221586 | 2643938221 | 189 |
| 94 | iso_pu_bacteria | 2643221593 | 2643976393 | 189 |
| 95 | iso_pu_bacteria | 2643221612 | 2644079860 | 189 |
| 96 | iso_pu_bacteria | 2643221695 | 2644528429 | 189 |
| 97 | iso_pu_bacteria | 2643221720 | 2644663181 | 189 |
| 98 | iso_pu_bacteria | 2643221727 | 2644695988 | 189 |
| 99 | iso_pu_bacteria | 2643221728 | 2644699656 | 189 |
| 100 | iso_pu_bacteria | 2747842501 | 2748018910 | 189 |
| 101 | iso_pu_bacteria | 2894414249 | 2894414487 | 189 |
| 102 | iso_pu_bacteria | 2941489479 | 2941490098 | 189 |
| 103 | 3300012512 | Ga0157327_1011044 | Ga0157327_10110442 | 190 |
| 104 | iso_pu_bacteria | 2734482264 | 2735835758 | 191 |
| 105 | iso_pu_bacteria | 2953994433 | 2953997323 | 191 |
| 106 | 3300003771 | Ga0055526_1007780 | Ga0055526_10077806 | 192 |
| 107 | 3300003775 | Ga0055524_1037152 | Ga0055524_10371522 | 192 |
| 108 | 3300003781 | Ga0055536_1052057 | Ga0055536_10520571 | 192 |
| 109 | 3300003791 | Ga0055530_10003355 | Ga0055530_100033559 | 192 |
| 110 | 3300003794 | Ga0055531_10026708 | Ga0055531_100267082 | 192 |
| 111 | 3300003794 | Ga0055531_10053433 | Ga0055531_100534332 | 192 |
| 112 | 3300005336 | Ga0070680_100751294 | Ga0070680_1007512941 | 192 |
| 113 | 3300005337 | Ga0070682_100223120 | Ga0070682_1002231202 | 192 |
| 114 | 3300005548 | Ga0070665_100583679 | Ga0070665_1005836792 | 192 |
| 115 | 3300006051 | Ga0075364_10005259 | Ga0075364_100052597 | 192 |
| 116 | 3300015689 | Ga0183360_10001 | Ga0183360_100012748 | 192 |
| 117 | 3300025273 | Ga0209673_1016931 | Ga0209673_10169313 | 192 |
| 118 | 3300025284 | Ga0209130_1009639 | Ga0209130_10096392 | 192 |
| 119 | 3300025291 | Ga0209675_1009635 | Ga0209675_10096353 | 192 |
| 120 | 3300025291 | Ga0209675_1042019 | Ga0209675_10420192 | 192 |
| 121 | 3300025292 | Ga0209676_1001557 | Ga0209676_10015572 | 192 |
| 122 | 3300025292 | Ga0209676_1005445 | Ga0209676_10054457 | 192 |
| 123 | 3300025292 | Ga0209676_1054366 | Ga0209676_10543661 | 192 |
| 124 | 3300025295 | Ga0209564_1006399 | Ga0209564_10063997 | 192 |
| 125 | 3300025297 | Ga0209758_1090260 | Ga0209758_10902601 | 192 |
| 126 | 3300025298 | Ga0209050_1006874 | Ga0209050_10068742 | 192 |
| 127 | 3300025298 | Ga0209050_1048399 | Ga0209050_10483992 | 192 |
| 128 | 3300025299 | Ga0209256_1009960 | Ga0209256_10099604 | 192 |
| 129 | 3300025303 | Ga0209051_1002516 | Ga0209051_100251610 | 192 |
| 130 | 3300025304 | Ga0209257_1000343 | Ga0209257_10003436 | 192 |
| 131 | 3300025304 | Ga0209257_1047840 | Ga0209257_10478402 | 192 |
| 132 | 3300025917 | Ga0207660_10608191 | Ga0207660_106081912 | 192 |
| 133 | 3300027364 | Ga0209967_1002954 | Ga0209967_10029543 | 192 |
| 134 | 3300028379 | Ga0268266_10120135 | Ga0268266_101201352 | 192 |
| 135 | 3300031730 | Ga0307516_10007119 | Ga0307516_1000711917 | 192 |
| 136 | 3300031852 | Ga0307410_10293429 | Ga0307410_102934291 | 192 |
| 137 | 3300031901 | Ga0307406_10085207 | Ga0307406_100852073 | 192 |
| 138 | 3300031911 | Ga0307412_10323802 | Ga0307412_103238022 | 192 |
| 139 | 3300041451 | Ga0451791_1274919 | Ga0451791_1274919_237_815 | 192 |
| 140 | 3300041452 | Ga0451793_1712095 | Ga0451793_1712095_371_949 | 192 |
| 141 | 3300041486 | Ga0451807_1988829 | Ga0451807_1988829_174_755 | 192 |
| 142 | 3300042007 | Ga0439449_0000413 | Ga0439449_0000413_12410_12988 | 192 |
| 143 | 3300042134 | Ga0450898_022996 | Ga0450898_022996_132_710 | 192 |
| 144 | 3300042876 | Ga0451577_0031713 | Ga0451577_0031713_3449_4027 | 192 |
| 145 | 3300046522 | Ga0495643_0063565 | Ga0495643_0063565_34_654 | 192 |
| 146 | 3300046525 | Ga0495663_0000627 | Ga0495663_0000627_2008_2628 | 192 |
| 147 | 3300046692 | Ga0495671_0096783 | Ga0495671_0096783_415_1035 | 192 |
| 148 | 3300048924 | Ga0496121_0040985 | Ga0496121_0040985_1456_2034 | 192 |
| 149 | 3300048925 | Ga0496122_0184448 | Ga0496122_0184448_98_676 | 192 |
| 150 | 3300049127 | Ga0501306_007573 | Ga0501306_007573_238_816 | 192 |
| 151 | 3300049568 | Ga0501031_0003184 | Ga0501031_0003184_9912_10490 | 192 |
| 152 | 3300049569 | Ga0501032_0021757 | Ga0501032_0021757_412_990 | 192 |
| 153 | 3300049571 | Ga0501034_0009035 | Ga0501034_0009035_7262_7885 | 192 |
| 154 | 3300049571 | Ga0501034_0046740 | Ga0501034_0046740_1159_1737 | 192 |
| 155 | 3300049571 | Ga0501034_0966985 | Ga0501034_0966985_27_605 | 192 |
| 156 | 3300049572 | Ga0501036_0043311 | Ga0501036_0043311_2672_3250 | 192 |
| 157 | 3300049572 | Ga0501036_0578104 | Ga0501036_0578104_44_667 | 192 |
| 158 | 3300049573 | Ga0501037_0002429 | Ga0501037_0002429_5146_5724 | 192 |
| 159 | 3300049574 | Ga0501038_0004283 | Ga0501038_0004283_10540_11118 | 192 |
| 160 | 3300049575 | Ga0501039_0020002 | Ga0501039_0020002_1935_2513 | 192 |
| 161 | 3300049579 | Ga0501043_0391785 | Ga0501043_0391785_128_706 | 192 |
| 162 | 3300049581 | Ga0501047_0060812 | Ga0501047_0060812_2809_3387 | 192 |
| 163 | 3300049589 | Ga0501073_0087884 | Ga0501073_0087884_1524_2102 | 192 |
| 164 | 3300049742 | Ga0501080_0015994 | Ga0501080_0015994_1365_1943 | 192 |
| 165 | 3300049822 | Ga0501035_0028854 | Ga0501035_0028854_2975_3553 | 192 |
| 166 | 3300049823 | Ga0501044_0008077 | Ga0501044_0008077_10618_11196 | 192 |
| 167 | 3300050491 | nmdc:mga00v17_21547_c1 | nmdc:mga00v17_21547_c1_1321_1899 | 192 |
| 168 | 3300002773 | JGI25152J39213_1000480 | JGI25152J39213_100048024 | 193 |
| 169 | 3300002774 | JGI25150J39212_1000356 | JGI25150J39212_10003563 | 193 |
| 170 | 3300002774 | JGI25150J39212_1001076 | JGI25150J39212_10010768 | 193 |
| 171 | 3300003187 | JGI25151J46595_10000924 | JGI25151J46595_1000092424 | 193 |
| 172 | 3300003215 | JGI25153J46596_10000050 | JGI25153J46596_10000050162 | 193 |
| 173 | 3300003771 | Ga0055526_1000124 | Ga0055526_10001245 | 193 |
| 174 | 3300003773 | Ga0055537_1000351 | Ga0055537_100035131 | 193 |
| 175 | 3300003775 | Ga0055524_1000188 | Ga0055524_10001885 | 193 |
| 176 | 3300003775 | Ga0055524_1012221 | Ga0055524_10122213 | 193 |
| 177 | 3300003784 | Ga0055534_1000108 | Ga0055534_100010853 | 193 |
| 178 | 3300003790 | Ga0055528_1000102 | Ga0055528_10001025 | 193 |
| 179 | 3300003794 | Ga0055531_10009978 | Ga0055531_100099785 | 193 |
| 180 | 3300003794 | Ga0055531_10022581 | Ga0055531_100225812 | 193 |
| 181 | 3300003794 | Ga0055531_10042494 | Ga0055531_100424942 | 193 |
| 182 | 3300003794 | Ga0055531_10061109 | Ga0055531_100611091 | 193 |
| 183 | 3300005293 | Ga0065715_10122124 | Ga0065715_101221243 | 193 |
| 184 | 3300005293 | Ga0065715_10185859 | Ga0065715_101858592 | 193 |
| 185 | 3300005329 | Ga0070683_100808040 | Ga0070683_1008080401 | 193 |
| 186 | 3300005331 | Ga0070670_100579527 | Ga0070670_1005795271 | 193 |
| 187 | 3300005338 | Ga0068868_100387333 | Ga0068868_1003873331 | 193 |
| 188 | 3300005356 | Ga0070674_100560787 | Ga0070674_1005607872 | 193 |
| 189 | 3300005364 | Ga0070673_100191967 | Ga0070673_1001919672 | 193 |
| 190 | 3300005366 | Ga0070659_100389843 | Ga0070659_1003898431 | 193 |
| 191 | 3300005367 | Ga0070667_100084950 | Ga0070667_1000849503 | 193 |
| 192 | 3300005435 | Ga0070714_100173138 | Ga0070714_1001731382 | 193 |
| 193 | 3300005530 | Ga0070679_100055347 | Ga0070679_1000553473 | 193 |
| 194 | 3300005547 | Ga0070693_100050744 | Ga0070693_1000507443 | 193 |
| 195 | 3300005618 | Ga0068864_100048154 | Ga0068864_1000481543 | 193 |
| 196 | 3300005719 | Ga0068861_100184720 | Ga0068861_1001847202 | 193 |
| 197 | 3300005719 | Ga0068861_100271269 | Ga0068861_1002712692 | 193 |
| 198 | 3300005841 | Ga0068863_100531527 | Ga0068863_1005315272 | 193 |
| 199 | 3300005844 | Ga0068862_100083610 | Ga0068862_1000836103 | 193 |
| 200 | 3300010375 | Ga0105239_10393874 | Ga0105239_103938742 | 193 |
| 201 | 3300012477 | Ga0157336_1001113 | Ga0157336_10011132 | 193 |
| 202 | 3300012482 | Ga0157318_1001010 | Ga0157318_10010102 | 193 |
| 203 | 3300012495 | Ga0157323_1002283 | Ga0157323_10022832 | 193 |
| 204 | 3300012502 | Ga0157347_1020760 | Ga0157347_10207602 | 193 |
| 205 | 3300012508 | Ga0157315_1002054 | Ga0157315_10020542 | 193 |
| 206 | 3300012510 | Ga0157316_1000607 | Ga0157316_10006072 | 193 |
| 207 | 3300012512 | Ga0157327_1001022 | Ga0157327_10010222 | 193 |
| 208 | 3300012515 | Ga0157338_1009055 | Ga0157338_10090552 | 193 |
| 209 | 3300013100 | Ga0157373_10654777 | Ga0157373_106547771 | 193 |
| 210 | 3300013105 | Ga0157369_10040166 | Ga0157369_100401666 | 193 |
| 211 | 3300013297 | Ga0157378_10089008 | Ga0157378_100890082 | 193 |
| 212 | 3300014326 | Ga0157380_10246581 | Ga0157380_102465813 | 193 |
| 213 | 3300014326 | Ga0157380_10514375 | Ga0157380_105143752 | 193 |
| 214 | 3300014326 | Ga0157380_10883228 | Ga0157380_108832282 | 193 |
| 215 | 3300014497 | Ga0182008_10040297 | Ga0182008_100402972 | 193 |
| 216 | 3300017792 | Ga0163161_10109856 | Ga0163161_101098563 | 193 |
| 217 | 3300025245 | Ga0207425_1000117 | Ga0207425_100011762 | 193 |
| 218 | 3300025245 | Ga0207425_1016989 | Ga0207425_10169892 | 193 |
| 219 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011319 | 193 |
| 220 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011125 | 193 |
| 221 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011125 | 193 |
| 222 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011408 | 193 |
| 223 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002479 | 193 |
| 224 | 3300025294 | Ga0209025_1000006 | Ga0209025_100000643 | 193 |
| 225 | 3300025294 | Ga0209025_1004073 | Ga0209025_10040737 | 193 |
| 226 | 3300025294 | Ga0209025_1084772 | Ga0209025_10847722 | 193 |
| 227 | 3300025294 | Ga0209025_1107572 | Ga0209025_11075721 | 193 |
| 228 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011570 | 193 |
| 229 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003486 | 193 |
| 230 | 3300025299 | Ga0209256_1000006 | Ga0209256_10000066 | 193 |
| 231 | 3300025299 | Ga0209256_1002733 | Ga0209256_10027332 | 193 |
| 232 | 3300025304 | Ga0209257_1000567 | Ga0209257_100056711 | 193 |
| 233 | 3300025304 | Ga0209257_1000788 | Ga0209257_100078845 | 193 |
| 234 | 3300025304 | Ga0209257_1016412 | Ga0209257_10164122 | 193 |
| 235 | 3300025919 | Ga0207657_10040428 | Ga0207657_100404285 | 193 |
| 236 | 3300025925 | Ga0207650_10171216 | Ga0207650_101712162 | 193 |
| 237 | 3300025925 | Ga0207650_10320564 | Ga0207650_103205642 | 193 |
| 238 | 3300025931 | Ga0207644_10034788 | Ga0207644_100347886 | 193 |
| 239 | 3300026023 | Ga0207677_10034774 | Ga0207677_100347745 | 193 |
| 240 | 3300026041 | Ga0207639_10347318 | Ga0207639_103473182 | 193 |
| 241 | 3300026088 | Ga0207641_10131242 | Ga0207641_101312422 | 193 |
| 242 | 3300026095 | Ga0207676_10091181 | Ga0207676_100911812 | 193 |
| 243 | 3300026116 | Ga0207674_10206185 | Ga0207674_102061852 | 193 |
| 244 | 3300026118 | Ga0207675_100136230 | Ga0207675_1001362302 | 193 |
| 245 | 3300027360 | Ga0209969_1003702 | Ga0209969_10037022 | 193 |
| 246 | 3300027378 | Ga0209981_1017045 | Ga0209981_10170452 | 193 |
| 247 | 3300027424 | Ga0209984_1008812 | Ga0209984_10088122 | 193 |
| 248 | 3300027471 | Ga0209995_1014812 | Ga0209995_10148122 | 193 |
| 249 | 3300027543 | Ga0209999_1000513 | Ga0209999_10005136 | 193 |
| 250 | 3300027665 | Ga0209983_1003578 | Ga0209983_10035786 | 193 |
| 251 | 3300027665 | Ga0209983_1070892 | Ga0209983_10708921 | 193 |
| 252 | 3300027682 | Ga0209971_1002324 | Ga0209971_10023244 | 193 |
| 253 | 3300027876 | Ga0209974_10036024 | Ga0209974_100360242 | 193 |
| 254 | 3300028379 | Ga0268266_10324948 | Ga0268266_103249482 | 193 |
| 255 | 3300028380 | Ga0268265_10188059 | Ga0268265_101880592 | 193 |
| 256 | 3300028380 | Ga0268265_10189410 | Ga0268265_101894102 | 193 |
| 257 | 3300030733 | Ga0314311_1048888 | Ga0314311_10488882 | 193 |
| 258 | 3300030735 | Ga0316178_1104819 | Ga0316178_11048192 | 193 |
| 259 | 3300030745 | Ga0316182_1135616 | Ga0316182_11356161 | 193 |
| 260 | 3300031456 | Ga0307513_10024815 | Ga0307513_100248152 | 193 |
| 261 | 3300031548 | Ga0307408_100796263 | Ga0307408_1007962631 | 193 |
| 262 | 3300031665 | Ga0316575_10032367 | Ga0316575_100323672 | 193 |
| 263 | 3300031824 | Ga0307413_10063997 | Ga0307413_100639972 | 193 |
| 264 | 3300031824 | Ga0307413_10214665 | Ga0307413_102146652 | 193 |
| 265 | 3300031901 | Ga0307406_10008962 | Ga0307406_100089623 | 193 |
| 266 | 3300031903 | Ga0307407_10761000 | Ga0307407_107610001 | 193 |
| 267 | 3300031911 | Ga0307412_10057798 | Ga0307412_100577982 | 193 |
| 268 | 3300031911 | Ga0307412_10149278 | Ga0307412_101492782 | 193 |
| 269 | 3300031911 | Ga0307412_10149760 | Ga0307412_101497602 | 193 |
| 270 | 3300031911 | Ga0307412_10317441 | Ga0307412_103174412 | 193 |
| 271 | 3300032004 | Ga0307414_10001926 | Ga0307414_100019265 | 193 |
| 272 | 3300032004 | Ga0307414_10003486 | Ga0307414_100034864 | 193 |
| 273 | 3300032004 | Ga0307414_10265403 | Ga0307414_102654032 | 193 |
| 274 | 3300032004 | Ga0307414_10366131 | Ga0307414_103661312 | 193 |
| 275 | 3300032004 | Ga0307414_10447479 | Ga0307414_104474792 | 193 |
| 276 | 3300032005 | Ga0307411_10177390 | Ga0307411_101773902 | 193 |
| 277 | 3300037312 | Ga0395899_0284105 | Ga0395899_0284105_176_757 | 193 |
| 278 | 3300037466 | Ga0395898_0129490 | Ga0395898_0129490_1354_1935 | 193 |
| 279 | 3300037466 | Ga0395898_0173334 | Ga0395898_0173334_1164_1745 | 193 |
| 280 | 3300037466 | Ga0395898_0490245 | Ga0395898_0490245_527_1108 | 193 |
| 281 | 3300037471 | Ga0395905_0075829 | Ga0395905_0075829_34_615 | 193 |
| 282 | 3300037471 | Ga0395905_0121377 | Ga0395905_0121377_1533_2114 | 193 |
| 283 | 3300037471 | Ga0395905_0522526 | Ga0395905_0522526_191_772 | 193 |
| 284 | 3300037471 | Ga0395905_0878712 | Ga0395905_0878712_184_765 | 193 |
| 285 | 3300038443 | Ga0395901_0092855 | Ga0395901_0092855_1303_1884 | 193 |
| 286 | 3300038705 | Ga0237819_00412 | Ga0237819_00412_12452_13033 | 193 |
| 287 | 3300041404 | Ga0439436_0005125 | Ga0439436_0005125_1266_1847 | 193 |
| 288 | 3300041404 | Ga0439436_0021567 | Ga0439436_0021567_355_936 | 193 |
| 289 | 3300041404 | Ga0439436_0022662 | Ga0439436_0022662_1227_1808 | 193 |
| 290 | 3300041404 | Ga0439436_0024264 | Ga0439436_0024264_1025_1606 | 193 |
| 291 | 3300041406 | Ga0439439_0016836 | Ga0439439_0016836_469_1050 | 193 |
| 292 | 3300041406 | Ga0439439_0058408 | Ga0439439_0058408_90_671 | 193 |
| 293 | 3300041407 | Ga0439447_002340 | Ga0439447_002340_1384_1965 | 193 |
| 294 | 3300041410 | Ga0439461_0130175 | Ga0439461_0130175_11_592 | 193 |
| 295 | 3300041413 | Ga0439465_0001938 | Ga0439465_0001938_5794_6375 | 193 |
| 296 | 3300041413 | Ga0439465_0011446 | Ga0439465_0011446_1345_1926 | 193 |
| 297 | 3300041413 | Ga0439465_0130934 | Ga0439465_0130934_35_616 | 193 |
| 298 | 3300041413 | Ga0439465_0233304 | Ga0439465_0233304_65_646 | 193 |
| 299 | 3300041443 | Ga0451789_1286101 | Ga0451789_1286101_77_658 | 193 |
| 300 | 3300041486 | Ga0451807_0822463 | Ga0451807_0822463_355_936 | 193 |
| 301 | 3300041486 | Ga0451807_0904569 | Ga0451807_0904569_304_894 | 193 |
| 302 | 3300041494 | Ga0451837_0903999 | Ga0451837_0903999_223_819 | 193 |
| 303 | 3300041999 | Ga0439433_0041040 | Ga0439433_0041040_200_781 | 193 |
| 304 | 3300042004 | Ga0439445_0014188 | Ga0439445_0014188_213_794 | 193 |
| 305 | 3300042004 | Ga0439445_0063262 | Ga0439445_0063262_408_989 | 193 |
| 306 | 3300042006 | Ga0439432_015781 | Ga0439432_015781_1573_2154 | 193 |
| 307 | 3300042006 | Ga0439432_029707 | Ga0439432_029707_299_880 | 193 |
| 308 | 3300042007 | Ga0439449_0005783 | Ga0439449_0005783_2184_2765 | 193 |
| 309 | 3300042007 | Ga0439449_0020151 | Ga0439449_0020151_542_1123 | 193 |
| 310 | 3300042007 | Ga0439449_0143507 | Ga0439449_0143507_32_613 | 193 |
| 311 | 3300042010 | Ga0439452_010124 | Ga0439452_010124_2135_2716 | 193 |
| 312 | 3300042015 | Ga0439462_0006706 | Ga0439462_0006706_1780_2361 | 193 |
| 313 | 3300045976 | Ga0466967_0869862 | Ga0466967_0869862_50_631 | 193 |
| 314 | 3300046460 | Ga0495638_0113775 | Ga0495638_0113775_13_594 | 193 |
| 315 | 3300046460 | Ga0495638_0344883 | Ga0495638_0344883_17_601 | 193 |
| 316 | 3300046525 | Ga0495663_0095122 | Ga0495663_0095122_174_761 | 193 |
| 317 | 3300046539 | Ga0495621_0015980 | Ga0495621_0015980_1325_1915 | 193 |
| 318 | 3300046539 | Ga0495621_0094066 | Ga0495621_0094066_500_1081 | 193 |
| 319 | 3300046558 | Ga0495633_0007036 | Ga0495633_0007036_4991_5572 | 193 |
| 320 | 3300046615 | Ga0495656_0020362 | Ga0495656_0020362_850_1431 | 193 |
| 321 | 3300046615 | Ga0495656_0023325 | Ga0495656_0023325_1364_1945 | 193 |
| 322 | 3300046615 | Ga0495656_0079486 | Ga0495656_0079486_710_1297 | 193 |
| 323 | 3300046615 | Ga0495656_0227955 | Ga0495656_0227955_102_689 | 193 |
| 324 | 3300046616 | Ga0495668_0005870 | Ga0495668_0005870_7474_8055 | 193 |
| 325 | 3300046691 | Ga0495670_0157301 | Ga0495670_0157301_304_885 | 193 |
| 326 | 3300047318 | Ga0495636_0008680 | Ga0495636_0008680_1867_2448 | 193 |
| 327 | 3300047318 | Ga0495636_0009214 | Ga0495636_0009214_613_1200 | 193 |
| 328 | 3300047318 | Ga0495636_0044848 | Ga0495636_0044848_618_1208 | 193 |
| 329 | 3300047318 | Ga0495636_0059910 | Ga0495636_0059910_698_1279 | 193 |
| 330 | 3300047472 | Ga0495686_0047803 | Ga0495686_0047803_1252_1833 | 193 |
| 331 | 3300048904 | Ga0496101_0136423 | Ga0496101_0136423_1232_1819 | 193 |
| 332 | 3300048904 | Ga0496101_0140374 | Ga0496101_0140374_493_1074 | 193 |
| 333 | 3300048905 | Ga0496102_0104102 | Ga0496102_0104102_938_1525 | 193 |
| 334 | 3300048909 | Ga0496106_0075896 | Ga0496106_0075896_1548_2135 | 193 |
| 335 | 3300048910 | Ga0496107_0230674 | Ga0496107_0230674_57_644 | 193 |
| 336 | 3300048912 | Ga0496109_0121252 | Ga0496109_0121252_390_971 | 193 |
| 337 | 3300048913 | Ga0496110_0453596 | Ga0496110_0453596_153_740 | 193 |
| 338 | 3300048915 | Ga0496112_0148083 | Ga0496112_0148083_1211_1792 | 193 |
| 339 | 3300048916 | Ga0496113_0040660 | Ga0496113_0040660_518_1099 | 193 |
| 340 | 3300048917 | Ga0496114_0014430 | Ga0496114_0014430_3785_4372 | 193 |
| 341 | 3300048921 | Ga0496118_0247522 | Ga0496118_0247522_110_694 | 193 |
| 342 | 3300048925 | Ga0496122_0032223 | Ga0496122_0032223_2530_3111 | 193 |
| 343 | 3300048929 | Ga0496126_0117984 | Ga0496126_0117984_337_918 | 193 |
| 344 | 3300049130 | Ga0501310_002906 | Ga0501310_002906_989_1570 | 193 |
| 345 | 3300049569 | Ga0501032_0107666 | Ga0501032_0107666_82_666 | 193 |
| 346 | 3300049571 | Ga0501034_0591077 | Ga0501034_0591077_156_740 | 193 |
| 347 | 3300049579 | Ga0501043_0038380 | Ga0501043_0038380_1192_1773 | 193 |
| 348 | 3300053161 | Ga0500634_0016015 | Ga0500634_0016015_523_1104 | 193 |
| 349 | 3300005330 | Ga0070690_100015749 | Ga0070690_1000157493 | 194 |
| 350 | 3300005335 | Ga0070666_10004410 | Ga0070666_100044109 | 194 |
| 351 | 3300005355 | Ga0070671_100012856 | Ga0070671_1000128563 | 194 |
| 352 | 3300005434 | Ga0070709_10039793 | Ga0070709_100397933 | 194 |
| 353 | 3300005436 | Ga0070713_100037359 | Ga0070713_1000373593 | 194 |
| 354 | 3300005437 | Ga0070710_10012772 | Ga0070710_100127725 | 194 |
| 355 | 3300005439 | Ga0070711_100391016 | Ga0070711_1003910162 | 194 |
| 356 | 3300005440 | Ga0070705_100029117 | Ga0070705_1000291172 | 194 |
| 357 | 3300005456 | Ga0070678_100002188 | Ga0070678_1000021883 | 194 |
| 358 | 3300005546 | Ga0070696_100297937 | Ga0070696_1002979371 | 194 |
| 359 | 3300005549 | Ga0070704_100081076 | Ga0070704_1000810763 | 194 |
| 360 | 3300005614 | Ga0068856_100223444 | Ga0068856_1002234442 | 194 |
| 361 | 3300005616 | Ga0068852_100017201 | Ga0068852_1000172013 | 194 |
| 362 | 3300005617 | Ga0068859_100092261 | Ga0068859_1000922612 | 194 |
| 363 | 3300005718 | Ga0068866_10025556 | Ga0068866_100255562 | 194 |
| 364 | 3300005843 | Ga0068860_100049203 | Ga0068860_1000492032 | 194 |
| 365 | 3300006163 | Ga0070715_10000377 | Ga0070715_1000037711 | 194 |
| 366 | 3300006175 | Ga0070712_100014028 | Ga0070712_1000140285 | 194 |
| 367 | 3300006237 | Ga0097621_100004496 | Ga0097621_1000044968 | 194 |
| 368 | 3300006358 | Ga0068871_100008248 | Ga0068871_1000082487 | 194 |
| 369 | 3300006881 | Ga0068865_100045505 | Ga0068865_1000455054 | 194 |
| 370 | 3300006914 | Ga0075436_100054620 | Ga0075436_1000546201 | 194 |
| 371 | 3300006931 | Ga0097620_100092260 | Ga0097620_1000922602 | 194 |
| 372 | 3300007265 | Ga0099794_10217979 | Ga0099794_102179791 | 194 |
| 373 | 3300009093 | Ga0105240_10392011 | Ga0105240_103920112 | 194 |
| 374 | 3300009098 | Ga0105245_10013508 | Ga0105245_100135083 | 194 |
| 375 | 3300009101 | Ga0105247_10053022 | Ga0105247_100530223 | 194 |
| 376 | 3300009174 | Ga0105241_10426989 | Ga0105241_104269892 | 194 |
| 377 | 3300009176 | Ga0105242_10002609 | Ga0105242_100026097 | 194 |
| 378 | 3300009177 | Ga0105248_10060061 | Ga0105248_100600612 | 194 |
| 379 | 3300010159 | Ga0099796_10012654 | Ga0099796_100126542 | 194 |
| 380 | 3300010375 | Ga0105239_10127578 | Ga0105239_101275782 | 194 |
| 381 | 3300013296 | Ga0157374_10002953 | Ga0157374_1000295312 | 194 |
| 382 | 3300013306 | Ga0163162_10047440 | Ga0163162_100474405 | 194 |
| 383 | 3300013308 | Ga0157375_10237851 | Ga0157375_102378512 | 194 |
| 384 | 3300014968 | Ga0157379_10025108 | Ga0157379_100251085 | 194 |
| 385 | 3300021358 | Ga0213873_10003266 | Ga0213873_100032664 | 194 |
| 386 | 3300025898 | Ga0207692_10023530 | Ga0207692_100235302 | 194 |
| 387 | 3300025899 | Ga0207642_10015835 | Ga0207642_100158352 | 194 |
| 388 | 3300025911 | Ga0207654_10322270 | Ga0207654_103222702 | 194 |
| 389 | 3300025913 | Ga0207695_10185807 | Ga0207695_101858072 | 194 |
| 390 | 3300025915 | Ga0207693_10000309 | Ga0207693_1000030942 | 194 |
| 391 | 3300025928 | Ga0207700_10035052 | Ga0207700_100350522 | 194 |
| 392 | 3300025931 | Ga0207644_10094519 | Ga0207644_100945193 | 194 |
| 393 | 3300025938 | Ga0207704_10938006 | Ga0207704_109380061 | 194 |
| 394 | 3300025941 | Ga0207711_10255980 | Ga0207711_102559802 | 194 |
| 395 | 3300025986 | Ga0207658_10110541 | Ga0207658_101105413 | 194 |
| 396 | 3300026035 | Ga0207703_10213118 | Ga0207703_102131182 | 194 |
| 397 | 3300026078 | Ga0207702_10058260 | Ga0207702_100582602 | 194 |
| 398 | 3300026088 | Ga0207641_10116499 | Ga0207641_101164993 | 194 |
| 399 | 3300026089 | Ga0207648_10149870 | Ga0207648_101498702 | 194 |
| 400 | 3300026121 | Ga0207683_10002168 | Ga0207683_1000216818 | 194 |
| 401 | 3300026142 | Ga0207698_10001409 | Ga0207698_100014094 | 194 |
| 402 | 3300028381 | Ga0268264_10074406 | Ga0268264_100744065 | 194 |
| 403 | 3300035089 | Ga0373944_0145547 | Ga0373944_0145547_201_800 | 194 |
| 404 | 3300035119 | Ga0373956_0242247 | Ga0373956_0242247_235_837 | 194 |
| 405 | 3300035170 | Ga0373943_0140555 | Ga0373943_0140555_204_806 | 194 |
| 406 | 3300035172 | Ga0373955_0121411 | Ga0373955_0121411_41_643 | 194 |
| 407 | 3300035695 | Ga0373927_0010393 | Ga0373927_0010393_3425_4027 | 194 |
| 408 | 3300035725 | Ga0373947_0109659 | Ga0373947_0109659_1048_1650 | 194 |
| 409 | 3300036401 | Ga0373937_0387507 | Ga0373937_0387507_666_1268 | 194 |
| 410 | 3300037068 | Ga0373925_0074520 | Ga0373925_0074520_591_1193 | 194 |
| 411 | 3300039438 | Ga0436360_0242755 | Ga0436360_0242755_1068_1679 | 194 |
| 412 | 3300039450 | Ga0436363_0272180 | Ga0436363_0272180_2991_3620 | 194 |
| 413 | 3300039450 | Ga0436363_0830800 | Ga0436363_0830800_933_1544 | 194 |
| 414 | 3300039453 | Ga0436362_0507180 | Ga0436362_0507180_894_1505 | 194 |
| 415 | 3300042876 | Ga0451577_0308057 | Ga0451577_0308057_748_1335 | 194 |
| 416 | 3300046472 | Ga0495580_0013301 | Ga0495580_0013301_4093_4695 | 194 |
| 417 | 3300046514 | Ga0495618_0240838 | Ga0495618_0240838_334_936 | 194 |
| 418 | 3300046516 | Ga0495628_0343022 | Ga0495628_0343022_282_884 | 194 |
| 419 | 3300046531 | Ga0495665_0053039 | Ga0495665_0053039_470_1072 | 194 |
| 420 | 3300046678 | Ga0495599_0259165 | Ga0495599_0259165_33_635 | 194 |
| 421 | 3300048905 | Ga0496102_0081654 | Ga0496102_0081654_1082_1684 | 194 |
| 422 | 3300048906 | Ga0496103_0060620 | Ga0496103_0060620_45_647 | 194 |
| 423 | 3300048906 | Ga0496103_0101642 | Ga0496103_0101642_146_745 | 194 |
| 424 | 3300048907 | Ga0496104_0215939 | Ga0496104_0215939_1007_1609 | 194 |
| 425 | 3300048908 | Ga0496105_0078549 | Ga0496105_0078549_1040_1642 | 194 |
| 426 | 3300048910 | Ga0496107_0038377 | Ga0496107_0038377_98_700 | 194 |
| 427 | 3300048911 | Ga0496108_0007461 | Ga0496108_0007461_2226_2828 | 194 |
| 428 | 3300048913 | Ga0496110_0006955 | Ga0496110_0006955_2053_2655 | 194 |
| 429 | 3300048914 | Ga0496111_0076140 | Ga0496111_0076140_1782_2384 | 194 |
| 430 | 3300048916 | Ga0496113_0037719 | Ga0496113_0037719_115_717 | 194 |
| 431 | 3300048917 | Ga0496114_0007080 | Ga0496114_0007080_5574_6176 | 194 |
| 432 | 3300048920 | Ga0496117_0185003 | Ga0496117_0185003_329_928 | 194 |
| 433 | 3300053078 | Ga0495612_0036532 | Ga0495612_0036532_246_848 | 194 |
| 434 | 3300001904 | JGI24736J21556_1001487 | JGI24736J21556_10014873 | 195 |
| 435 | 3300001915 | JGI24741J21665_1005708 | JGI24741J21665_10057082 | 195 |
| 436 | 3300001979 | JGI24740J21852_10012039 | JGI24740J21852_100120393 | 195 |
| 437 | 3300005329 | Ga0070683_100015303 | Ga0070683_1000153034 | 195 |
| 438 | 3300005334 | Ga0068869_100021838 | Ga0068869_1000218381 | 195 |
| 439 | 3300005336 | Ga0070680_100040040 | Ga0070680_1000400405 | 195 |
| 440 | 3300005336 | Ga0070680_101141825 | Ga0070680_1011418251 | 195 |
| 441 | 3300005339 | Ga0070660_100288604 | Ga0070660_1002886042 | 195 |
| 442 | 3300005339 | Ga0070660_100339268 | Ga0070660_1003392681 | 195 |
| 443 | 3300005345 | Ga0070692_10000651 | Ga0070692_100006516 | 195 |
| 444 | 3300005366 | Ga0070659_100014837 | Ga0070659_1000148376 | 195 |
| 445 | 3300005535 | Ga0070684_100004415 | Ga0070684_1000044157 | 195 |
| 446 | 3300005535 | Ga0070684_100006211 | Ga0070684_1000062112 | 195 |
| 447 | 3300005543 | Ga0070672_100004167 | Ga0070672_1000041675 | 195 |
| 448 | 3300005546 | Ga0070696_100121986 | Ga0070696_1001219863 | 195 |
| 449 | 3300005564 | Ga0070664_100100573 | Ga0070664_1001005732 | 195 |
| 450 | 3300005577 | Ga0068857_100102805 | Ga0068857_1001028053 | 195 |
| 451 | 3300005577 | Ga0068857_100133236 | Ga0068857_1001332362 | 195 |
| 452 | 3300005578 | Ga0068854_100225912 | Ga0068854_1002259121 | 195 |
| 453 | 3300005578 | Ga0068854_100227301 | Ga0068854_1002273012 | 195 |
| 454 | 3300005834 | Ga0068851_10062833 | Ga0068851_100628332 | 195 |
| 455 | 3300009093 | Ga0105240_11038053 | Ga0105240_110380531 | 195 |
| 456 | 3300009177 | Ga0105248_10054518 | Ga0105248_100545186 | 195 |
| 457 | 3300013100 | Ga0157373_10002076 | Ga0157373_100020766 | 195 |
| 458 | 3300013102 | Ga0157371_10543073 | Ga0157371_105430731 | 195 |
| 459 | 3300013104 | Ga0157370_11122369 | Ga0157370_111223691 | 195 |
| 460 | 3300013296 | Ga0157374_10456745 | Ga0157374_104567452 | 195 |
| 461 | 3300013307 | Ga0157372_10009738 | Ga0157372_100097387 | 195 |
| 462 | 3300013307 | Ga0157372_10551623 | Ga0157372_105516232 | 195 |
| 463 | 3300013308 | Ga0157375_10008845 | Ga0157375_1000884511 | 195 |
| 464 | 3300020070 | Ga0206356_10028907 | Ga0206356_100289071 | 195 |
| 465 | 3300020081 | Ga0206354_10060913 | Ga0206354_100609132 | 195 |
| 466 | 3300020082 | Ga0206353_10309227 | Ga0206353_103092276 | 195 |
| 467 | 3300020610 | Ga0154015_1087267 | Ga0154015_10872672 | 195 |
| 468 | 3300025904 | Ga0207647_10000845 | Ga0207647_100008459 | 195 |
| 469 | 3300025904 | Ga0207647_10415343 | Ga0207647_104153431 | 195 |
| 470 | 3300025909 | Ga0207705_10002560 | Ga0207705_100025605 | 195 |
| 471 | 3300025909 | Ga0207705_10044506 | Ga0207705_100445061 | 195 |
| 472 | 3300025912 | Ga0207707_10000184 | Ga0207707_1000018440 | 195 |
| 473 | 3300025912 | Ga0207707_10002500 | Ga0207707_100025009 | 195 |
| 474 | 3300025913 | Ga0207695_10022985 | Ga0207695_100229853 | 195 |
| 475 | 3300025913 | Ga0207695_10046420 | Ga0207695_100464205 | 195 |
| 476 | 3300025917 | Ga0207660_10002616 | Ga0207660_100026169 | 195 |
| 477 | 3300025917 | Ga0207660_10015330 | Ga0207660_100153305 | 195 |
| 478 | 3300025919 | Ga0207657_10168905 | Ga0207657_101689052 | 195 |
| 479 | 3300025919 | Ga0207657_10183155 | Ga0207657_101831552 | 195 |
| 480 | 3300025920 | Ga0207649_10004358 | Ga0207649_100043583 | 195 |
| 481 | 3300025920 | Ga0207649_10014225 | Ga0207649_100142252 | 195 |
| 482 | 3300025921 | Ga0207652_10004286 | Ga0207652_100042867 | 195 |
| 483 | 3300025921 | Ga0207652_10014993 | Ga0207652_100149935 | 195 |
| 484 | 3300025932 | Ga0207690_10165365 | Ga0207690_101653652 | 195 |
| 485 | 3300025940 | Ga0207691_10206802 | Ga0207691_102068022 | 195 |
| 486 | 3300025941 | Ga0207711_10016115 | Ga0207711_100161155 | 195 |
| 487 | 3300025942 | Ga0207689_10175963 | Ga0207689_101759632 | 195 |
| 488 | 3300025944 | Ga0207661_10002037 | Ga0207661_100020378 | 195 |
| 489 | 3300025944 | Ga0207661_10194099 | Ga0207661_101940991 | 195 |
| 490 | 3300025949 | Ga0207667_10014147 | Ga0207667_100141476 | 195 |
| 491 | 3300025949 | Ga0207667_10052651 | Ga0207667_100526511 | 195 |
| 492 | 3300025981 | Ga0207640_10002439 | Ga0207640_100024394 | 195 |
| 493 | 3300025981 | Ga0207640_10016624 | Ga0207640_100166241 | 195 |
| 494 | 3300026041 | Ga0207639_10061352 | Ga0207639_100613521 | 195 |
| 495 | 3300026041 | Ga0207639_10192383 | Ga0207639_101923832 | 195 |
| 496 | 3300026067 | Ga0207678_10193364 | Ga0207678_101933641 | 195 |
| 497 | 3300026067 | Ga0207678_10200512 | Ga0207678_102005121 | 195 |
| 498 | 3300026078 | Ga0207702_10001953 | Ga0207702_1000195315 | 195 |
| 499 | 3300026078 | Ga0207702_10280769 | Ga0207702_102807692 | 195 |
| 500 | 3300026116 | Ga0207674_10012399 | Ga0207674_100123995 | 195 |
| 501 | 3300026116 | Ga0207674_10090054 | Ga0207674_100900543 | 195 |
| 502 | 3300026142 | Ga0207698_10002115 | Ga0207698_100021152 | 195 |
| 503 | 3300026142 | Ga0207698_11208195 | Ga0207698_112081952 | 195 |
| 504 | 3300049585 | Ga0501069_0226222 | Ga0501069_0226222_76_687 | 195 |
| 505 | 3300049586 | Ga0501070_0004462 | Ga0501070_0004462_1209_1820 | 195 |
| 506 | 3300049586 | Ga0501070_0102516 | Ga0501070_0102516_1697_2293 | 195 |
| 507 | 3300049586 | Ga0501070_0323831 | Ga0501070_0323831_474_1061 | 195 |
| 508 | 3300049593 | Ga0501077_0012889 | Ga0501077_0012889_2029_2616 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4olj-assembly1.cif.gz_A | crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution | 0.965 | 1 | 190 |
| 7brd-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae | 0.9639 | 4 | 193 |
| 8axp-assembly1.cif.gz_B | neisseria gonorrhoeae peptidyl-trna hydrolase complexed with an xchem hit. | 0.9616 | 3 | 190 |
| 4qd3-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from pseudomonas aeruginosa with 5-azacytidine at 1.89 angstrom resolution | 0.9613 | 1 | 191 |
| 6ix6-assembly1.cif.gz_A | crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution | 0.9613 | 4 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3neaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9602 | 2 | 188 | 3.40.50.1470 |
| 3neaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9552 | 2 | 188 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.95 | 1 | 188 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9303 | 4 | 190 | 3.40.50.1470 |
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9294 | 58 | 190 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377E4Z3-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9867 | 3 | 107 |
GO:0004045
|
| AF-A0A5C7PWZ3-F1-model_v4 | Peptidyl-tRNA hydrolase | 0.9854 | 3 | 105 |
GO:0004045
|
| AF-A0A2J4V7Z6-F1-model_v4 | deleted | 0.9814 | 3 | 164 |
|
| AF-A0A1G0GLW4-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.981 | 1 | 190 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A1E5JVW5-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9767 | 47 | 190 |
GO:0004045
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar