F456038

General Info

Members Datasets Scaffolds Average Seq Length
503 299 1006 182

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10640900|Ga0307516_106409001
Length 198
Sequence MRPPRQTESRTRQTRSMKVTRTAIEGVLILEPKVFGDARGFFTESFNQKVFNDAVGGEVVFVQDNHSRSTKGVLRGLHYQLPPHAQGKLVRVVQGSVYDVAVDVRRDSPTFGQWVGVELDGDTQRQLWLPSGMAHGFLVTSESADFLYKTTDYYVPAAEGCVLWSDPALGIAWPDVGCAPRLAAKDAAAPPLSKASLF

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
273 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
274 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
289 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
293 2842677519 Variovorax sp. R-72495 Isolate Unclassified
294 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
295 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
296 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
297 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
298 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
299 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.2
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 0.4
Rhizoplane 1.79
Rhizosphere 74.95
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10640900 3300031730 Bacteria 717
2 JGI24752J21851_1003244 3300001976 Bacteria 2145
3 JGI24035J26624_1002723 3300002126 Bacteria 1647
4 JGI24034J26672_10032479 3300002239 Bacteria 855
5 Ga0055535_1000079 3300003761 Bacteria 109482
6 Ga0055542_1033630 3300003762 Bacteria 639
7 Ga0055529_1000311 3300003763 Bacteria 56033
8 Ga0065714_10005436 3300005288 Bacteria 4160
9 Ga0065714_10140976 3300005288 Unclassified 1172
10 Ga0070658_10062371 3300005327 Bacteria 3038
11 Ga0070676_10071072 3300005328 Bacteria 2090
12 Ga0070670_100003700 3300005331 Bacteria 12742
13 Ga0070670_100007464 3300005331 Bacteria 9284
14 Ga0070677_10012477 3300005333 Bacteria 2951
15 Ga0070677_10330070 3300005333 Bacteria 784
16 Ga0070666_10000305 3300005335 Bacteria 31836
17 Ga0070682_100230890 3300005337 Bacteria 1323
18 Ga0068868_100075820 3300005338 Bacteria 2688
19 Ga0070669_100000013 3300005353 Bacteria 210577
20 Ga0070669_100009422 3300005353 Bacteria 6953
21 Ga0070675_100013001 3300005354 Bacteria 6536
22 Ga0070671_100000009 3300005355 Bacteria 206508
23 Ga0070671_100007464 3300005355 Bacteria 8740
24 Ga0070674_100024590 3300005356 Bacteria 3911
25 Ga0070674_100174675 3300005356 Bacteria 1641
26 Ga0070673_100059165 3300005364 Bacteria 3032
27 Ga0070659_100031324 3300005366 Bacteria 4118
28 Ga0070659_100468845 3300005366 Bacteria 1070
29 Ga0070667_100000461 3300005367 Bacteria 41911
30 Ga0070667_100000606 3300005367 Bacteria 34995
31 Ga0070667_100077194 3300005367 Bacteria 2844
32 Ga0070667_100500427 3300005367 Bacteria 1114
33 Ga0070714_100001810 3300005435 Bacteria 15531
34 Ga0070705_100018572 3300005440 Bacteria 3647
35 Ga0070708_100830147 3300005445 Bacteria 869
36 Ga0070678_100014023 3300005456 Bacteria 5040
37 Ga0070678_100052378 3300005456 Bacteria 2964
38 Ga0070662_100064153 3300005457 Bacteria 2689
39 Ga0068867_100000453 3300005459 Bacteria 27171
40 Ga0068867_100022588 3300005459 Bacteria 4497
41 Ga0068867_100439261 3300005459 Bacteria 1109
42 Ga0070685_10493384 3300005466 Bacteria 865
43 Ga0070707_100882545 3300005468 Unclassified 859
44 Ga0070698_100602336 3300005471 Bacteria 1039
45 Ga0070672_100004699 3300005543 Bacteria 8956
46 Ga0070672_100230996 3300005543 Bacteria 1554
47 Ga0070665_100006191 3300005548 Bacteria 12245
48 Ga0070665_100147912 3300005548 Bacteria 2352
49 Ga0070665_100743805 3300005548 Bacteria 994
50 Ga0068855_100001856 3300005563 Bacteria 26268
51 Ga0070664_100075216 3300005564 Bacteria 2900
52 Ga0070664_100139805 3300005564 Bacteria 2131
53 Ga0070664_100153636 3300005564 Bacteria 2033
54 Ga0068859_100008911 3300005617 Bacteria 10132
55 Ga0068859_101249707 3300005617 Bacteria 818
56 Ga0068864_100005285 3300005618 Bacteria 10581
57 Ga0068861_100004489 3300005719 Bacteria 9368
58 Ga0068851_10047180 3300005834 Bacteria 2181
59 Ga0068863_100019345 3300005841 Bacteria 6513
60 Ga0068863_100334334 3300005841 Bacteria 1473
61 Ga0068858_100005784 3300005842 Bacteria 12077
62 Ga0068860_100007265 3300005843 Bacteria 11079
63 Ga0068860_100200230 3300005843 Bacteria 1935
64 Ga0068860_100551244 3300005843 Bacteria 1155
65 Ga0068862_100000876 3300005844 Bacteria 29314
66 Ga0070717_10052375 3300006028 Bacteria 3362
67 Ga0075363_100059091 3300006048 Bacteria 2061
68 Ga0075364_10056820 3300006051 Bacteria 2563
69 Ga0070716_100360597 3300006173 Bacteria 1032
70 Ga0075362_10020995 3300006177 Bacteria 2735
71 Ga0075367_10000791 3300006178 Bacteria 12445
72 Ga0075369_10260398 3300006186 Bacteria 806
73 Ga0075366_10006153 3300006195 Bacteria 6548
74 Ga0097621_100016738 3300006237 Bacteria 5553
75 Ga0075370_10006432 3300006353 Bacteria 5907
76 Ga0075370_10013904 3300006353 Bacteria 4284
77 Ga0075370_10015898 3300006353 Bacteria 4040
78 Ga0075370_10017534 3300006353 Bacteria 3870
79 Ga0075370_10077680 3300006353 Bacteria 1905
80 Ga0075370_10392352 3300006353 Bacteria 832
81 Ga0068871_100492605 3300006358 Bacteria 1104
82 Ga0097620_100008911 3300006931 Bacteria 10132
83 Ga0097620_101249671 3300006931 Bacteria 818
84 Ga0079104_1012310 3300006946 Bacteria 2697
85 Ga0099795_10088875 3300007788 Bacteria 1195
86 Ga0105240_10056275 3300009093 Bacteria 4922
87 Ga0111539_10023456 3300009094 Bacteria 7582
88 Ga0105245_10187860 3300009098 Bacteria 1977
89 Ga0105245_10411263 3300009098 Bacteria 1354
90 Ga0105247_10000831 3300009101 Bacteria 23501
91 Ga0105243_10002357 3300009148 Bacteria 15813
92 Ga0105248_10706050 3300009177 Bacteria 1138
93 Ga0105237_10674742 3300009545 Bacteria 1040
94 Ga0105249_10520254 3300009553 Bacteria 1237
95 Ga0105239_10141904 3300010375 Bacteria 2677
96 Ga0105239_11365675 3300010375 Bacteria 818
97 Ga0105246_10906197 3300011119 Unclassified 791
98 Ga0105246_11678570 3300011119 Bacteria 603
99 Ga0157370_10001358 3300013104 Bacteria 30312
100 Ga0157370_10768931 3300013104 Bacteria 877
101 Ga0157374_10113220 3300013296 Bacteria 2611
102 Ga0157374_11064007 3300013296 Bacteria 829
103 Ga0163162_10003012 3300013306 Bacteria 16100
104 Ga0163162_10226243 3300013306 Bacteria 2000
105 Ga0157372_10076030 3300013307 Bacteria 3791
106 Ga0157375_10073154 3300013308 Bacteria 3446
107 Ga0157375_10380856 3300013308 Bacteria 1577
108 Ga0157375_11268727 3300013308 Bacteria 865
109 Ga0163163_11145798 3300014325 Bacteria 840
110 Ga0157380_10114393 3300014326 Bacteria 2274
111 Ga0182008_10080826 3300014497 Bacteria 1599
112 Ga0157377_10000088 3300014745 Bacteria 67719
113 Ga0157377_10323051 3300014745 Bacteria 1026
114 Ga0157379_10656952 3300014968 Bacteria 982
115 Ga0157376_10501806 3300014969 Bacteria 1193
116 Ga0157376_10704965 3300014969 Bacteria 1015
117 Ga0163161_10058958 3300017792 Bacteria 2791
118 Ga0163161_10626787 3300017792 Bacteria 889
119 Ga0209672_104143 3300025228 Bacteria 2768
120 Ga0209258_100129 3300025242 Bacteria 176515
121 Ga0209148_1000273 3300025254 Bacteria 81211
122 Ga0209759_1000958 3300025256 Bacteria 20481
123 Ga0209455_1000083 3300025272 Bacteria 255660
124 Ga0207697_10001013 3300025315 Bacteria 15719
125 Ga0207697_10008374 3300025315 Bacteria 4527
126 Ga0207656_10064041 3300025321 Bacteria 1620
127 Ga0207682_10015703 3300025893 Bacteria 2950
128 Ga0207682_10080113 3300025893 Bacteria 1398
129 Ga0207710_10002726 3300025900 Bacteria 8091
130 Ga0207688_10017761 3300025901 Bacteria 3870
131 Ga0207680_10000965 3300025903 Bacteria 13583
132 Ga0207705_10005954 3300025909 Bacteria 9070
133 Ga0207684_10072970 3300025910 Bacteria 2915
134 Ga0207695_10045485 3300025913 Bacteria 4659
135 Ga0207657_10168814 3300025919 Bacteria 1774
136 Ga0207649_10172102 3300025920 Bacteria 1509
137 Ga0207646_10626754 3300025922 Bacteria 964
138 Ga0207681_10000008 3300025923 Bacteria 414329
139 Ga0207650_10001844 3300025925 Bacteria 14943
140 Ga0207650_10017188 3300025925 Bacteria 5063
141 Ga0207659_10182925 3300025926 Bacteria 1662
142 Ga0207659_10440982 3300025926 Bacteria 1095
143 Ga0207687_10319351 3300025927 Bacteria 1256
144 Ga0207664_10037521 3300025929 Bacteria 3751
145 Ga0207644_10000006 3300025931 Bacteria 408793
146 Ga0207644_10012817 3300025931 Bacteria 5575
147 Ga0207690_10155869 3300025932 Bacteria 1697
148 Ga0207706_10563243 3300025933 Bacteria 980
149 Ga0207686_11357561 3300025934 Bacteria 584
150 Ga0207709_10005919 3300025935 Bacteria 6898
151 Ga0207669_10020551 3300025937 Bacteria 3466
152 Ga0207704_10011380 3300025938 Bacteria 4378
153 Ga0207691_10011992 3300025940 Bacteria 8313
154 Ga0207691_10166926 3300025940 Bacteria 1929
155 Ga0207679_10030613 3300025945 Bacteria 3760
156 Ga0207679_10070847 3300025945 Bacteria 2628
157 Ga0207667_10000734 3300025949 Bacteria 42640
158 Ga0207651_10002198 3300025960 Bacteria 9237
159 Ga0207712_10022302 3300025961 Bacteria 4168
160 Ga0207668_10001271 3300025972 Bacteria 15032
161 Ga0207658_10000397 3300025986 Bacteria 41950
162 Ga0207658_10006803 3300025986 Bacteria 7790
163 Ga0207658_10073885 3300025986 Bacteria 2589
164 Ga0207658_10174195 3300025986 Bacteria 1775
165 Ga0207677_10384025 3300026023 Bacteria 1186
166 Ga0207703_10002500 3300026035 Bacteria 15933
167 Ga0207641_10004555 3300026088 Bacteria 11980
168 Ga0207648_10000019 3300026089 Bacteria 144209
169 Ga0207648_10015730 3300026089 Bacteria 6940
170 Ga0207648_10053270 3300026089 Bacteria 3537
171 Ga0207676_10040502 3300026095 Bacteria 3570
172 Ga0207676_10059380 3300026095 Bacteria 3020
173 Ga0207675_100013643 3300026118 Bacteria 7584
174 Ga0207683_10003612 3300026121 Bacteria 13479
175 Ga0207683_10080219 3300026121 Bacteria 2895
176 Ga0207698_10726560 3300026142 Bacteria 990
177 Ga0209281_1019053 3300027111 Bacteria 1360
178 Ga0209813_10000017 3300027866 Bacteria 75687
179 Ga0207428_10041914 3300027907 Bacteria 3704
180 Ga0207428_10079666 3300027907 Bacteria 2560
181 Ga0268266_10209093 3300028379 Bacteria 1789
182 Ga0268266_10402141 3300028379 Bacteria 1295
183 Ga0268265_10000392 3300028380 Bacteria 46740
184 Ga0268264_10000310 3300028381 Bacteria 78142
185 Ga0268264_10171869 3300028381 Bacteria 1961
186 Ga0265323_10010392 3300028653 Bacteria 3775
187 Ga0265336_10000011 3300028666 Bacteria 275816
188 Ga0307517_10000174 3300028786 Bacteria 105578
189 Ga0307515_10002251 3300028794 Bacteria 42303
190 Ga0307515_10003180 3300028794 Bacteria 34757
191 Ga0307515_10004349 3300028794 Bacteria 29393
192 Ga0307515_10012282 3300028794 Bacteria 16128
193 Ga0307515_10532167 3300028794 Bacteria 785
194 Ga0265324_10003088 3300029957 Bacteria 8120
195 Ga0265324_10028643 3300029957 Bacteria 1962
196 Ga0307512_10043252 3300030522 Bacteria 3717
197 Ga0265328_10005206 3300031239 Bacteria 5589
198 Ga0265331_10031836 3300031250 Bacteria 2618
199 Ga0265327_10001139 3300031251 Bacteria 36374
200 Ga0265327_10037991 3300031251 Bacteria 2630
201 Ga0265316_10323327 3300031344 Bacteria 1120
202 Ga0307513_10007146 3300031456 Bacteria 14517
203 Ga0307513_10190803 3300031456 Bacteria 1901
204 Ga0307513_10603948 3300031456 Bacteria 806
205 Ga0307513_10609898 3300031456 Bacteria 800
206 Ga0307509_10000798 3300031507 Bacteria 54052
207 Ga0307509_10012377 3300031507 Bacteria 10208
208 Ga0307509_10028676 3300031507 Bacteria 6186
209 Ga0307509_10061470 3300031507 Bacteria 3965
210 Ga0307408_100001618 3300031548 Bacteria 16664
211 Ga0307508_10000123 3300031616 Bacteria 92439
212 Ga0307508_10003326 3300031616 Bacteria 16330
213 Ga0307508_10007419 3300031616 Bacteria 10211
214 Ga0307508_10068487 3300031616 Bacteria 3119
215 Ga0307508_10086769 3300031616 Bacteria 2713
216 Ga0307514_10021644 3300031649 Bacteria 5239
217 Ga0307514_10076738 3300031649 Bacteria 2488
218 Ga0307516_10008261 3300031730 Bacteria 11812
219 Ga0307516_10460042 3300031730 Bacteria 928
220 Ga0307405_10004015 3300031731 Bacteria 6902
221 Ga0307405_10321122 3300031731 Bacteria 1183
222 Ga0307407_10033537 3300031903 Bacteria 2803
223 Ga0307412_10000764 3300031911 Bacteria 18615
224 Ga0307412_10169778 3300031911 Bacteria 1630
225 Ga0307412_11023096 3300031911 Bacteria 731
226 Ga0307414_10002279 3300032004 Bacteria 10023
227 Ga0307414_10463956 3300032004 Bacteria 1114
228 Ga0307415_101032001 3300032126 Bacteria 766
229 Ga0307507_10029893 3300033179 Bacteria 5762
230 Ga0307510_10000578 3300033180 Bacteria 36983
231 Ga0307510_10000948 3300033180 Bacteria 30647
232 Ga0307510_10029479 3300033180 Bacteria 6245
233 Ga0307510_10038597 3300033180 Bacteria 5278
234 Ga0307510_10085011 3300033180 Bacteria 3043
235 Ga0307510_10094243 3300033180 Bacteria 2820
236 Ga0373925_0181280 3300037068 Bacteria 1667
237 Ga0395899_0004667 3300037312 Bacteria 10695
238 Ga0395899_0128215 3300037312 Bacteria 1813
239 Ga0395899_0141669 3300037312 Bacteria 1710
240 Ga0395899_0192354 3300037312 Bacteria 1427
241 Ga0395899_0324580 3300037312 Bacteria 1036
242 Ga0395900_0002376 3300037418 Bacteria 20800
243 Ga0395900_0090747 3300037418 Bacteria 3140
244 Ga0395900_0263558 3300037418 Bacteria 1720
245 Ga0395900_0293225 3300037418 Bacteria 1615
246 Ga0395900_0725996 3300037418 Bacteria 925
247 Ga0395898_0002367 3300037466 Bacteria 22408
248 Ga0395898_0291493 3300037466 Bacteria 1557
249 Ga0395898_0455048 3300037466 Bacteria 1219
250 Ga0395905_0002870 3300037471 Bacteria 18821
251 Ga0395905_0055951 3300037471 Bacteria 3692
252 Ga0395905_0072255 3300037471 Bacteria 3234
253 Ga0395905_0100098 3300037471 Bacteria 2722
254 Ga0395905_0162431 3300037471 Bacteria 2099
255 Ga0395905_0241705 3300037471 Bacteria 1687
256 Ga0395905_0567558 3300037471 Bacteria 1036
257 Ga0395901_0000082 3300038443 Bacteria 130230
258 Ga0395901_0065568 3300038443 Bacteria 3781
259 Ga0395901_0310477 3300038443 Bacteria 1633
260 Ga0395901_0329237 3300038443 Bacteria 1579
261 Ga0451835_0824641 3300041492 Bacteria 1245
262 Ga0451853_1540091 3300041512 Bacteria 2482
263 Ga0439448_0138135 3300042005 Bacteria 842
264 Ga0439432_143037 3300042006 Bacteria 703
265 Ga0439449_0043278 3300042007 Bacteria 1672
266 Ga0439458_0019289 3300042157 Bacteria 1568
267 Ga0439458_0030874 3300042157 Bacteria 1276
268 Ga0450918_000153 3300042531 Bacteria 15229
269 Ga0451577_0001360 3300042876 Bacteria 32926
270 Ga0466969_0010522 3300044656 Bacteria 4903
271 Ga0466969_0212207 3300044656 Bacteria 882
272 Ga0466972_0061702 3300044658 Bacteria 1797
273 Ga0466965_0002006 3300044683 Bacteria 8522
274 Ga0466965_0013482 3300044683 Bacteria 3857
275 Ga0466965_0091468 3300044683 Bacteria 1548
276 Ga0466965_0238509 3300044683 Unclassified 973
277 Ga0466965_0347041 3300044683 Bacteria 812
278 Ga0466966_0002449 3300044684 Bacteria 12134
279 Ga0466966_0006043 3300044684 Bacteria 7995
280 Ga0466961_0248302 3300044693 Bacteria 1093
281 Ga0466963_0135342 3300044694 Bacteria 1704
282 Ga0466963_0287309 3300044694 Bacteria 1156
283 Ga0466964_0005628 3300044706 Bacteria 4656
284 Ga0466964_0012924 3300044706 Bacteria 3162
285 Ga0466964_0029292 3300044706 Bacteria 2173
286 Ga0453684_0003877 3300044712 Bacteria 32926
287 Ga0453684_0017222 3300044712 Bacteria 11217
288 Ga0466971_0002560 3300044719 Bacteria 7686
289 Ga0466968_0027902 3300044735 Bacteria 2325
290 Ga0466968_0230600 3300044735 Bacteria 874
291 Ga0466957_0002133 3300044842 Bacteria 10584
292 Ga0466957_0005152 3300044842 Bacteria 7306
293 Ga0466957_0029083 3300044842 Bacteria 3293
294 Ga0466957_0224545 3300044842 Bacteria 1241
295 Ga0466959_0052775 3300045049 Bacteria 2976
296 Ga0451576_0000652 3300045051 Bacteria 71674
297 Ga0466958_0039515 3300045836 Bacteria 2835
298 Ga0466967_0224986 3300045976 Bacteria 1784
299 Ga0466967_0501072 3300045976 Bacteria 1192
300 Ga0466967_0799278 3300045976 Bacteria 936
301 Ga0495592_0000525 3300046454 Bacteria 27628
302 Ga0495590_0000229 3300046457 Bacteria 30769
303 Ga0495590_0017988 3300046457 Bacteria 2535
304 Ga0495590_0061449 3300046457 Bacteria 1315
305 Ga0495638_0256291 3300046460 Bacteria 962
306 Ga0495653_0022795 3300046463 Bacteria 5065
307 Ga0495605_0000034 3300046474 Bacteria 208277
308 Ga0495605_0017438 3300046474 Bacteria 3866
309 Ga0495605_0027899 3300046474 Bacteria 2919
310 Ga0495605_0028934 3300046474 Bacteria 2856
311 Ga0495605_0212640 3300046474 Bacteria 838
312 Ga0495664_0010369 3300046477 Bacteria 5226
313 Ga0495664_0536476 3300046477 Bacteria 698
314 Ga0495584_0005929 3300046491 Bacteria 6438
315 Ga0495584_0074433 3300046491 Bacteria 1707
316 Ga0495584_0226641 3300046491 Bacteria 950
317 Ga0495585_0048158 3300046492 Bacteria 2371
318 Ga0495596_0000048 3300046500 Bacteria 88427
319 Ga0495596_0193934 3300046500 Bacteria 789
320 Ga0495607_0006818 3300046501 Bacteria 7970
321 Ga0495607_0010322 3300046501 Bacteria 6281
322 Ga0495607_0010332 3300046501 Bacteria 6279
323 Ga0495607_0023312 3300046501 Bacteria 3874
324 Ga0495583_0001534 3300046506 Bacteria 22903
325 Ga0495606_0006681 3300046507 Bacteria 10574
326 Ga0495606_0243401 3300046507 Bacteria 1002
327 Ga0495610_0000430 3300046512 Bacteria 43081
328 Ga0495610_0014764 3300046512 Bacteria 4573
329 Ga0495616_0000178 3300046513 Bacteria 54382
330 Ga0495616_0008611 3300046513 Bacteria 6025
331 Ga0495616_0146716 3300046513 Bacteria 1070
332 Ga0495628_0140381 3300046516 Bacteria 1844
333 Ga0495631_0016656 3300046518 Bacteria 3499
334 Ga0495631_0128482 3300046518 Bacteria 1089
335 Ga0495632_0000350 3300046519 Bacteria 43875
336 Ga0495632_0081038 3300046519 Bacteria 1548
337 Ga0495637_0000265 3300046520 Bacteria 41367
338 Ga0495637_0014050 3300046520 Bacteria 3786
339 Ga0495643_0000021 3300046522 Bacteria 293465
340 Ga0495643_0000429 3300046522 Bacteria 54784
341 Ga0495643_0000470 3300046522 Bacteria 51330
342 Ga0495643_0133006 3300046522 Bacteria 1247
343 Ga0495643_0287234 3300046522 Bacteria 754
344 Ga0495648_0000769 3300046524 Bacteria 34148
345 Ga0495648_0001890 3300046524 Bacteria 20010
346 Ga0495648_0062067 3300046524 Bacteria 2215
347 Ga0495648_0107564 3300046524 Bacteria 1524
348 Ga0495648_0120403 3300046524 Bacteria 1412
349 Ga0495663_0000081 3300046525 Bacteria 43880
350 Ga0495642_0000573 3300046528 Bacteria 18451
351 Ga0495642_0008313 3300046528 Bacteria 3970
352 Ga0495652_0000862 3300046529 Bacteria 35004
353 Ga0495654_0026218 3300046530 Bacteria 2999
354 Ga0495609_0000002 3300046538 Bacteria 739816
355 Ga0495597_0000031 3300046542 Bacteria 133296
356 Ga0495597_0000054 3300046542 Bacteria 95390
357 Ga0495597_0130226 3300046542 Bacteria 1044
358 Ga0495645_0227515 3300046543 Bacteria 1251
359 Ga0495622_0037952 3300046557 Bacteria 2243
360 Ga0495633_0001283 3300046558 Bacteria 19926
361 Ga0495633_0003077 3300046558 Bacteria 11348
362 Ga0495633_0196969 3300046558 Bacteria 925
363 Ga0495633_0242957 3300046558 Bacteria 822
364 Ga0495656_0066359 3300046615 Bacteria 1589
365 Ga0495668_0005726 3300046616 Bacteria 8306
366 Ga0495668_0021398 3300046616 Bacteria 3709
367 Ga0495611_0170372 3300046648 Bacteria 1018
368 Ga0495625_0000929 3300046660 Bacteria 39380
369 Ga0495625_0187793 3300046660 Bacteria 1370
370 Ga0495661_0000207 3300046665 Bacteria 67846
371 Ga0495661_0000693 3300046665 Bacteria 33492
372 Ga0495661_0001547 3300046665 Bacteria 19014
373 Ga0495661_0036836 3300046665 Bacteria 3058
374 Ga0495661_0049168 3300046665 Bacteria 2558
375 Ga0495661_0054011 3300046665 Bacteria 2414
376 Ga0495661_0059909 3300046665 Bacteria 2263
377 Ga0495661_0066136 3300046665 Bacteria 2128
378 Ga0495661_0118000 3300046665 Bacteria 1469
379 Ga0495588_0000067 3300046674 Bacteria 238958
380 Ga0495623_0010011 3300046679 Bacteria 6139
381 Ga0495658_0342768 3300046683 Bacteria 949
382 Ga0495624_0041726 3300046690 Bacteria 2934
383 Ga0495671_0000017 3300046692 Bacteria 293465
384 Ga0495649_0052672 3300046694 Bacteria 2205
385 Ga0495589_0000009 3300046794 Bacteria 256265
386 Ga0495589_0000129 3300046794 Bacteria 69672
387 Ga0495589_0000200 3300046794 Bacteria 51987
388 Ga0495660_0000026 3300046810 Bacteria 256223
389 Ga0495660_0175470 3300046810 Bacteria 1041
390 Ga0495674_0025325 3300047319 Bacteria 5441
391 Ga0495674_0096672 3300047319 Bacteria 2517
392 Ga0495672_0000522 3300047320 Bacteria 43913
393 Ga0495672_0001356 3300047320 Bacteria 24279
394 Ga0495672_0407577 3300047320 Bacteria 620
395 Ga0495680_0329678 3300047322 Bacteria 1067
396 Ga0495683_0023319 3300047323 Bacteria 3180
397 Ga0495687_000013 3300047443 Bacteria 371058
398 Ga0495687_000116 3300047443 Bacteria 122687
399 Ga0495687_000162 3300047443 Bacteria 100599
400 Ga0495687_000439 3300047443 Bacteria 51384
401 Ga0495677_0000024 3300047445 Bacteria 99215
402 Ga0495677_0000940 3300047445 Bacteria 11727
403 Ga0495673_0170779 3300047469 Bacteria 829
404 Ga0495681_0002473 3300047470 Bacteria 13191
405 Ga0495686_0000105 3300047472 Bacteria 176098
406 Ga0495686_0000188 3300047472 Bacteria 115937
407 Ga0495686_0010887 3300047472 Bacteria 6440
408 Ga0495686_0027577 3300047472 Bacteria 3707
409 Ga0495686_0159079 3300047472 Bacteria 1321
410 Ga0495602_0002262 3300048088 Bacteria 19467
411 Ga0495626_0000096 3300048091 Bacteria 114087
412 Ga0495626_0000151 3300048091 Bacteria 86296
413 Ga0495626_0029323 3300048091 Bacteria 2663
414 Ga0496101_0362211 3300048904 Bacteria 1140
415 Ga0496102_0055846 3300048905 Bacteria 3601
416 Ga0496103_0026174 3300048906 Bacteria 3531
417 Ga0496106_0134563 3300048909 Bacteria 1940
418 Ga0496106_0499981 3300048909 Bacteria 977
419 Ga0496108_0005607 3300048911 Bacteria 10158
420 Ga0496110_0739179 3300048913 Bacteria 887
421 Ga0496111_0404309 3300048914 Bacteria 1009
422 Ga0496115_0388586 3300048918 Bacteria 1134
423 Ga0496117_0007607 3300048920 Bacteria 10526
424 Ga0496117_0097580 3300048920 Bacteria 1871
425 Ga0496118_0000753 3300048921 Bacteria 52390
426 Ga0496118_0007389 3300048921 Bacteria 11665
427 Ga0496118_0123560 3300048921 Bacteria 1681
428 Ga0496119_0080353 3300048922 Bacteria 1881
429 Ga0496121_0000650 3300048924 Bacteria 65007
430 Ga0496121_0419442 3300048924 Bacteria 871
431 Ga0496123_0121645 3300048926 Bacteria 1467
432 Ga0496123_0314178 3300048926 Bacteria 742
433 Ga0496124_0016314 3300048927 Bacteria 7069
434 Ga0496124_0113339 3300048927 Bacteria 2179
435 Ga0496125_0419302 3300048928 Bacteria 776
436 Ga0501308_001778 3300049128 Bacteria 1798
437 Ga0495678_000577 3300049459 Bacteria 34773
438 Ga0501031_0153449 3300049568 Bacteria 1505
439 Ga0501034_0032187 3300049571 Bacteria 5328
440 Ga0501038_0033967 3300049574 Bacteria 4487
441 Ga0501043_0086509 3300049579 Bacteria 2463
442 Ga0501047_0514545 3300049581 Bacteria 1023
443 Ga0501068_0001156 3300049584 Bacteria 13994
444 Ga0501077_0108248 3300049593 Bacteria 1761
445 Ga0501044_0267853 3300049823 Bacteria 1645
446 nmdc:mga03683_2694_c1 3300050489 Bacteria 5569
447 nmdc:mga03n38_62127_c1 3300050490 Bacteria 1703
448 nmdc:mga0k408_17220_c1 3300050493 Bacteria 4023
449 nmdc:mga0k408_294858_c1 3300050493 Bacteria 968
450 nmdc:mga0k408_38582_c1 3300050493 Bacteria 2742
451 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
452 nmdc:mga06z11_273659_c1 3300050494 Bacteria 999
453 nmdc:mga04h51_406_c1 3300050495 Bacteria 10431
454 nmdc:mga07m45_12302_c1 3300050496 Bacteria 4520
455 nmdc:mga07m45_17290_c1 3300050496 Bacteria 3870
456 nmdc:mga07m45_200786_c1 3300050496 Bacteria 1160
457 nmdc:mga07m45_216189_c1 3300050496 Bacteria 1115
458 nmdc:mga07m45_23994_c1 3300050496 Bacteria 3337
459 nmdc:mga07m45_427094_c1 3300050496 Bacteria 769
460 nmdc:mga08y16_110674_c1 3300050511 Bacteria 2860
461 nmdc:mga08y16_583_c1 3300050511 Bacteria 33926
462 nmdc:mga0sz30_5564_c1 3300050516 Bacteria 806
463 Ga0500578_0146179 3300053086 Bacteria 1475
464 Ga0500643_000557 3300053087 Bacteria 25902
465 Ga0500643_025653 3300053087 Bacteria 1856
466 Ga0500644_0007535 3300053088 Bacteria 2836
467 Ga0500651_0094383 3300053093 Bacteria 1839
468 Ga0500651_0412552 3300053093 Bacteria 757
469 Ga0500594_0001108 3300053118 Bacteria 5776
470 Ga0500597_016892 3300053120 Bacteria 2794
471 Ga0500607_000028 3300053121 Bacteria 91877
472 Ga0500607_201356 3300053121 Bacteria 855
473 Ga0500607_251698 3300053121 Bacteria 702
474 Ga0500614_020914 3300053123 Bacteria 1515
475 Ga0500559_0000079 3300053136 Bacteria 75437
476 Ga0500568_0016392 3300053139 Bacteria 3297
477 Ga0500589_196395 3300053147 Bacteria 779
478 Ga0500604_0002028 3300053151 Bacteria 5598
479 Ga0500616_0187867 3300053153 Bacteria 925
480 Ga0500619_190401 3300053154 Bacteria 690
481 Ga0500622_0001104 3300053156 Bacteria 22463
482 Ga0500622_0202946 3300053156 Bacteria 901
483 Ga0500624_000013 3300053157 Bacteria 165889
484 Ga0500627_0000180 3300053158 Bacteria 18437
485 Ga0500636_0033072 3300053177 Bacteria 3063
486 Ga0500636_0194943 3300053177 Bacteria 1076
487 Ga0500637_0000032 3300053178 Bacteria 51354
488 Ga0500570_122765 3300053724 Bacteria 1014
489 Ga0500645_009091 3300053730 Bacteria 3354
490 Ga0500587_000487 3300053739 Bacteria 4782
491 Ga0500587_002080 3300053739 Bacteria 2860
492 Ga0500587_004814 3300053739 Bacteria 1842
493 Ga0590071_002564 3300059421 Bacteria 4573
494 Ga0590074_005690 3300059423 Bacteria 2067
495 Ga0466962_0005820 3300061719 Bacteria 5923
496 2587759330 2585428062 Bacteria 6842168
497 2842681179 2842677519 Bacteria 5615038
498 2846041819 2846037992 Bacteria 4526407
499 2852627173 2852623160 Bacteria 4376875
500 2884935890 2884933994 Bacteria 4535041
501 2919465247 2919462493 Bacteria 5817112
502 2919711781 2919709256 Bacteria 4318106
503 8047678216 8047673197 Bacteria 7395230
504 Ga0307516_10640900
505 JGI24752J21851_1003244
506 JGI24035J26624_1002723
507 JGI24034J26672_10032479
508 Ga0055535_1000079
509 Ga0055542_1033630
510 Ga0055529_1000311
511 Ga0065714_10005436
512 Ga0065714_10140976
513 Ga0070658_10062371
514 Ga0070676_10071072
515 Ga0070670_100003700
516 Ga0070670_100007464
517 Ga0070677_10012477
518 Ga0070677_10330070
519 Ga0070666_10000305
520 Ga0070682_100230890
521 Ga0068868_100075820
522 Ga0070669_100000013
523 Ga0070669_100009422
524 Ga0070675_100013001
525 Ga0070671_100000009
526 Ga0070671_100007464
527 Ga0070674_100024590
528 Ga0070674_100174675
529 Ga0070673_100059165
530 Ga0070659_100031324
531 Ga0070659_100468845
532 Ga0070667_100000461
533 Ga0070667_100000606
534 Ga0070667_100077194
535 Ga0070667_100500427
536 Ga0070714_100001810
537 Ga0070705_100018572
538 Ga0070708_100830147
539 Ga0070678_100014023
540 Ga0070678_100052378
541 Ga0070662_100064153
542 Ga0068867_100000453
543 Ga0068867_100022588
544 Ga0068867_100439261
545 Ga0070685_10493384
546 Ga0070707_100882545
547 Ga0070698_100602336
548 Ga0070672_100004699
549 Ga0070672_100230996
550 Ga0070665_100006191
551 Ga0070665_100147912
552 Ga0070665_100743805
553 Ga0068855_100001856
554 Ga0070664_100075216
555 Ga0070664_100139805
556 Ga0070664_100153636
557 Ga0068859_100008911
558 Ga0068859_101249707
559 Ga0068864_100005285
560 Ga0068861_100004489
561 Ga0068851_10047180
562 Ga0068863_100019345
563 Ga0068863_100334334
564 Ga0068858_100005784
565 Ga0068860_100007265
566 Ga0068860_100200230
567 Ga0068860_100551244
568 Ga0068862_100000876
569 Ga0070717_10052375
570 Ga0075363_100059091
571 Ga0075364_10056820
572 Ga0070716_100360597
573 Ga0075362_10020995
574 Ga0075367_10000791
575 Ga0075369_10260398
576 Ga0075366_10006153
577 Ga0097621_100016738
578 Ga0075370_10006432
579 Ga0075370_10013904
580 Ga0075370_10015898
581 Ga0075370_10017534
582 Ga0075370_10077680
583 Ga0075370_10392352
584 Ga0068871_100492605
585 Ga0097620_100008911
586 Ga0097620_101249671
587 Ga0079104_1012310
588 Ga0099795_10088875
589 Ga0105240_10056275
590 Ga0111539_10023456
591 Ga0105245_10187860
592 Ga0105245_10411263
593 Ga0105247_10000831
594 Ga0105243_10002357
595 Ga0105248_10706050
596 Ga0105237_10674742
597 Ga0105249_10520254
598 Ga0105239_10141904
599 Ga0105239_11365675
600 Ga0105246_10906197
601 Ga0105246_11678570
602 Ga0157370_10001358
603 Ga0157370_10768931
604 Ga0157374_10113220
605 Ga0157374_11064007
606 Ga0163162_10003012
607 Ga0163162_10226243
608 Ga0157372_10076030
609 Ga0157375_10073154
610 Ga0157375_10380856
611 Ga0157375_11268727
612 Ga0163163_11145798
613 Ga0157380_10114393
614 Ga0182008_10080826
615 Ga0157377_10000088
616 Ga0157377_10323051
617 Ga0157379_10656952
618 Ga0157376_10501806
619 Ga0157376_10704965
620 Ga0163161_10058958
621 Ga0163161_10626787
622 Ga0209672_104143
623 Ga0209258_100129
624 Ga0209148_1000273
625 Ga0209759_1000958
626 Ga0209455_1000083
627 Ga0207697_10001013
628 Ga0207697_10008374
629 Ga0207656_10064041
630 Ga0207682_10015703
631 Ga0207682_10080113
632 Ga0207710_10002726
633 Ga0207688_10017761
634 Ga0207680_10000965
635 Ga0207705_10005954
636 Ga0207684_10072970
637 Ga0207695_10045485
638 Ga0207657_10168814
639 Ga0207649_10172102
640 Ga0207646_10626754
641 Ga0207681_10000008
642 Ga0207650_10001844
643 Ga0207650_10017188
644 Ga0207659_10182925
645 Ga0207659_10440982
646 Ga0207687_10319351
647 Ga0207664_10037521
648 Ga0207644_10000006
649 Ga0207644_10012817
650 Ga0207690_10155869
651 Ga0207706_10563243
652 Ga0207686_11357561
653 Ga0207709_10005919
654 Ga0207669_10020551
655 Ga0207704_10011380
656 Ga0207691_10011992
657 Ga0207691_10166926
658 Ga0207679_10030613
659 Ga0207679_10070847
660 Ga0207667_10000734
661 Ga0207651_10002198
662 Ga0207712_10022302
663 Ga0207668_10001271
664 Ga0207658_10000397
665 Ga0207658_10006803
666 Ga0207658_10073885
667 Ga0207658_10174195
668 Ga0207677_10384025
669 Ga0207703_10002500
670 Ga0207641_10004555
671 Ga0207648_10000019
672 Ga0207648_10015730
673 Ga0207648_10053270
674 Ga0207676_10040502
675 Ga0207676_10059380
676 Ga0207675_100013643
677 Ga0207683_10003612
678 Ga0207683_10080219
679 Ga0207698_10726560
680 Ga0209281_1019053
681 Ga0209813_10000017
682 Ga0207428_10041914
683 Ga0207428_10079666
684 Ga0268266_10209093
685 Ga0268266_10402141
686 Ga0268265_10000392
687 Ga0268264_10000310
688 Ga0268264_10171869
689 Ga0265323_10010392
690 Ga0265336_10000011
691 Ga0307517_10000174
692 Ga0307515_10002251
693 Ga0307515_10003180
694 Ga0307515_10004349
695 Ga0307515_10012282
696 Ga0307515_10532167
697 Ga0265324_10003088
698 Ga0265324_10028643
699 Ga0307512_10043252
700 Ga0265328_10005206
701 Ga0265331_10031836
702 Ga0265327_10001139
703 Ga0265327_10037991
704 Ga0265316_10323327
705 Ga0307513_10007146
706 Ga0307513_10190803
707 Ga0307513_10603948
708 Ga0307513_10609898
709 Ga0307509_10000798
710 Ga0307509_10012377
711 Ga0307509_10028676
712 Ga0307509_10061470
713 Ga0307408_100001618
714 Ga0307508_10000123
715 Ga0307508_10003326
716 Ga0307508_10007419
717 Ga0307508_10068487
718 Ga0307508_10086769
719 Ga0307514_10021644
720 Ga0307514_10076738
721 Ga0307516_10008261
722 Ga0307516_10460042
723 Ga0307405_10004015
724 Ga0307405_10321122
725 Ga0307407_10033537
726 Ga0307412_10000764
727 Ga0307412_10169778
728 Ga0307412_11023096
729 Ga0307414_10002279
730 Ga0307414_10463956
731 Ga0307415_101032001
732 Ga0307507_10029893
733 Ga0307510_10000578
734 Ga0307510_10000948
735 Ga0307510_10029479
736 Ga0307510_10038597
737 Ga0307510_10085011
738 Ga0307510_10094243
739 Ga0373925_0181280
740 Ga0395899_0004667
741 Ga0395899_0128215
742 Ga0395899_0141669
743 Ga0395899_0192354
744 Ga0395899_0324580
745 Ga0395900_0002376
746 Ga0395900_0090747
747 Ga0395900_0263558
748 Ga0395900_0293225
749 Ga0395900_0725996
750 Ga0395898_0002367
751 Ga0395898_0291493
752 Ga0395898_0455048
753 Ga0395905_0002870
754 Ga0395905_0055951
755 Ga0395905_0072255
756 Ga0395905_0100098
757 Ga0395905_0162431
758 Ga0395905_0241705
759 Ga0395905_0567558
760 Ga0395901_0000082
761 Ga0395901_0065568
762 Ga0395901_0310477
763 Ga0395901_0329237
764 Ga0451835_0824641
765 Ga0451853_1540091
766 Ga0439448_0138135
767 Ga0439432_143037
768 Ga0439449_0043278
769 Ga0439458_0019289
770 Ga0439458_0030874
771 Ga0450918_000153
772 Ga0451577_0001360
773 Ga0466969_0010522
774 Ga0466969_0212207
775 Ga0466972_0061702
776 Ga0466965_0002006
777 Ga0466965_0013482
778 Ga0466965_0091468
779 Ga0466965_0238509
780 Ga0466965_0347041
781 Ga0466966_0002449
782 Ga0466966_0006043
783 Ga0466961_0248302
784 Ga0466963_0135342
785 Ga0466963_0287309
786 Ga0466964_0005628
787 Ga0466964_0012924
788 Ga0466964_0029292
789 Ga0453684_0003877
790 Ga0453684_0017222
791 Ga0466971_0002560
792 Ga0466968_0027902
793 Ga0466968_0230600
794 Ga0466957_0002133
795 Ga0466957_0005152
796 Ga0466957_0029083
797 Ga0466957_0224545
798 Ga0466959_0052775
799 Ga0451576_0000652
800 Ga0466958_0039515
801 Ga0466967_0224986
802 Ga0466967_0501072
803 Ga0466967_0799278
804 Ga0495592_0000525
805 Ga0495590_0000229
806 Ga0495590_0017988
807 Ga0495590_0061449
808 Ga0495638_0256291
809 Ga0495653_0022795
810 Ga0495605_0000034
811 Ga0495605_0017438
812 Ga0495605_0027899
813 Ga0495605_0028934
814 Ga0495605_0212640
815 Ga0495664_0010369
816 Ga0495664_0536476
817 Ga0495584_0005929
818 Ga0495584_0074433
819 Ga0495584_0226641
820 Ga0495585_0048158
821 Ga0495596_0000048
822 Ga0495596_0193934
823 Ga0495607_0006818
824 Ga0495607_0010322
825 Ga0495607_0010332
826 Ga0495607_0023312
827 Ga0495583_0001534
828 Ga0495606_0006681
829 Ga0495606_0243401
830 Ga0495610_0000430
831 Ga0495610_0014764
832 Ga0495616_0000178
833 Ga0495616_0008611
834 Ga0495616_0146716
835 Ga0495628_0140381
836 Ga0495631_0016656
837 Ga0495631_0128482
838 Ga0495632_0000350
839 Ga0495632_0081038
840 Ga0495637_0000265
841 Ga0495637_0014050
842 Ga0495643_0000021
843 Ga0495643_0000429
844 Ga0495643_0000470
845 Ga0495643_0133006
846 Ga0495643_0287234
847 Ga0495648_0000769
848 Ga0495648_0001890
849 Ga0495648_0062067
850 Ga0495648_0107564
851 Ga0495648_0120403
852 Ga0495663_0000081
853 Ga0495642_0000573
854 Ga0495642_0008313
855 Ga0495652_0000862
856 Ga0495654_0026218
857 Ga0495609_0000002
858 Ga0495597_0000031
859 Ga0495597_0000054
860 Ga0495597_0130226
861 Ga0495645_0227515
862 Ga0495622_0037952
863 Ga0495633_0001283
864 Ga0495633_0003077
865 Ga0495633_0196969
866 Ga0495633_0242957
867 Ga0495656_0066359
868 Ga0495668_0005726
869 Ga0495668_0021398
870 Ga0495611_0170372
871 Ga0495625_0000929
872 Ga0495625_0187793
873 Ga0495661_0000207
874 Ga0495661_0000693
875 Ga0495661_0001547
876 Ga0495661_0036836
877 Ga0495661_0049168
878 Ga0495661_0054011
879 Ga0495661_0059909
880 Ga0495661_0066136
881 Ga0495661_0118000
882 Ga0495588_0000067
883 Ga0495623_0010011
884 Ga0495658_0342768
885 Ga0495624_0041726
886 Ga0495671_0000017
887 Ga0495649_0052672
888 Ga0495589_0000009
889 Ga0495589_0000129
890 Ga0495589_0000200
891 Ga0495660_0000026
892 Ga0495660_0175470
893 Ga0495674_0025325
894 Ga0495674_0096672
895 Ga0495672_0000522
896 Ga0495672_0001356
897 Ga0495672_0407577
898 Ga0495680_0329678
899 Ga0495683_0023319
900 Ga0495687_000013
901 Ga0495687_000116
902 Ga0495687_000162
903 Ga0495687_000439
904 Ga0495677_0000024
905 Ga0495677_0000940
906 Ga0495673_0170779
907 Ga0495681_0002473
908 Ga0495686_0000105
909 Ga0495686_0000188
910 Ga0495686_0010887
911 Ga0495686_0027577
912 Ga0495686_0159079
913 Ga0495602_0002262
914 Ga0495626_0000096
915 Ga0495626_0000151
916 Ga0495626_0029323
917 Ga0496101_0362211
918 Ga0496102_0055846
919 Ga0496103_0026174
920 Ga0496106_0134563
921 Ga0496106_0499981
922 Ga0496108_0005607
923 Ga0496110_0739179
924 Ga0496111_0404309
925 Ga0496115_0388586
926 Ga0496117_0007607
927 Ga0496117_0097580
928 Ga0496118_0000753
929 Ga0496118_0007389
930 Ga0496118_0123560
931 Ga0496119_0080353
932 Ga0496121_0000650
933 Ga0496121_0419442
934 Ga0496123_0121645
935 Ga0496123_0314178
936 Ga0496124_0016314
937 Ga0496124_0113339
938 Ga0496125_0419302
939 Ga0501308_001778
940 Ga0495678_000577
941 Ga0501031_0153449
942 Ga0501034_0032187
943 Ga0501038_0033967
944 Ga0501043_0086509
945 Ga0501047_0514545
946 Ga0501068_0001156
947 Ga0501077_0108248
948 Ga0501044_0267853
949 nmdc:mga03683_2694_c1
950 nmdc:mga03n38_62127_c1
951 nmdc:mga0k408_17220_c1
952 nmdc:mga0k408_294858_c1
953 nmdc:mga0k408_38582_c1
954 nmdc:mga06z11_20_c1
955 nmdc:mga06z11_273659_c1
956 nmdc:mga04h51_406_c1
957 nmdc:mga07m45_12302_c1
958 nmdc:mga07m45_17290_c1
959 nmdc:mga07m45_200786_c1
960 nmdc:mga07m45_216189_c1
961 nmdc:mga07m45_23994_c1
962 nmdc:mga07m45_427094_c1
963 nmdc:mga08y16_110674_c1
964 nmdc:mga08y16_583_c1
965 nmdc:mga0sz30_5564_c1
966 Ga0500578_0146179
967 Ga0500643_000557
968 Ga0500643_025653
969 Ga0500644_0007535
970 Ga0500651_0094383
971 Ga0500651_0412552
972 Ga0500594_0001108
973 Ga0500597_016892
974 Ga0500607_000028
975 Ga0500607_201356
976 Ga0500607_251698
977 Ga0500614_020914
978 Ga0500559_0000079
979 Ga0500568_0016392
980 Ga0500589_196395
981 Ga0500604_0002028
982 Ga0500616_0187867
983 Ga0500619_190401
984 Ga0500622_0001104
985 Ga0500622_0202946
986 Ga0500624_000013
987 Ga0500627_0000180
988 Ga0500636_0033072
989 Ga0500636_0194943
990 Ga0500637_0000032
991 Ga0500570_122765
992 Ga0500645_009091
993 Ga0500587_000487
994 Ga0500587_002080
995 Ga0500587_004814
996 Ga0590071_002564
997 Ga0590074_005690
998 Ga0466962_0005820
999 2587759330
1000 2842681179
1001 2846041819
1002 2852627173
1003 2884935890
1004 2919465247
1005 2919711781
1006 8047678216

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

21

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.968 2 177
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9679 2 176
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9678 2 181
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.9669 2 181
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9632 1 181
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9678 2 181 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9614 2 181 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.959 1 176 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9574 2 181 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9524 7 177 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1W9HG63-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9933 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4Y6W013-F1-model_v4 deleted 0.993 2 181
AF-A0A850R3L1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9916 42 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X8PYK9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9905 2 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.99 44 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map