F456338

General Info

Members Datasets Scaffolds Average Seq Length
505 257 1010 114

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10173170|Ga0070717_101731703
Length 125
Sequence MVVSHGEIWWADLELPAGSAPGFRRPVIVVQGDALNRSRIATVVCIPLTSNLGWADAPGNVLLASSATGLPRDSVANVSQIVTLDRILLSERAGKISRAKVELILSGIDIVFGKMTPRPRVRSDG

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
170 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 0.2
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 34.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10173170 3300006028 Unclassified 1878
2 MBSR1b_contig_1894739 2162886012 Bacteria 841
3 Ga0065715_10318808 3300005293 Bacteria 1006
4 Ga0065707_10006433 3300005295 Unclassified 4785
5 Ga0065707_10316432 3300005295 Bacteria 975
6 Ga0065707_10706300 3300005295 Unclassified 637
7 Ga0070690_100003752 3300005330 Bacteria 8370
8 Ga0070670_100722969 3300005331 Bacteria 896
9 Ga0070680_100017690 3300005336 Bacteria 5623
10 Ga0070689_100000064 3300005340 Bacteria 65382
11 Ga0070687_100174151 3300005343 Unclassified 1283
12 Ga0070687_101119427 3300005343 Unclassified 577
13 Ga0070668_101259352 3300005347 Unclassified 671
14 Ga0070669_101068972 3300005353 Unclassified 694
15 Ga0070675_101643236 3300005354 Bacteria 593
16 Ga0070674_100515370 3300005356 Bacteria 998
17 Ga0070674_100995539 3300005356 Unclassified 735
18 Ga0070673_100820204 3300005364 Bacteria 860
19 Ga0070673_101140234 3300005364 Unclassified 729
20 Ga0070673_101207932 3300005364 Unclassified 708
21 Ga0070688_100702095 3300005365 Bacteria 783
22 Ga0070688_101220875 3300005365 Unclassified 605
23 Ga0070667_100087723 3300005367 Bacteria 2671
24 Ga0070709_10000047 3300005434 Bacteria 97230
25 Ga0070709_10230278 3300005434 Unclassified 1326
26 Ga0070714_100266083 3300005435 Bacteria 1589
27 Ga0070714_100423036 3300005435 Unclassified 1262
28 Ga0070713_100004553 3300005436 Bacteria 9343
29 Ga0070713_101111114 3300005436 Unclassified 764
30 Ga0070701_10752653 3300005438 Unclassified 660
31 Ga0070705_100000397 3300005440 Bacteria 25329
32 Ga0070705_100882911 3300005440 Unclassified 718
33 Ga0070700_100000014 3300005441 Bacteria 156712
34 Ga0070694_100001151 3300005444 Bacteria 15188
35 Ga0070694_101170654 3300005444 Unclassified 643
36 Ga0070708_100089955 3300005445 Bacteria 2794
37 Ga0070708_100887708 3300005445 Unclassified 837
38 Ga0068867_100112186 3300005459 Bacteria 2096
39 Ga0070706_100028238 3300005467 Bacteria 5164
40 Ga0070706_101028937 3300005467 Unclassified 759
41 Ga0070706_101075298 3300005467 Unclassified 741
42 Ga0070706_101462738 3300005467 Unclassified 625
43 Ga0070707_100011962 3300005468 Bacteria 8097
44 Ga0070707_100014454 3300005468 Bacteria 7398
45 Ga0070707_100107968 3300005468 Bacteria 2700
46 Ga0070707_100272613 3300005468 Unclassified 1645
47 Ga0070707_100671070 3300005468 Unclassified 999
48 Ga0070707_100830159 3300005468 Unclassified 888
49 Ga0070698_100037437 3300005471 Bacteria 5002
50 Ga0070698_100867065 3300005471 Bacteria 848
51 Ga0070698_101550965 3300005471 Unclassified 614
52 Ga0070699_100062527 3300005518 Bacteria 3227
53 Ga0070699_100090226 3300005518 Bacteria 2679
54 Ga0070699_101247098 3300005518 Unclassified 682
55 Ga0070699_101921431 3300005518 Unclassified 541
56 Ga0070679_100583313 3300005530 Bacteria 1061
57 Ga0070679_100672034 3300005530 Unclassified 978
58 Ga0070697_100103564 3300005536 Bacteria 2366
59 Ga0070697_100492478 3300005536 Bacteria 1071
60 Ga0070697_100909684 3300005536 Unclassified 781
61 Ga0070697_101201690 3300005536 Unclassified 676
62 Ga0068853_100032591 3300005539 Bacteria 4415
63 Ga0068853_100492776 3300005539 Bacteria 1156
64 Ga0070672_101957332 3300005543 Unclassified 528
65 Ga0070686_100321905 3300005544 Bacteria 1153
66 Ga0070686_100628291 3300005544 Unclassified 849
67 Ga0070695_100140196 3300005545 Bacteria 1676
68 Ga0070695_100986125 3300005545 Unclassified 684
69 Ga0070696_100006582 3300005546 Bacteria 7757
70 Ga0070696_101909205 3300005546 Unclassified 514
71 Ga0070693_100000910 3300005547 Bacteria 13158
72 Ga0070665_100030064 3300005548 Bacteria 5466
73 Ga0070704_100039915 3300005549 Bacteria 3226
74 Ga0070704_100568596 3300005549 Unclassified 993
75 Ga0068854_100002517 3300005578 Bacteria 11365
76 Ga0070702_100121804 3300005615 Bacteria 1634
77 Ga0068859_100005876 3300005617 Bacteria 12454
78 Ga0068859_100164743 3300005617 Bacteria 2296
79 Ga0068859_100486617 3300005617 Bacteria 1329
80 Ga0068859_100521968 3300005617 Bacteria 1283
81 Ga0068859_100601623 3300005617 Bacteria 1192
82 Ga0068859_102491996 3300005617 Bacteria 570
83 Ga0068864_101749112 3300005618 Unclassified 627
84 Ga0068866_10068147 3300005718 Bacteria 1870
85 Ga0068866_11455786 3300005718 Unclassified 502
86 Ga0068861_101479430 3300005719 Unclassified 666
87 Ga0068863_101061318 3300005841 Unclassified 814
88 Ga0068858_100000090 3300005842 Bacteria 94699
89 Ga0068858_100113397 3300005842 Unclassified 2532
90 Ga0068860_100072827 3300005843 Unclassified 3265
91 Ga0068862_101021653 3300005844 Bacteria 818
92 Ga0068862_101454162 3300005844 Bacteria 690
93 Ga0068862_101559058 3300005844 Bacteria 667
94 Ga0068862_102717717 3300005844 Unclassified 506
95 Ga0081455_10608474 3300005937 Bacteria 711
96 Ga0081455_10938335 3300005937 Unclassified 537
97 Ga0081540_1281326 3300005983 Unclassified 574
98 Ga0075365_11190056 3300006038 Bacteria 536
99 Ga0075368_10045854 3300006042 Bacteria 1728
100 Ga0075364_10003106 3300006051 Bacteria 9393
101 Ga0075364_10283763 3300006051 Bacteria 1126
102 Ga0070716_100295762 3300006173 Bacteria 1124
103 Ga0075362_10005841 3300006177 Bacteria 4540
104 Ga0075367_10007054 3300006178 Bacteria 5725
105 Ga0075366_10007092 3300006195 Bacteria 6170
106 Ga0075366_10481548 3300006195 Bacteria 767
107 Ga0097621_101031813 3300006237 Unclassified 770
108 Ga0097621_102123900 3300006237 Unclassified 537
109 Ga0075428_100016099 3300006844 Bacteria 8268
110 Ga0075428_100164747 3300006844 Bacteria 2405
111 Ga0075428_100184366 3300006844 Bacteria 2258
112 Ga0075428_100300145 3300006844 Bacteria 1727
113 Ga0075428_101832695 3300006844 Unclassified 631
114 Ga0075430_100158401 3300006846 Bacteria 1885
115 Ga0075430_100674411 3300006846 Unclassified 852
116 Ga0075431_100004803 3300006847 Bacteria 13301
117 Ga0075431_100089997 3300006847 Unclassified 3167
118 Ga0075431_100690057 3300006847 Bacteria 999
119 Ga0075431_101037021 3300006847 Bacteria 786
120 Ga0075431_101590629 3300006847 Bacteria 611
121 Ga0075433_10348937 3300006852 Unclassified 1308
122 Ga0075433_10573179 3300006852 Bacteria 992
123 Ga0075434_100479332 3300006871 Bacteria 1265
124 Ga0075434_100748573 3300006871 Bacteria 994
125 Ga0075434_101841453 3300006871 Unclassified 612
126 Ga0075429_100299424 3300006880 Bacteria 1408
127 Ga0075429_100384038 3300006880 Bacteria 1230
128 Ga0075429_101438699 3300006880 Unclassified 600
129 Ga0075429_101580251 3300006880 Unclassified 570
130 Ga0075436_100041655 3300006914 Bacteria 3169
131 Ga0075436_100248781 3300006914 Bacteria 1266
132 Ga0097620_100005876 3300006931 Bacteria 12454
133 Ga0097620_100164734 3300006931 Bacteria 2296
134 Ga0097620_100486627 3300006931 Bacteria 1329
135 Ga0097620_100521998 3300006931 Bacteria 1283
136 Ga0097620_100601620 3300006931 Bacteria 1192
137 Ga0097620_102492072 3300006931 Bacteria 570
138 Ga0075435_100436517 3300007076 Bacteria 1129
139 Ga0075435_101713677 3300007076 Unclassified 551
140 Ga0099795_10119968 3300007788 Unclassified 1050
141 Ga0105240_10066731 3300009093 Bacteria 4462
142 Ga0105240_10306628 3300009093 Bacteria 1815
143 Ga0105240_10693499 3300009093 Unclassified 1112
144 Ga0105240_11082829 3300009093 Bacteria 853
145 Ga0105240_12025869 3300009093 Unclassified 598
146 Ga0111539_10051945 3300009094 Bacteria 4880
147 Ga0111539_10253402 3300009094 Bacteria 2049
148 Ga0111539_10700807 3300009094 Unclassified 1179
149 Ga0105245_10021704 3300009098 Bacteria 5636
150 Ga0114129_10017792 3300009147 Bacteria 10121
151 Ga0114129_10032439 3300009147 Bacteria 7382
152 Ga0114129_10121908 3300009147 Bacteria 3588
153 Ga0105243_10000182 3300009148 Bacteria 73148
154 Ga0105243_10756897 3300009148 Bacteria 953
155 Ga0105243_10991043 3300009148 Bacteria 842
156 Ga0105242_10000103 3300009176 Bacteria 60306
157 Ga0105242_10078133 3300009176 Bacteria 2762
158 Ga0105242_10079172 3300009176 Unclassified 2745
159 Ga0105242_10774948 3300009176 Unclassified 947
160 Ga0105248_10161205 3300009177 Bacteria 2530
161 Ga0105248_12046578 3300009177 Unclassified 651
162 Ga0105237_10716390 3300009545 Unclassified 1007
163 Ga0105238_10202315 3300009551 Bacteria 1962
164 Ga0105249_10123683 3300009553 Unclassified 2461
165 Ga0105249_11574398 3300009553 Bacteria 730
166 Ga0105249_11851000 3300009553 Bacteria 676
167 Ga0105249_12142225 3300009553 Bacteria 632
168 Ga0099796_10215361 3300010159 Unclassified 785
169 Ga0157336_1035079 3300012477 Unclassified 519
170 Ga0157338_1005667 3300012515 Bacteria 1130
171 Ga0157371_11112572 3300013102 Unclassified 606
172 Ga0157370_10009912 3300013104 Bacteria 10094
173 Ga0157374_10056120 3300013296 Bacteria 3677
174 Ga0157378_10594879 3300013297 Unclassified 1117
175 Ga0157378_11936542 3300013297 Unclassified 639
176 Ga0163162_11179400 3300013306 Unclassified 869
177 Ga0157372_10676422 3300013307 Unclassified 1201
178 Ga0157372_12671252 3300013307 Unclassified 573
179 Ga0157375_10970820 3300013308 Bacteria 991
180 Ga0157379_11261342 3300014968 Unclassified 712
181 Ga0157376_10056791 3300014969 Bacteria 3272
182 Ga0213876_10019053 3300021384 Unclassified 3624
183 Ga0213876_10024090 3300021384 Bacteria 3214
184 Ga0207653_10360604 3300025885 Unclassified 568
185 Ga0207699_10000056 3300025906 Bacteria 97208
186 Ga0207699_10546194 3300025906 Unclassified 840
187 Ga0207699_10611835 3300025906 Unclassified 794
188 Ga0207684_10549287 3300025910 Bacteria 988
189 Ga0207684_10664258 3300025910 Bacteria 887
190 Ga0207684_10724367 3300025910 Unclassified 844
191 Ga0207684_10775028 3300025910 Unclassified 812
192 Ga0207684_11259648 3300025910 Unclassified 610
193 Ga0207707_10834993 3300025912 Unclassified 765
194 Ga0207695_10017601 3300025913 Bacteria 8305
195 Ga0207695_11203218 3300025913 Unclassified 638
196 Ga0207671_10459956 3300025914 Unclassified 1014
197 Ga0207660_10200478 3300025917 Bacteria 1558
198 Ga0207662_10106465 3300025918 Bacteria 1744
199 Ga0207652_11343116 3300025921 Unclassified 618
200 Ga0207646_10003384 3300025922 Bacteria 18044
201 Ga0207646_10010517 3300025922 Bacteria 9030
202 Ga0207646_10129243 3300025922 Unclassified 2273
203 Ga0207646_10669068 3300025922 Unclassified 929
204 Ga0207646_10722766 3300025922 Unclassified 890
205 Ga0207694_10265066 3300025924 Bacteria 1408
206 Ga0207650_10325927 3300025925 Bacteria 1259
207 Ga0207650_11134890 3300025925 Bacteria 665
208 Ga0207687_10071970 3300025927 Bacteria 2471
209 Ga0207687_10160685 3300025927 Bacteria 1724
210 Ga0207700_10128954 3300025928 Bacteria 2062
211 Ga0207664_10049815 3300025929 Bacteria 3299
212 Ga0207664_10247300 3300025929 Bacteria 1555
213 Ga0207664_11458101 3300025929 Unclassified 606
214 Ga0207686_10000018 3300025934 Bacteria 189717
215 Ga0207686_10000021 3300025934 Bacteria 181793
216 Ga0207686_10011431 3300025934 Unclassified 4861
217 Ga0207686_10050233 3300025934 Bacteria 2592
218 Ga0207709_10000069 3300025935 Bacteria 183367
219 Ga0207709_11299264 3300025935 Unclassified 601
220 Ga0207670_10000137 3300025936 Bacteria 48112
221 Ga0207670_10835633 3300025936 Bacteria 769
222 Ga0207670_11761272 3300025936 Unclassified 527
223 Ga0207665_10037693 3300025939 Bacteria 3218
224 Ga0207711_10103750 3300025941 Bacteria 2518
225 Ga0207711_10222539 3300025941 Bacteria 1726
226 Ga0207651_10405165 3300025960 Unclassified 1161
227 Ga0207651_11956480 3300025960 Bacteria 527
228 Ga0207712_10118816 3300025961 Unclassified 1997
229 Ga0207640_10002808 3300025981 Bacteria 9335
230 Ga0207677_10364964 3300026023 Bacteria 1214
231 Ga0207703_10000242 3300026035 Bacteria 61824
232 Ga0207703_10606314 3300026035 Unclassified 1036
233 Ga0207703_10770636 3300026035 Unclassified 917
234 Ga0207639_10000006 3300026041 Bacteria 544415
235 Ga0207639_10416504 3300026041 Unclassified 1214
236 Ga0207708_10000012 3300026075 Bacteria 207611
237 Ga0207648_11190179 3300026089 Unclassified 716
238 Ga0207675_100019788 3300026118 Bacteria 6283
239 Ga0207675_101029564 3300026118 Bacteria 842
240 Ga0210002_1087109 3300027617 Unclassified 559
241 Ga0209588_1005790 3300027671 Bacteria 3558
242 Ga0209971_1046990 3300027682 Bacteria 1041
243 Ga0209966_1128346 3300027695 Unclassified 585
244 Ga0209974_10064280 3300027876 Bacteria 1245
245 Ga0207428_10006805 3300027907 Bacteria 10484
246 Ga0207428_10312455 3300027907 Unclassified 1162
247 Ga0265354_1000072 3300028016 Bacteria 16825
248 Ga0268266_10033819 3300028379 Unclassified 4344
249 Ga0268266_10892356 3300028379 Bacteria 860
250 Ga0268266_11391138 3300028379 Unclassified 677
251 Ga0268265_10278413 3300028380 Bacteria 1496
252 Ga0268265_10974467 3300028380 Bacteria 836
253 Ga0268265_11168793 3300028380 Unclassified 766
254 Ga0268265_11882225 3300028380 Bacteria 605
255 Ga0268264_10304193 3300028381 Unclassified 1502
256 Ga0265337_1063630 3300028556 Unclassified 1019
257 Ga0265326_10076103 3300028558 Unclassified 949
258 Ga0265334_10108657 3300028573 Unclassified 998
259 Ga0265323_10039946 3300028653 Bacteria 1709
260 Ga0265322_10077605 3300028654 Bacteria 942
261 Ga0265338_10019020 3300028800 Bacteria 7315
262 Ga0265338_10337005 3300028800 Archaea 1088
263 Ga0265324_10001021 3300029957 Bacteria 17213
264 Ga0265762_1008169 3300030760 Bacteria 1863
265 Ga0265770_1001280 3300030878 Bacteria 3468
266 Ga0265760_10007943 3300031090 Bacteria 3031
267 Ga0265760_10013011 3300031090 Bacteria 2382
268 Ga0265760_10041186 3300031090 Bacteria 1377
269 Ga0265330_10001610 3300031235 Bacteria 12892
270 Ga0265330_10036640 3300031235 Bacteria 2186
271 Ga0265332_10015992 3300031238 Bacteria 3311
272 Ga0265328_10165123 3300031239 Unclassified 835
273 Ga0265320_10283177 3300031240 Bacteria 734
274 Ga0265325_10025690 3300031241 Bacteria 3196
275 Ga0265329_10082701 3300031242 Bacteria 1016
276 Ga0265340_10000883 3300031247 Bacteria 16977
277 Ga0265339_10000693 3300031249 Bacteria 26066
278 Ga0265339_10075834 3300031249 Bacteria 1784
279 Ga0265339_10155111 3300031249 Bacteria 1155
280 Ga0265327_10238987 3300031251 Bacteria 812
281 Ga0265316_10042395 3300031344 Bacteria 3637
282 Ga0265313_10004816 3300031595 Bacteria 10154
283 Ga0265313_10344403 3300031595 Unclassified 592
284 Ga0316579_10124355 3300031691 Bacteria 1241
285 Ga0316579_10147334 3300031691 Unclassified 1135
286 Ga0265314_10037297 3300031711 Unclassified 3523
287 Ga0265314_10107589 3300031711 Unclassified 1779
288 Ga0265342_10061773 3300031712 Bacteria 2206
289 Ga0316577_10541296 3300031733 Unclassified 662
290 Ga0307412_10355855 3300031911 Bacteria 1177
291 Ga0316583_10209541 3300032133 Bacteria 676
292 Ga0373949_0043743 3300035090 Bacteria 1109
293 Ga0373932_0002577 3300035112 Bacteria 4532
294 Ga0373932_0185979 3300035112 Unclassified 731
295 Ga0373941_0083052 3300035115 Unclassified 1085
296 Ga0373961_0140195 3300035241 Unclassified 816
297 Ga0373931_0043905 3300035691 Unclassified 2356
298 Ga0373927_0335502 3300035695 Bacteria 996
299 Ga0373947_0676032 3300035725 Unclassified 704
300 Ga0316582_0240998 3300036647 Bacteria 1239
301 Ga0316582_0309055 3300036647 Bacteria 1087
302 Ga0373925_0235517 3300037068 Unclassified 1465
303 Ga0395901_0367287 3300038443 Bacteria 1483
304 Ga0400490_31574 3300038726 Bacteria 2817
305 Ga0400491_17428 3300038727 Unclassified 1017
306 Ga0242420_049800 3300038996 Bacteria 817
307 Ga0400483_012808 3300039062 Bacteria 1169
308 Ga0436365_0165902 3300039437 Bacteria 584
309 Ga0436365_1071700 3300039437 Bacteria 3305
310 Ga0436365_1847564 3300039437 Bacteria 9508
311 Ga0436360_0749120 3300039438 Unclassified 852
312 Ga0436360_1112407 3300039438 Bacteria 1774
313 Ga0451853_3855770 3300041512 Bacteria 1460
314 Ga0450920_002897 3300042122 Bacteria 2951
315 Ga0450908_000150 3300042184 Bacteria 14530
316 Ga0439434_0367395 3300042435 Bacteria 504
317 Ga0451577_0001243 3300042876 Bacteria 35284
318 Ga0451577_0004170 3300042876 Bacteria 15447
319 Ga0451577_0012255 3300042876 Bacteria 8057
320 Ga0451577_0017229 3300042876 Bacteria 6679
321 Ga0451577_0621142 3300042876 Bacteria 980
322 Ga0451577_0690461 3300042876 Unclassified 925
323 Ga0453683_0000037 3300044673 Bacteria 230268
324 Ga0453683_0001084 3300044673 Bacteria 25080
325 Ga0453683_0006802 3300044673 Bacteria 7812
326 Ga0453683_0028177 3300044673 Bacteria 3557
327 Ga0453683_0037806 3300044673 Bacteria 3035
328 Ga0453683_0064541 3300044673 Bacteria 2289
329 Ga0453683_0200969 3300044673 Bacteria 1265
330 Ga0453684_0000563 3300044712 Bacteria 139887
331 Ga0453684_0018520 3300044712 Bacteria 10682
332 Ga0453684_0026784 3300044712 Bacteria 8307
333 Ga0453684_0035560 3300044712 Bacteria 6881
334 Ga0453684_0042792 3300044712 Bacteria 6099
335 Ga0453684_0058316 3300044712 Bacteria 4988
336 Ga0453684_0582835 3300044712 Bacteria 1228
337 Ga0453684_0809612 3300044712 Unclassified 1010
338 Ga0453684_0822393 3300044712 Unclassified 1000
339 Ga0451576_0008856 3300045051 Bacteria 11754
340 Ga0451576_0014561 3300045051 Bacteria 8741
341 Ga0451576_0022093 3300045051 Bacteria 6903
342 Ga0451576_0354583 3300045051 Bacteria 1536
343 Ga0451576_1472013 3300045051 Unclassified 708
344 Ga0451576_2190703 3300045051 Unclassified 567
345 Ga0466967_0526392 3300045976 Bacteria 1162
346 Ga0466967_0696183 3300045976 Bacteria 1006
347 Ga0495641_0201164 3300046461 Bacteria 893
348 Ga0495651_0234858 3300046462 Bacteria 1261
349 Ga0495580_0491034 3300046472 Unclassified 820
350 Ga0495582_0015921 3300046473 Bacteria 4122
351 Ga0495639_0014594 3300046475 Bacteria 3403
352 Ga0495594_0172121 3300046499 Bacteria 1232
353 Ga0495666_0085132 3300046526 Bacteria 1493
354 Ga0495642_0044687 3300046528 Bacteria 1809
355 Ga0495665_0129148 3300046531 Unclassified 1323
356 Ga0495665_0316716 3300046531 Unclassified 797
357 Ga0495586_0058615 3300046535 Bacteria 2091
358 Ga0495586_0293155 3300046535 Bacteria 932
359 Ga0495598_0191786 3300046537 Unclassified 734
360 Ga0495667_0398302 3300046559 Unclassified 867
361 Ga0495634_0062391 3300046642 Bacteria 2475
362 Ga0495634_0120269 3300046642 Bacteria 1682
363 Ga0495659_0009348 3300046664 Bacteria 3127
364 Ga0495659_0034956 3300046664 Bacteria 1769
365 Ga0495658_0115896 3300046683 Bacteria 1615
366 Ga0495600_0346568 3300046809 Bacteria 931
367 Ga0495636_0026284 3300047318 Bacteria 2367
368 Ga0495636_0663277 3300047318 Unclassified 513
369 Ga0496114_0000020 3300048917 Bacteria 238645
370 Ga0501032_0064276 3300049569 Bacteria 2456
371 Ga0501032_0328601 3300049569 Unclassified 986
372 Ga0501032_0440030 3300049569 Bacteria 836
373 Ga0501033_0005607 3300049570 Bacteria 9916
374 Ga0501033_0683446 3300049570 Unclassified 699
375 Ga0501034_0220234 3300049571 Bacteria 1850
376 Ga0501034_1699737 3300049571 Unclassified 503
377 Ga0501036_0461218 3300049572 Bacteria 1058
378 Ga0501036_1271415 3300049572 Bacteria 599
379 Ga0501036_1700974 3300049572 Bacteria 508
380 Ga0501037_0022999 3300049573 Bacteria 4609
381 Ga0501037_0035011 3300049573 Bacteria 3704
382 Ga0501038_0021761 3300049574 Bacteria 5754
383 Ga0501038_0581384 3300049574 Unclassified 849
384 Ga0501039_0574231 3300049575 Unclassified 884
385 Ga0501039_1153210 3300049575 Unclassified 600
386 Ga0501040_0064591 3300049576 Bacteria 2520
387 Ga0501040_0485217 3300049576 Bacteria 891
388 Ga0501040_0852825 3300049576 Bacteria 659
389 Ga0501041_0204768 3300049577 Bacteria 1237
390 Ga0501041_1005955 3300049577 Unclassified 536
391 Ga0501042_0174283 3300049578 Bacteria 1552
392 Ga0501042_0347268 3300049578 Unclassified 1073
393 Ga0501043_0038973 3300049579 Bacteria 3735
394 Ga0501043_0374212 3300049579 Bacteria 1079
395 Ga0501046_0030093 3300049580 Bacteria 4409
396 Ga0501046_0107563 3300049580 Bacteria 2134
397 Ga0501046_0622808 3300049580 Unclassified 764
398 Ga0501048_0030219 3300049582 Bacteria 3920
399 Ga0501048_0708191 3300049582 Bacteria 723
400 Ga0501067_0099721 3300049583 Bacteria 1613
401 Ga0501068_0209731 3300049584 Bacteria 1237
402 Ga0501068_0599464 3300049584 Unclassified 718
403 Ga0501068_0677038 3300049584 Unclassified 674
404 Ga0501068_0703227 3300049584 Unclassified 661
405 Ga0501068_0762977 3300049584 Unclassified 633
406 Ga0501069_0005730 3300049585 Bacteria 6476
407 Ga0501070_0137345 3300049586 Bacteria 2018
408 Ga0501070_0151186 3300049586 Bacteria 1915
409 Ga0501071_0064198 3300049587 Bacteria 2664
410 Ga0501071_0233323 3300049587 Bacteria 1387
411 Ga0501071_0810352 3300049587 Bacteria 722
412 Ga0501072_0098684 3300049588 Bacteria 2322
413 Ga0501072_0105099 3300049588 Bacteria 2245
414 Ga0501072_0485627 3300049588 Unclassified 977
415 Ga0501072_0711162 3300049588 Unclassified 789
416 Ga0501073_0091946 3300049589 Bacteria 2109
417 Ga0501073_0134082 3300049589 Bacteria 1716
418 Ga0501073_0215904 3300049589 Bacteria 1325
419 Ga0501074_0020382 3300049590 Bacteria 4819
420 Ga0501074_0523084 3300049590 Unclassified 840
421 Ga0501075_0028280 3300049591 Bacteria 4138
422 Ga0501075_0147243 3300049591 Bacteria 1795
423 Ga0501075_0546402 3300049591 Bacteria 884
424 Ga0501075_1273970 3300049591 Bacteria 557
425 Ga0501076_0041326 3300049592 Bacteria 3627
426 Ga0501076_0240132 3300049592 Bacteria 1482
427 Ga0501076_0471685 3300049592 Bacteria 1034
428 Ga0501076_0578527 3300049592 Bacteria 926
429 Ga0501076_0913669 3300049592 Unclassified 724
430 Ga0501076_1590834 3300049592 Unclassified 536
431 Ga0501076_1591543 3300049592 Unclassified 536
432 Ga0501077_0273057 3300049593 Unclassified 1076
433 Ga0501077_0877752 3300049593 Bacteria 577
434 Ga0501079_0029563 3300049741 Bacteria 4207
435 Ga0501079_0142571 3300049741 Bacteria 1866
436 Ga0501079_0430257 3300049741 Bacteria 1036
437 Ga0501079_0671848 3300049741 Bacteria 815
438 Ga0501079_0769859 3300049741 Unclassified 758
439 Ga0501079_0846088 3300049741 Unclassified 720
440 Ga0501079_1558572 3300049741 Bacteria 520
441 Ga0501080_0216115 3300049742 Bacteria 1756
442 Ga0501080_1538728 3300049742 Unclassified 564
443 Ga0501081_0006148 3300049743 Bacteria 7781
444 Ga0501081_0240224 3300049743 Bacteria 1321
445 Ga0501081_0282741 3300049743 Unclassified 1215
446 Ga0501081_0321448 3300049743 Unclassified 1137
447 Ga0501081_0449567 3300049743 Unclassified 957
448 Ga0501083_0016372 3300049744 Bacteria 5189
449 Ga0501083_0527133 3300049744 Bacteria 769
450 Ga0501035_0011413 3300049822 Bacteria 8237
451 Ga0501035_1055336 3300049822 Unclassified 636
452 Ga0501035_1251655 3300049822 Unclassified 574
453 Ga0501044_0077367 3300049823 Bacteria 3374
454 Ga0501044_0320855 3300049823 Unclassified 1473
455 Ga0501045_0166577 3300049824 Bacteria 1641
456 Ga0501045_0369005 3300049824 Bacteria 1068
457 Ga0501045_0398077 3300049824 Bacteria 1025
458 nmdc:mga03683_6104_c1 3300050489 Bacteria 4108
459 nmdc:mga00v17_11492_c1 3300050491 Bacteria 4865
460 nmdc:mga0yw44_1179738_c1 3300050492 Bacteria 517
461 nmdc:mga0k408_33161_c1 3300050493 Bacteria 2953
462 nmdc:mga0k408_528574_c1 3300050493 Bacteria 698
463 nmdc:mga06z11_8762_c1 3300050494 Bacteria 4237
464 nmdc:mga04h51_28411_c1 3300050495 Unclassified 1744
465 nmdc:mga05p37_26506_c1 3300050507 Bacteria 7049
466 nmdc:mga09592_1136129_c1 3300050508 Unclassified 648
467 nmdc:mga09592_1410100_c1 3300050508 Unclassified 569
468 nmdc:mga09592_257140_c1 3300050508 Bacteria 1514
469 nmdc:mga09592_69552_c1 3300050508 Bacteria 2986
470 nmdc:mga0qj67_310457_c1 3300050509 Bacteria 1277
471 nmdc:mga0qj67_945151_c1 3300050509 Unclassified 678
472 nmdc:mga0qj67_98003_c1 3300050509 Bacteria 2361
473 nmdc:mga06r32_213622_c1 3300050510 Bacteria 1917
474 nmdc:mga06r32_3304_c1 3300050510 Bacteria 14446
475 nmdc:mga06r32_625359_c1 3300050510 Bacteria 1046
476 nmdc:mga06r32_881186_c1 3300050510 Unclassified 852
477 nmdc:mga08y16_576436_c1 3300050511 Unclassified 1137
478 nmdc:mga08y16_93711_c1 3300050511 Bacteria 3129
479 nmdc:mga0n895_1675810_c1 3300050512 Unclassified 599
480 nmdc:mga0n895_2117604_c1 3300050512 Unclassified 519
481 nmdc:mga0rr50_1720415_c1 3300050513 Unclassified 528
482 nmdc:mga08x19_234095_c1 3300050514 Bacteria 1265
483 nmdc:mga0a205_1492103_c1 3300050515 Unclassified 524
484 nmdc:mga0a205_192144_c2 3300050515 Bacteria 1589
485 nmdc:mga0a205_79678_c1 3300050515 Bacteria 3165
486 Ga0495601_0092775 3300053077 Bacteria 1945
487 Ga0495595_0341331 3300053084 Unclassified 755
488 Ga0495619_0278153 3300053085 Bacteria 1160
489 Ga0500641_0008958 3300053096 Unclassified 3586
490 Ga0501084_0033191 3300054114 Bacteria 4317
491 Ga0501084_0084303 3300054114 Unclassified 2668
492 Ga0501084_0384611 3300054114 Unclassified 1186
493 Ga0501084_0912058 3300054114 Bacteria 739
494 Ga0590074_000687 3300059423 Bacteria 5154
495 Ga0590075_000299 3300059424 Bacteria 13936
496 Ga0590077_001461 3300059426 Bacteria 5524
497 Ga0501082_0076767 3300060353 Bacteria 2880
498 Ga0501082_0195806 3300060353 Unclassified 1758
499 Ga0501082_0422414 3300060353 Bacteria 1164
500 Ga0501082_0586378 3300060353 Unclassified 975
501 Ga0501082_0686502 3300060353 Bacteria 896
502 Ga0530510_0030303 3300061734 Bacteria 3886
503 Ga0530510_0082723 3300061734 Bacteria 2337
504 Ga0530510_0569454 3300061734 Bacteria 861
505 Ga0530510_0626238 3300061734 Bacteria 819
506 Ga0070717_10173170
507 MBSR1b_contig_1894739
508 Ga0065715_10318808
509 Ga0065707_10006433
510 Ga0065707_10316432
511 Ga0065707_10706300
512 Ga0070690_100003752
513 Ga0070670_100722969
514 Ga0070680_100017690
515 Ga0070689_100000064
516 Ga0070687_100174151
517 Ga0070687_101119427
518 Ga0070668_101259352
519 Ga0070669_101068972
520 Ga0070675_101643236
521 Ga0070674_100515370
522 Ga0070674_100995539
523 Ga0070673_100820204
524 Ga0070673_101140234
525 Ga0070673_101207932
526 Ga0070688_100702095
527 Ga0070688_101220875
528 Ga0070667_100087723
529 Ga0070709_10000047
530 Ga0070709_10230278
531 Ga0070714_100266083
532 Ga0070714_100423036
533 Ga0070713_100004553
534 Ga0070713_101111114
535 Ga0070701_10752653
536 Ga0070705_100000397
537 Ga0070705_100882911
538 Ga0070700_100000014
539 Ga0070694_100001151
540 Ga0070694_101170654
541 Ga0070708_100089955
542 Ga0070708_100887708
543 Ga0068867_100112186
544 Ga0070706_100028238
545 Ga0070706_101028937
546 Ga0070706_101075298
547 Ga0070706_101462738
548 Ga0070707_100011962
549 Ga0070707_100014454
550 Ga0070707_100107968
551 Ga0070707_100272613
552 Ga0070707_100671070
553 Ga0070707_100830159
554 Ga0070698_100037437
555 Ga0070698_100867065
556 Ga0070698_101550965
557 Ga0070699_100062527
558 Ga0070699_100090226
559 Ga0070699_101247098
560 Ga0070699_101921431
561 Ga0070679_100583313
562 Ga0070679_100672034
563 Ga0070697_100103564
564 Ga0070697_100492478
565 Ga0070697_100909684
566 Ga0070697_101201690
567 Ga0068853_100032591
568 Ga0068853_100492776
569 Ga0070672_101957332
570 Ga0070686_100321905
571 Ga0070686_100628291
572 Ga0070695_100140196
573 Ga0070695_100986125
574 Ga0070696_100006582
575 Ga0070696_101909205
576 Ga0070693_100000910
577 Ga0070665_100030064
578 Ga0070704_100039915
579 Ga0070704_100568596
580 Ga0068854_100002517
581 Ga0070702_100121804
582 Ga0068859_100005876
583 Ga0068859_100164743
584 Ga0068859_100486617
585 Ga0068859_100521968
586 Ga0068859_100601623
587 Ga0068859_102491996
588 Ga0068864_101749112
589 Ga0068866_10068147
590 Ga0068866_11455786
591 Ga0068861_101479430
592 Ga0068863_101061318
593 Ga0068858_100000090
594 Ga0068858_100113397
595 Ga0068860_100072827
596 Ga0068862_101021653
597 Ga0068862_101454162
598 Ga0068862_101559058
599 Ga0068862_102717717
600 Ga0081455_10608474
601 Ga0081455_10938335
602 Ga0081540_1281326
603 Ga0075365_11190056
604 Ga0075368_10045854
605 Ga0075364_10003106
606 Ga0075364_10283763
607 Ga0070716_100295762
608 Ga0075362_10005841
609 Ga0075367_10007054
610 Ga0075366_10007092
611 Ga0075366_10481548
612 Ga0097621_101031813
613 Ga0097621_102123900
614 Ga0075428_100016099
615 Ga0075428_100164747
616 Ga0075428_100184366
617 Ga0075428_100300145
618 Ga0075428_101832695
619 Ga0075430_100158401
620 Ga0075430_100674411
621 Ga0075431_100004803
622 Ga0075431_100089997
623 Ga0075431_100690057
624 Ga0075431_101037021
625 Ga0075431_101590629
626 Ga0075433_10348937
627 Ga0075433_10573179
628 Ga0075434_100479332
629 Ga0075434_100748573
630 Ga0075434_101841453
631 Ga0075429_100299424
632 Ga0075429_100384038
633 Ga0075429_101438699
634 Ga0075429_101580251
635 Ga0075436_100041655
636 Ga0075436_100248781
637 Ga0097620_100005876
638 Ga0097620_100164734
639 Ga0097620_100486627
640 Ga0097620_100521998
641 Ga0097620_100601620
642 Ga0097620_102492072
643 Ga0075435_100436517
644 Ga0075435_101713677
645 Ga0099795_10119968
646 Ga0105240_10066731
647 Ga0105240_10306628
648 Ga0105240_10693499
649 Ga0105240_11082829
650 Ga0105240_12025869
651 Ga0111539_10051945
652 Ga0111539_10253402
653 Ga0111539_10700807
654 Ga0105245_10021704
655 Ga0114129_10017792
656 Ga0114129_10032439
657 Ga0114129_10121908
658 Ga0105243_10000182
659 Ga0105243_10756897
660 Ga0105243_10991043
661 Ga0105242_10000103
662 Ga0105242_10078133
663 Ga0105242_10079172
664 Ga0105242_10774948
665 Ga0105248_10161205
666 Ga0105248_12046578
667 Ga0105237_10716390
668 Ga0105238_10202315
669 Ga0105249_10123683
670 Ga0105249_11574398
671 Ga0105249_11851000
672 Ga0105249_12142225
673 Ga0099796_10215361
674 Ga0157336_1035079
675 Ga0157338_1005667
676 Ga0157371_11112572
677 Ga0157370_10009912
678 Ga0157374_10056120
679 Ga0157378_10594879
680 Ga0157378_11936542
681 Ga0163162_11179400
682 Ga0157372_10676422
683 Ga0157372_12671252
684 Ga0157375_10970820
685 Ga0157379_11261342
686 Ga0157376_10056791
687 Ga0213876_10019053
688 Ga0213876_10024090
689 Ga0207653_10360604
690 Ga0207699_10000056
691 Ga0207699_10546194
692 Ga0207699_10611835
693 Ga0207684_10549287
694 Ga0207684_10664258
695 Ga0207684_10724367
696 Ga0207684_10775028
697 Ga0207684_11259648
698 Ga0207707_10834993
699 Ga0207695_10017601
700 Ga0207695_11203218
701 Ga0207671_10459956
702 Ga0207660_10200478
703 Ga0207662_10106465
704 Ga0207652_11343116
705 Ga0207646_10003384
706 Ga0207646_10010517
707 Ga0207646_10129243
708 Ga0207646_10669068
709 Ga0207646_10722766
710 Ga0207694_10265066
711 Ga0207650_10325927
712 Ga0207650_11134890
713 Ga0207687_10071970
714 Ga0207687_10160685
715 Ga0207700_10128954
716 Ga0207664_10049815
717 Ga0207664_10247300
718 Ga0207664_11458101
719 Ga0207686_10000018
720 Ga0207686_10000021
721 Ga0207686_10011431
722 Ga0207686_10050233
723 Ga0207709_10000069
724 Ga0207709_11299264
725 Ga0207670_10000137
726 Ga0207670_10835633
727 Ga0207670_11761272
728 Ga0207665_10037693
729 Ga0207711_10103750
730 Ga0207711_10222539
731 Ga0207651_10405165
732 Ga0207651_11956480
733 Ga0207712_10118816
734 Ga0207640_10002808
735 Ga0207677_10364964
736 Ga0207703_10000242
737 Ga0207703_10606314
738 Ga0207703_10770636
739 Ga0207639_10000006
740 Ga0207639_10416504
741 Ga0207708_10000012
742 Ga0207648_11190179
743 Ga0207675_100019788
744 Ga0207675_101029564
745 Ga0210002_1087109
746 Ga0209588_1005790
747 Ga0209971_1046990
748 Ga0209966_1128346
749 Ga0209974_10064280
750 Ga0207428_10006805
751 Ga0207428_10312455
752 Ga0265354_1000072
753 Ga0268266_10033819
754 Ga0268266_10892356
755 Ga0268266_11391138
756 Ga0268265_10278413
757 Ga0268265_10974467
758 Ga0268265_11168793
759 Ga0268265_11882225
760 Ga0268264_10304193
761 Ga0265337_1063630
762 Ga0265326_10076103
763 Ga0265334_10108657
764 Ga0265323_10039946
765 Ga0265322_10077605
766 Ga0265338_10019020
767 Ga0265338_10337005
768 Ga0265324_10001021
769 Ga0265762_1008169
770 Ga0265770_1001280
771 Ga0265760_10007943
772 Ga0265760_10013011
773 Ga0265760_10041186
774 Ga0265330_10001610
775 Ga0265330_10036640
776 Ga0265332_10015992
777 Ga0265328_10165123
778 Ga0265320_10283177
779 Ga0265325_10025690
780 Ga0265329_10082701
781 Ga0265340_10000883
782 Ga0265339_10000693
783 Ga0265339_10075834
784 Ga0265339_10155111
785 Ga0265327_10238987
786 Ga0265316_10042395
787 Ga0265313_10004816
788 Ga0265313_10344403
789 Ga0316579_10124355
790 Ga0316579_10147334
791 Ga0265314_10037297
792 Ga0265314_10107589
793 Ga0265342_10061773
794 Ga0316577_10541296
795 Ga0307412_10355855
796 Ga0316583_10209541
797 Ga0373949_0043743
798 Ga0373932_0002577
799 Ga0373932_0185979
800 Ga0373941_0083052
801 Ga0373961_0140195
802 Ga0373931_0043905
803 Ga0373927_0335502
804 Ga0373947_0676032
805 Ga0316582_0240998
806 Ga0316582_0309055
807 Ga0373925_0235517
808 Ga0395901_0367287
809 Ga0400490_31574
810 Ga0400491_17428
811 Ga0242420_049800
812 Ga0400483_012808
813 Ga0436365_0165902
814 Ga0436365_1071700
815 Ga0436365_1847564
816 Ga0436360_0749120
817 Ga0436360_1112407
818 Ga0451853_3855770
819 Ga0450920_002897
820 Ga0450908_000150
821 Ga0439434_0367395
822 Ga0451577_0001243
823 Ga0451577_0004170
824 Ga0451577_0012255
825 Ga0451577_0017229
826 Ga0451577_0621142
827 Ga0451577_0690461
828 Ga0453683_0000037
829 Ga0453683_0001084
830 Ga0453683_0006802
831 Ga0453683_0028177
832 Ga0453683_0037806
833 Ga0453683_0064541
834 Ga0453683_0200969
835 Ga0453684_0000563
836 Ga0453684_0018520
837 Ga0453684_0026784
838 Ga0453684_0035560
839 Ga0453684_0042792
840 Ga0453684_0058316
841 Ga0453684_0582835
842 Ga0453684_0809612
843 Ga0453684_0822393
844 Ga0451576_0008856
845 Ga0451576_0014561
846 Ga0451576_0022093
847 Ga0451576_0354583
848 Ga0451576_1472013
849 Ga0451576_2190703
850 Ga0466967_0526392
851 Ga0466967_0696183
852 Ga0495641_0201164
853 Ga0495651_0234858
854 Ga0495580_0491034
855 Ga0495582_0015921
856 Ga0495639_0014594
857 Ga0495594_0172121
858 Ga0495666_0085132
859 Ga0495642_0044687
860 Ga0495665_0129148
861 Ga0495665_0316716
862 Ga0495586_0058615
863 Ga0495586_0293155
864 Ga0495598_0191786
865 Ga0495667_0398302
866 Ga0495634_0062391
867 Ga0495634_0120269
868 Ga0495659_0009348
869 Ga0495659_0034956
870 Ga0495658_0115896
871 Ga0495600_0346568
872 Ga0495636_0026284
873 Ga0495636_0663277
874 Ga0496114_0000020
875 Ga0501032_0064276
876 Ga0501032_0328601
877 Ga0501032_0440030
878 Ga0501033_0005607
879 Ga0501033_0683446
880 Ga0501034_0220234
881 Ga0501034_1699737
882 Ga0501036_0461218
883 Ga0501036_1271415
884 Ga0501036_1700974
885 Ga0501037_0022999
886 Ga0501037_0035011
887 Ga0501038_0021761
888 Ga0501038_0581384
889 Ga0501039_0574231
890 Ga0501039_1153210
891 Ga0501040_0064591
892 Ga0501040_0485217
893 Ga0501040_0852825
894 Ga0501041_0204768
895 Ga0501041_1005955
896 Ga0501042_0174283
897 Ga0501042_0347268
898 Ga0501043_0038973
899 Ga0501043_0374212
900 Ga0501046_0030093
901 Ga0501046_0107563
902 Ga0501046_0622808
903 Ga0501048_0030219
904 Ga0501048_0708191
905 Ga0501067_0099721
906 Ga0501068_0209731
907 Ga0501068_0599464
908 Ga0501068_0677038
909 Ga0501068_0703227
910 Ga0501068_0762977
911 Ga0501069_0005730
912 Ga0501070_0137345
913 Ga0501070_0151186
914 Ga0501071_0064198
915 Ga0501071_0233323
916 Ga0501071_0810352
917 Ga0501072_0098684
918 Ga0501072_0105099
919 Ga0501072_0485627
920 Ga0501072_0711162
921 Ga0501073_0091946
922 Ga0501073_0134082
923 Ga0501073_0215904
924 Ga0501074_0020382
925 Ga0501074_0523084
926 Ga0501075_0028280
927 Ga0501075_0147243
928 Ga0501075_0546402
929 Ga0501075_1273970
930 Ga0501076_0041326
931 Ga0501076_0240132
932 Ga0501076_0471685
933 Ga0501076_0578527
934 Ga0501076_0913669
935 Ga0501076_1590834
936 Ga0501076_1591543
937 Ga0501077_0273057
938 Ga0501077_0877752
939 Ga0501079_0029563
940 Ga0501079_0142571
941 Ga0501079_0430257
942 Ga0501079_0671848
943 Ga0501079_0769859
944 Ga0501079_0846088
945 Ga0501079_1558572
946 Ga0501080_0216115
947 Ga0501080_1538728
948 Ga0501081_0006148
949 Ga0501081_0240224
950 Ga0501081_0282741
951 Ga0501081_0321448
952 Ga0501081_0449567
953 Ga0501083_0016372
954 Ga0501083_0527133
955 Ga0501035_0011413
956 Ga0501035_1055336
957 Ga0501035_1251655
958 Ga0501044_0077367
959 Ga0501044_0320855
960 Ga0501045_0166577
961 Ga0501045_0369005
962 Ga0501045_0398077
963 nmdc:mga03683_6104_c1
964 nmdc:mga00v17_11492_c1
965 nmdc:mga0yw44_1179738_c1
966 nmdc:mga0k408_33161_c1
967 nmdc:mga0k408_528574_c1
968 nmdc:mga06z11_8762_c1
969 nmdc:mga04h51_28411_c1
970 nmdc:mga05p37_26506_c1
971 nmdc:mga09592_1136129_c1
972 nmdc:mga09592_1410100_c1
973 nmdc:mga09592_257140_c1
974 nmdc:mga09592_69552_c1
975 nmdc:mga0qj67_310457_c1
976 nmdc:mga0qj67_945151_c1
977 nmdc:mga0qj67_98003_c1
978 nmdc:mga06r32_213622_c1
979 nmdc:mga06r32_3304_c1
980 nmdc:mga06r32_625359_c1
981 nmdc:mga06r32_881186_c1
982 nmdc:mga08y16_576436_c1
983 nmdc:mga08y16_93711_c1
984 nmdc:mga0n895_1675810_c1
985 nmdc:mga0n895_2117604_c1
986 nmdc:mga0rr50_1720415_c1
987 nmdc:mga08x19_234095_c1
988 nmdc:mga0a205_1492103_c1
989 nmdc:mga0a205_192144_c2
990 nmdc:mga0a205_79678_c1
991 Ga0495601_0092775
992 Ga0495595_0341331
993 Ga0495619_0278153
994 Ga0500641_0008958
995 Ga0501084_0033191
996 Ga0501084_0084303
997 Ga0501084_0384611
998 Ga0501084_0912058
999 Ga0590074_000687
1000 Ga0590075_000299
1001 Ga0590077_001461
1002 Ga0501082_0076767
1003 Ga0501082_0195806
1004 Ga0501082_0422414
1005 Ga0501082_0586378
1006 Ga0501082_0686502
1007 Ga0530510_0030303
1008 Ga0530510_0082723
1009 Ga0530510_0569454
1010 Ga0530510_0626238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

4

112

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.9272 2 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9225 1 114
5hk0-assembly2.cif.gz_D crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9216 5 114
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.9187 2 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9143 1 114
ID Description Score Start End Superfamily
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.896 5 113 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8793 5 113 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.8718 2 114 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8712 5 113 2.30.30.110
4me7C00 Mainly Beta;Roll;SH3 type barrels.; 0.8683 2 113 2.30.30.110
ID Description Score Start End GO Terms
AF-D5MFK6-F1-model_v4 Uncharacterized protein 0.9966 49 114 GO:0003677
AF-A0A841GR93-F1-model_v4 mRNA-degrading endonuclease toxin of MazEF toxin-antitoxin module 0.981 44 113 GO:0003677
GO:0004519
AF-A0A7Z8PAQ2-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9797 46 113 GO:0003677
AF-A0A838EDU1-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9735 40 113 GO:0003677
AF-A0A2U3K4V0-F1-model_v4 mRNA interferase (EC 3.1.-.-) 0.9701 46 113 GO:0003677
GO:0016787

Map