metagRoot

F455893

General Info

Members	Datasets	Scaffolds	Average Seq Length
502	285	495	217

Family's Representative Sequence

Representative Sequence	3300044712\|Ga0453684_0471096\|Ga0453684_0471096_392_1126
Length	244
Sequence	LYDVVEVADINSSLHLVSLISNKGRIAIRVILLGGPGAGKGTQANYIKEHFGVPQISTGDMLRSAVKAGTELGVMAKKIMDSGGLVSDDIIINLVKERIAQPDCVNGFLFDGFPRTIPQADAMKAAGVPIDFVVEIDVADAEIVKRMSGRRVHPASGRTYHVDFNPPKAHGRDDVTGEPLIQRDDDKEETVRKRLEVYHQQTEPLVDYYSKWSANGGKDSPHYIKIAGIGTVEEIRDLIFAALK

Samples

	Sample ID	Description	Type	Environment
1	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
2	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
3	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
4	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
5	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
6	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
7	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
8	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
9	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
10	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
11	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
12	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
13	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
14	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
15	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
16	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
19	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
20	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
21	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
24	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
25	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
26	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
27	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
28	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
33	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
34	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
35	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
36	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
37	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
38	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
39	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
40	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
41	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
45	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
46	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
47	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
48	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
49	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
50	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
51	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
52	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
53	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
54	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
55	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
56	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
57	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
60	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
61	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
62	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
63	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
64	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
65	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
66	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
67	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
68	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
69	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
70	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
73	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
75	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
76	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
77	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
82	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
83	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
84	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
89	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
90	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
91	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
94	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
95	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
96	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
97	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
104	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
105	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
154	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
158	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
159	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
160	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
161	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
162	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
163	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
164	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
165	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
166	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
167	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
168	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
169	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
170	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
171	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
172	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
173	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
174	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
175	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
176	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
177	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
178	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
179	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
180	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
181	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
182	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
183	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
184	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
185	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
186	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
187	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
188	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
189	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
190	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
191	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
192	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
193	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
194	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
195	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
196	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
197	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
198	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
199	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
200	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
201	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
202	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
203	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
204	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
205	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
206	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
207	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
208	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
209	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
210	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
211	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
212	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
213	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
214	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
215	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
216	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
217	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
218	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
219	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
220	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
221	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
222	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
223	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
224	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
225	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
226	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
227	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
228	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
229	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
230	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
231	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
232	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
233	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
234	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
235	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
236	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
237	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
238	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
239	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
240	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
241	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
242	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
243	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
244	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
245	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
246	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
247	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
249	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
252	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
264	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
265	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
266	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
267	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
269	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
270	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
271	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
272	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
273	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
274	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
275	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
276	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
277	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
278	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
279	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
280	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
281	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
282	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
283	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
284	8001522603	Methylomicrobium sp. RS1	Isolate	Unclassified
285	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.41
Metatranscriptomes	1.2
Isolates	1.39

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.39
Nodule	0.4
Rhizoplane	5.38
Rhizosphere	91.43
Stem	0
Stem Tuber	0
Unclassified	1.39

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24742J22300_10044515	3300002244	Bacteria	795
2	Ga0006759J45824_1060182	3300003163	Bacteria	936
3	JGI25406J46586_10032142	3300003203	Bacteria	1953
4	Ga0007417J51691_1029735	3300003544	Bacteria	1920
5	Ga0007410J51695_1038368	3300003574	Bacteria	1210
6	Ga0007409J51694_1014788	3300003575	Bacteria	1483
7	Ga0007416J51690_1024881	3300003577	Bacteria	4106
8	Ga0032354_1027395	3300003693	Bacteria	1979
9	Ga0055543_1012095	3300004625	Bacteria	1747
10	Ga0065165_1000074	3300005262	Bacteria	164454
11	Ga0065712_10136099	3300005290	Bacteria	1496
12	Ga0070676_10038787	3300005328	Bacteria	2752
13	Ga0070676_10089431	3300005328	Bacteria	1884
14	Ga0070683_100011251	3300005329	Bacteria	7722
15	Ga0070690_100000525	3300005330	Bacteria	19252
16	Ga0070690_100357954	3300005330	Bacteria	1061
17	Ga0070677_10008719	3300005333	Bacteria	3421
18	Ga0068869_100009815	3300005334	Bacteria	6218
19	Ga0068869_100018841	3300005334	Bacteria	4705
20	Ga0068869_100075172	3300005334	Bacteria	2509
21	Ga0068868_100364468	3300005338	Bacteria	1240
22	Ga0070689_100000288	3300005340	Bacteria	29270
23	Ga0070689_100023335	3300005340	Bacteria	4630
24	Ga0070689_100102156	3300005340	Bacteria	2271
25	Ga0070691_10143188	3300005341	Bacteria	1220
26	Ga0070687_100012830	3300005343	Bacteria	3714
27	Ga0070687_100273442	3300005343	Bacteria	1060
28	Ga0070661_100130850	3300005344	Bacteria	1884
29	Ga0070692_10246125	3300005345	Bacteria	1068
30	Ga0070668_100187533	3300005347	Bacteria	1692
31	Ga0070671_100200224	3300005355	Bacteria	1693
32	Ga0070674_100011298	3300005356	Bacteria	5433
33	Ga0070674_100019277	3300005356	Bacteria	4331
34	Ga0070659_100038961	3300005366	Bacteria	3708
35	Ga0070714_100012639	3300005435	Bacteria	6743
36	Ga0070714_100271648	3300005435	Bacteria	1572
37	Ga0070713_100199920	3300005436	Bacteria	1804
38	Ga0070711_100029977	3300005439	Bacteria	3597
39	Ga0070700_100000241	3300005441	Bacteria	30113
40	Ga0070700_100007416	3300005441	Bacteria	5921
41	Ga0070694_100030431	3300005444	Bacteria	3531
42	Ga0070694_100046160	3300005444	Bacteria	2923
43	Ga0070694_100262660	3300005444	Bacteria	1310
44	Ga0070708_100056954	3300005445	Bacteria	3478
45	Ga0070663_100081975	3300005455	Bacteria	2372
46	Ga0070663_100126179	3300005455	Bacteria	1939
47	Ga0070678_100130195	3300005456	Bacteria	1998
48	Ga0070662_100133435	3300005457	Bacteria	1917
49	Ga0070681_10002547	3300005458	Bacteria	16723
50	Ga0070681_10420213	3300005458	Bacteria	1249
51	Ga0068867_100011581	3300005459	Bacteria	6226
52	Ga0068867_100050522	3300005459	Bacteria	3065
53	Ga0068867_100060803	3300005459	Bacteria	2803
54	Ga0068867_100148158	3300005459	Bacteria	1841
55	Ga0068867_100340286	3300005459	Bacteria	1249
56	Ga0070685_10040706	3300005466	Bacteria	2645
57	Ga0070706_100056054	3300005467	Bacteria	3637
58	Ga0070706_100156603	3300005467	Bacteria	2126
59	Ga0070706_100222700	3300005467	Bacteria	1761
60	Ga0070706_100506550	3300005467	Bacteria	1123
61	Ga0070707_100088069	3300005468	Bacteria	3003
62	Ga0070698_100193578	3300005471	Bacteria	1970
63	Ga0070698_100574397	3300005471	Bacteria	1067
64	Ga0070698_100608768	3300005471	Bacteria	1033
65	Ga0070699_100093440	3300005518	Bacteria	2632
66	Ga0070699_100237079	3300005518	Bacteria	1627
67	Ga0070679_100022031	3300005530	Bacteria	6225
68	Ga0070684_100183581	3300005535	Bacteria	1902
69	Ga0070697_100001057	3300005536	Bacteria	20812
70	Ga0070697_100121675	3300005536	Bacteria	2183
71	Ga0070697_100190310	3300005536	Bacteria	1741
72	Ga0068853_100427111	3300005539	Bacteria	1243
73	Ga0070672_100205382	3300005543	Bacteria	1648
74	Ga0070686_100006108	3300005544	Bacteria	6688
75	Ga0070686_100452348	3300005544	Bacteria	987
76	Ga0070695_100000298	3300005545	Bacteria	25019
77	Ga0070695_100444509	3300005545	Bacteria	992
78	Ga0070696_100002472	3300005546	Bacteria	12245
79	Ga0070696_100077807	3300005546	Bacteria	2344
80	Ga0070696_100114996	3300005546	Bacteria	1941
81	Ga0070696_100709640	3300005546	Bacteria	821
82	Ga0070693_100388010	3300005547	Bacteria	965
83	Ga0070693_100483551	3300005547	Bacteria	875
84	Ga0070704_100049505	3300005549	Bacteria	2949
85	Ga0068855_100327399	3300005563	Bacteria	1692
86	Ga0068855_100611213	3300005563	Bacteria	1174
87	Ga0068857_100017048	3300005577	Bacteria	6362
88	Ga0068856_100439568	3300005614	Bacteria	1325
89	Ga0070702_100102846	3300005615	Bacteria	1756
90	Ga0070702_100261524	3300005615	Bacteria	1178
91	Ga0068859_100164610	3300005617	Bacteria	2297
92	Ga0068866_10002898	3300005718	Bacteria	7070
93	Ga0068866_10063865	3300005718	Bacteria	1920
94	Ga0068861_100106551	3300005719	Bacteria	2239
95	Ga0068861_100958922	3300005719	Bacteria	814
96	Ga0068870_10134443	3300005840	Bacteria	1440
97	Ga0068863_100195293	3300005841	Bacteria	1945
98	Ga0068863_100315572	3300005841	Bacteria	1518
99	Ga0068863_100917482	3300005841	Bacteria	877
100	Ga0068858_100005846	3300005842	Bacteria	12017
101	Ga0068860_100030340	3300005843	Bacteria	5201
102	Ga0068860_100090257	3300005843	Bacteria	2918
103	Ga0068860_100400629	3300005843	Bacteria	1358
104	Ga0068862_100147834	3300005844	Bacteria	2090
105	Ga0068862_100257147	3300005844	Bacteria	1593
106	Ga0081539_10001364	3300005985	Bacteria	42295
107	Ga0070716_100287749	3300006173	Bacteria	1137
108	Ga0070716_100346103	3300006173	Bacteria	1050
109	Ga0075366_10000666	3300006195	Bacteria	16183
110	Ga0097621_100001153	3300006237	Bacteria	18360
111	Ga0097621_100093888	3300006237	Bacteria	2515
112	Ga0097621_100397432	3300006237	Bacteria	1233
113	Ga0097621_100473952	3300006237	Bacteria	1131
114	Ga0075428_100000532	3300006844	Bacteria	38828
115	Ga0075433_10059938	3300006852	Bacteria	3331
116	Ga0075433_10531900	3300006852	Bacteria	1034
117	Ga0075434_100004910	3300006871	Bacteria	12116
118	Ga0075434_100011723	3300006871	Bacteria	8279
119	Ga0075429_100000324	3300006880	Bacteria	34389
120	Ga0068865_100024180	3300006881	Bacteria	3983
121	Ga0068865_100054614	3300006881	Bacteria	2776
122	Ga0068865_100297285	3300006881	Bacteria	1291
123	Ga0075436_100009070	3300006914	Bacteria	6806
124	Ga0075436_100027479	3300006914	Bacteria	3916
125	Ga0075436_100051039	3300006914	Bacteria	2854
126	Ga0075436_100074204	3300006914	Bacteria	2355
127	Ga0097620_100164610	3300006931	Bacteria	2297
128	Ga0075435_100000887	3300007076	Bacteria	18792
129	Ga0075435_100005202	3300007076	Bacteria	9049
130	Ga0075435_100078200	3300007076	Bacteria	2712
131	Ga0099794_10017672	3300007265	Bacteria	3182
132	Ga0099795_10052863	3300007788	Bacteria	1485
133	Ga0111539_10011581	3300009094	Bacteria	11068
134	Ga0111539_10019692	3300009094	Bacteria	8323
135	Ga0111539_10072574	3300009094	Bacteria	4059
136	Ga0111539_10074045	3300009094	Bacteria	4013
137	Ga0111539_10080009	3300009094	Bacteria	3844
138	Ga0111539_10859233	3300009094	Bacteria	1055
139	Ga0105245_10000515	3300009098	Bacteria	35472
140	Ga0114129_10014186	3300009147	Bacteria	11354
141	Ga0114129_10141094	3300009147	Bacteria	3303
142	Ga0114129_10474598	3300009147	Bacteria	1637
143	Ga0114129_10625986	3300009147	Bacteria	1391
144	Ga0105243_10006067	3300009148	Bacteria	9343
145	Ga0105242_10001066	3300009176	Bacteria	21546
146	Ga0105242_10017457	3300009176	Bacteria	5594
147	Ga0105242_10401567	3300009176	Bacteria	1279
148	Ga0105248_10316878	3300009177	Bacteria	1757
149	Ga0105248_10804902	3300009177	Bacteria	1061
150	Ga0105248_10816714	3300009177	Bacteria	1052
151	Ga0105237_10313598	3300009545	Bacteria	1572
152	Ga0105237_10533825	3300009545	Bacteria	1180
153	Ga0105238_10423423	3300009551	Bacteria	1326
154	Ga0105249_10031943	3300009553	Bacteria	4763
155	Ga0105249_10121156	3300009553	Bacteria	2486
156	Ga0099796_10078520	3300010159	Bacteria	1206
157	Ga0105246_10359803	3300011119	Bacteria	1195
158	Ga0157374_10607542	3300013296	Bacteria	1104
159	Ga0157378_10000746	3300013297	Bacteria	30487
160	Ga0157378_10331790	3300013297	Bacteria	1480
161	Ga0163162_10232647	3300013306	Bacteria	1973
162	Ga0157375_10187147	3300013308	Bacteria	2224
163	Ga0163163_10212716	3300014325	Bacteria	1982
164	Ga0157380_10013785	3300014326	Bacteria	5903
165	Ga0157380_10015130	3300014326	Bacteria	5662
166	Ga0157380_10053703	3300014326	Bacteria	3195
167	Ga0157377_10002865	3300014745	Bacteria	7703
168	Ga0157377_10205143	3300014745	Bacteria	1254
169	Ga0157379_10014938	3300014968	Bacteria	6810
170	Ga0157379_10023168	3300014968	Bacteria	5507
171	Ga0157379_10215160	3300014968	Bacteria	1740
172	Ga0157376_10160502	3300014969	Bacteria	2037
173	Ga0157376_11147081	3300014969	Bacteria	804
174	Ga0163161_10176245	3300017792	Bacteria	1637
175	Ga0163161_10191402	3300017792	Bacteria	1573
176	Ga0163161_10238355	3300017792	Bacteria	1414
177	Ga0163161_10423331	3300017792	Bacteria	1072
178	Ga0209672_104865	3300025228	Bacteria	2406
179	Ga0207666_1009927	3300025271	Bacteria	1294
180	Ga0209455_1001352	3300025272	Bacteria	11264
181	Ga0207697_10000552	3300025315	Bacteria	21216
182	Ga0207682_10000696	3300025893	Bacteria	15554
183	Ga0207692_10227700	3300025898	Bacteria	1108
184	Ga0207642_10030306	3300025899	Bacteria	2252
185	Ga0207642_10146347	3300025899	Bacteria	1252
186	Ga0207688_10434735	3300025901	Bacteria	817
187	Ga0207647_10377062	3300025904	Bacteria	801
188	Ga0207645_10001675	3300025907	Bacteria	18033
189	Ga0207645_10181727	3300025907	Bacteria	1380
190	Ga0207643_10000579	3300025908	Bacteria	23210
191	Ga0207684_10193932	3300025910	Bacteria	1752
192	Ga0207707_10005405	3300025912	Bacteria	11169
193	Ga0207660_10059649	3300025917	Bacteria	2740
194	Ga0207660_10870958	3300025917	Bacteria	735
195	Ga0207662_10000516	3300025918	Bacteria	17183
196	Ga0207662_10100073	3300025918	Bacteria	1795
197	Ga0207662_10118876	3300025918	Bacteria	1655
198	Ga0207649_10105468	3300025920	Bacteria	1873
199	Ga0207649_10250509	3300025920	Bacteria	1275
200	Ga0207652_10015482	3300025921	Bacteria	6200
201	Ga0207681_10296726	3300025923	Bacteria	1277
202	Ga0207650_10001400	3300025925	Bacteria	17395
203	Ga0207659_10187499	3300025926	Bacteria	1643
204	Ga0207664_10032610	3300025929	Bacteria	3995
205	Ga0207664_10080713	3300025929	Bacteria	2645
206	Ga0207644_10263611	3300025931	Bacteria	1378
207	Ga0207690_10295347	3300025932	Bacteria	1266
208	Ga0207706_10279817	3300025933	Bacteria	1455
209	Ga0207706_10778271	3300025933	Bacteria	814
210	Ga0207686_10014752	3300025934	Bacteria	4359
211	Ga0207686_10031499	3300025934	Bacteria	3150
212	Ga0207709_10011240	3300025935	Bacteria	4938
213	Ga0207670_10050306	3300025936	Bacteria	2792
214	Ga0207670_10057480	3300025936	Bacteria	2638
215	Ga0207670_10058454	3300025936	Bacteria	2619
216	Ga0207670_10072695	3300025936	Bacteria	2382
217	Ga0207670_10870469	3300025936	Bacteria	753
218	Ga0207669_10004355	3300025937	Bacteria	6219
219	Ga0207669_10164540	3300025937	Bacteria	1571
220	Ga0207704_10002488	3300025938	Bacteria	8304
221	Ga0207704_10099665	3300025938	Bacteria	1933
222	Ga0207704_10120852	3300025938	Bacteria	1792
223	Ga0207704_10186426	3300025938	Bacteria	1505
224	Ga0207665_10601335	3300025939	Bacteria	859
225	Ga0207691_10836261	3300025940	Bacteria	772
226	Ga0207711_10200175	3300025941	Bacteria	1822
227	Ga0207711_11118317	3300025941	Bacteria	729
228	Ga0207689_10000067	3300025942	Bacteria	83906
229	Ga0207689_10001066	3300025942	Bacteria	26408
230	Ga0207689_10008725	3300025942	Bacteria	8822
231	Ga0207667_10170549	3300025949	Bacteria	2237
232	Ga0207651_10012732	3300025960	Bacteria	4776
233	Ga0207651_10222881	3300025960	Bacteria	1525
234	Ga0207712_10093941	3300025961	Bacteria	2214
235	Ga0207712_10875273	3300025961	Bacteria	793
236	Ga0207658_10049555	3300025986	Bacteria	3087
237	Ga0207658_10436189	3300025986	Bacteria	1157
238	Ga0207677_10160561	3300026023	Bacteria	1746
239	Ga0207703_10022100	3300026035	Bacteria	4985
240	Ga0207703_10053875	3300026035	Bacteria	3270
241	Ga0207678_10003679	3300026067	Bacteria	13784
242	Ga0207678_10129304	3300026067	Bacteria	2154
243	Ga0207708_10000067	3300026075	Bacteria	83659
244	Ga0207708_10000693	3300026075	Bacteria	25576
245	Ga0207702_10177245	3300026078	Bacteria	1960
246	Ga0207641_10055165	3300026088	Bacteria	3374
247	Ga0207641_10223524	3300026088	Bacteria	1747
248	Ga0207641_10441954	3300026088	Bacteria	1255
249	Ga0207648_10000232	3300026089	Bacteria	59568
250	Ga0207648_10001872	3300026089	Bacteria	23010
251	Ga0207648_10010290	3300026089	Bacteria	8881
252	Ga0207648_10013843	3300026089	Bacteria	7483
253	Ga0207648_10446218	3300026089	Bacteria	1177
254	Ga0207674_10006474	3300026116	Bacteria	13767
255	Ga0207675_100000258	3300026118	Bacteria	50669
256	Ga0207675_100020582	3300026118	Bacteria	6148
257	Ga0207675_100600753	3300026118	Bacteria	1103
258	Ga0207683_10007938	3300026121	Bacteria	9084
259	Ga0209974_10004035	3300027876	Bacteria	5249
260	Ga0207428_10000835	3300027907	Bacteria	34652
261	Ga0207428_10037740	3300027907	Bacteria	3930
262	Ga0207428_10062983	3300027907	Bacteria	2931
263	Ga0207428_10136063	3300027907	Bacteria	1878
264	Ga0207428_10143095	3300027907	Bacteria	1824
265	Ga0268266_10102244	3300028379	Bacteria	2527
266	Ga0268265_10028957	3300028380	Bacteria	3970
267	Ga0268265_10247242	3300028380	Bacteria	1577
268	Ga0268264_10045118	3300028381	Bacteria	3659
269	Ga0268264_10344238	3300028381	Bacteria	1417
270	Ga0265336_10044088	3300028666	Bacteria	1358
271	Ga0265324_10006096	3300029957	Bacteria	5092
272	Ga0265324_10073147	3300029957	Bacteria	1167
273	Ga0265330_10001645	3300031235	Bacteria	12705
274	Ga0265325_10056768	3300031241	Bacteria	1998
275	Ga0265331_10005024	3300031250	Bacteria	8106
276	Ga0265331_10034129	3300031250	Bacteria	2512
277	Ga0265331_10037547	3300031250	Bacteria	2371
278	Ga0265327_10000237	3300031251	Bacteria	110403
279	Ga0265327_10024011	3300031251	Bacteria	3592
280	Ga0265316_10378919	3300031344	Bacteria	1021
281	Ga0307509_10654941	3300031507	Bacteria	719
282	Ga0307508_10221881	3300031616	Bacteria	1490
283	Ga0316575_10000732	3300031665	Bacteria	9862
284	Ga0265314_10001850	3300031711	Bacteria	22707
285	Ga0307405_10427464	3300031731	Bacteria	1044
286	Ga0307413_10056831	3300031824	Bacteria	2389
287	Ga0307413_10221986	3300031824	Bacteria	1381
288	Ga0307412_10426774	3300031911	Bacteria	1086
289	Ga0307414_10814491	3300032004	Bacteria	852
290	Ga0316583_10010847	3300032133	Bacteria	3282
291	Ga0373950_0003727	3300034818	Bacteria	2199
292	Ga0373928_0009613	3300035084	Bacteria	1889
293	Ga0373929_0016548	3300035085	Bacteria	1446
294	Ga0373934_0018128	3300035086	Bacteria	2693
295	Ga0373940_0004143	3300035088	Bacteria	3039
296	Ga0373951_0006769	3300035091	Bacteria	2616
297	Ga0373932_0004155	3300035112	Bacteria	3439
298	Ga0373932_0070472	3300035112	Bacteria	1083
299	Ga0373932_0075163	3300035112	Bacteria	1056
300	Ga0373939_0051558	3300035114	Bacteria	1280
301	Ga0373953_0042817	3300035117	Bacteria	1806
302	Ga0373954_0000266	3300035118	Bacteria	18952
303	Ga0373956_0055708	3300035119	Bacteria	1784
304	Ga0373960_0018041	3300035121	Bacteria	1835
305	Ga0373943_0126054	3300035170	Bacteria	1365
306	Ga0373955_0127272	3300035172	Bacteria	1485
307	Ga0373955_0236078	3300035172	Bacteria	1094
308	Ga0373942_0019022	3300035207	Bacteria	1710
309	Ga0373961_0153133	3300035241	Bacteria	787
310	Ga0373962_0006162	3300035242	Bacteria	2899
311	Ga0316574_0000266	3300035398	Bacteria	19315
312	Ga0373931_0011745	3300035691	Bacteria	4233
313	Ga0373931_0016082	3300035691	Bacteria	3678
314	Ga0373931_0102871	3300035691	Bacteria	1609
315	Ga0373933_0094562	3300035724	Bacteria	1848
316	Ga0373933_0234760	3300035724	Bacteria	1179
317	Ga0373933_0251953	3300035724	Bacteria	1137
318	Ga0373947_0050464	3300035725	Bacteria	2502
319	Ga0373937_0005745	3300036401	Bacteria	10659
320	Ga0373937_0077738	3300036401	Bacteria	3067
321	Ga0316582_0076574	3300036647	Bacteria	2176
322	Ga0373925_0006322	3300037068	Bacteria	8726
323	Ga0373925_0353958	3300037068	Bacteria	1193
324	Ga0395900_0057552	3300037418	Bacteria	4002
325	Ga0395900_0218993	3300037418	Bacteria	1920
326	Ga0395901_0015047	3300038443	Bacteria	7867
327	Ga0451577_0001514	3300042876	Bacteria	30625
328	Ga0451577_0022931	3300042876	Bacteria	5698
329	Ga0451577_0039821	3300042876	Bacteria	4221
330	Ga0451577_0272756	3300042876	Bacteria	1532
331	Ga0451577_0652786	3300042876	Bacteria	954
332	Ga0466972_0004984	3300044658	Bacteria	6661
333	Ga0453683_0149915	3300044673	Bacteria	1473
334	Ga0453683_0343937	3300044673	Bacteria	958
335	Ga0453684_0011179	3300044712	Bacteria	15114
336	Ga0453684_0019065	3300044712	Bacteria	10472
337	Ga0453684_0087587	3300044712	Bacteria	3858
338	Ga0453684_0090628	3300044712	Bacteria	3777
339	Ga0453684_0139599	3300044712	Bacteria	2896
340	Ga0453684_0191370	3300044712	Bacteria	2393
341	Ga0453684_0248747	3300044712	Bacteria	2042
342	Ga0453684_0471096	3300044712	Bacteria	1395
343	Ga0451576_0000034	3300045051	Bacteria	390778
344	Ga0451576_0009282	3300045051	Bacteria	11427
345	Ga0451576_0027479	3300045051	Bacteria	6110
346	Ga0451576_0041328	3300045051	Bacteria	4875
347	Ga0451576_0063562	3300045051	Bacteria	3847
348	Ga0451576_0213743	3300045051	Bacteria	2014
349	Ga0495592_0466560	3300046454	Bacteria	789
350	Ga0495603_0101786	3300046455	Bacteria	1677
351	Ga0495629_0064549	3300046459	Bacteria	2556
352	Ga0495650_0013751	3300046471	Bacteria	4258
353	Ga0495582_0018344	3300046473	Bacteria	3828
354	Ga0495582_0037277	3300046473	Bacteria	2674
355	Ga0495662_0030922	3300046476	Bacteria	2585
356	Ga0495584_0000016	3300046491	Bacteria	156560
357	Ga0495583_0000633	3300046506	Bacteria	46837
358	Ga0495606_0002601	3300046507	Bacteria	20643
359	Ga0495630_0085122	3300046517	Bacteria	2387
360	Ga0495630_0175212	3300046517	Bacteria	1635
361	Ga0495640_0194961	3300046533	Bacteria	1286
362	Ga0495586_0023610	3300046535	Bacteria	3285
363	Ga0495621_0002899	3300046539	Bacteria	4674
364	Ga0495645_0015095	3300046543	Bacteria	5489
365	Ga0495633_0196401	3300046558	Bacteria	927
366	Ga0495656_0106449	3300046615	Bacteria	1305
367	Ga0495635_0086191	3300046663	Bacteria	2149
368	Ga0495588_0226194	3300046674	Bacteria	987
369	Ga0495658_0054300	3300046683	Bacteria	2278
370	Ga0495658_0289036	3300046683	Bacteria	1036
371	Ga0495613_0006186	3300046689	Bacteria	8955
372	Ga0495600_0020583	3300046809	Bacteria	4218
373	Ga0495581_0005831	3300047315	Bacteria	7141
374	Ga0495581_0061408	3300047315	Bacteria	2172
375	Ga0495674_0072245	3300047319	Bacteria	2976
376	Ga0495680_0181671	3300047322	Bacteria	1518
377	Ga0495687_134952	3300047443	Bacteria	867
378	Ga0495684_0070629	3300047471	Bacteria	2654
379	Ga0495684_0213998	3300047471	Bacteria	1416
380	Ga0495686_0005281	3300047472	Bacteria	10245
381	Ga0496100_0084195	3300048903	Bacteria	2155
382	Ga0496100_0265538	3300048903	Bacteria	1274
383	Ga0496101_0018724	3300048904	Bacteria	4713
384	Ga0496102_0096749	3300048905	Bacteria	2737
385	Ga0496104_0023226	3300048907	Bacteria	5702
386	Ga0496104_0181005	3300048907	Bacteria	2018
387	Ga0496105_0092645	3300048908	Bacteria	2495
388	Ga0496105_0167219	3300048908	Bacteria	1804
389	Ga0496106_0049782	3300048909	Bacteria	3157
390	Ga0496107_0081481	3300048910	Bacteria	2360
391	Ga0496108_0006405	3300048911	Bacteria	9544
392	Ga0496108_0016828	3300048911	Bacteria	5974
393	Ga0496108_0059658	3300048911	Bacteria	3208
394	Ga0496109_0017330	3300048912	Bacteria	6312
395	Ga0496109_0071700	3300048912	Bacteria	3181
396	Ga0496109_0134494	3300048912	Bacteria	2309
397	Ga0496109_0317043	3300048912	Bacteria	1471
398	Ga0496110_0004013	3300048913	Bacteria	11342
399	Ga0496110_0034594	3300048913	Bacteria	4378
400	Ga0496110_0753644	3300048913	Bacteria	877
401	Ga0496111_0122384	3300048914	Bacteria	1922
402	Ga0496111_0285101	3300048914	Bacteria	1225
403	Ga0496111_0462891	3300048914	Bacteria	935
404	Ga0496112_0202356	3300048915	Bacteria	1945
405	Ga0496113_0511792	3300048916	Bacteria	964
406	Ga0496114_0010695	3300048917	Bacteria	7302
407	Ga0496114_0595001	3300048917	Bacteria	975
408	Ga0496121_0036502	3300048924	Bacteria	4379
409	Ga0496124_0000036	3300048927	Bacteria	318032
410	Ga0501031_0007840	3300049568	Bacteria	6952
411	Ga0501032_0000036	3300049569	Bacteria	117044
412	Ga0501032_0003205	3300049569	Bacteria	12580
413	Ga0501032_0082136	3300049569	Bacteria	2144
414	Ga0501033_0002208	3300049570	Bacteria	16778
415	Ga0501033_0003067	3300049570	Bacteria	13882
416	Ga0501033_0003901	3300049570	Bacteria	12123
417	Ga0501034_0014505	3300049571	Bacteria	8114
418	Ga0501034_0074608	3300049571	Bacteria	3399
419	Ga0501036_0002365	3300049572	Bacteria	14744
420	Ga0501036_0020294	3300049572	Bacteria	5581
421	Ga0501036_0022423	3300049572	Bacteria	5311
422	Ga0501036_0272348	3300049572	Bacteria	1417
423	Ga0501037_0000793	3300049573	Bacteria	23702
424	Ga0501037_0089353	3300049573	Bacteria	2229
425	Ga0501037_0131555	3300049573	Bacteria	1794
426	Ga0501038_0001677	3300049574	Bacteria	20517
427	Ga0501038_0005737	3300049574	Bacteria	11505
428	Ga0501038_0007673	3300049574	Bacteria	9949
429	Ga0501038_0027295	3300049574	Bacteria	5081
430	Ga0501038_0078325	3300049574	Bacteria	2789
431	Ga0501038_0300406	3300049574	Bacteria	1260
432	Ga0501039_0000386	3300049575	Bacteria	31668
433	Ga0501039_0016619	3300049575	Bacteria	5636
434	Ga0501039_0071029	3300049575	Bacteria	2704
435	Ga0501040_0000455	3300049576	Bacteria	24277
436	Ga0501042_0000031	3300049578	Bacteria	46017
437	Ga0501043_0000157	3300049579	Bacteria	62190
438	Ga0501043_0022555	3300049579	Bacteria	4936
439	Ga0501043_0032782	3300049579	Bacteria	4085
440	Ga0501043_0040310	3300049579	Bacteria	3671
441	Ga0501043_0099510	3300049579	Bacteria	2286
442	Ga0501046_0001694	3300049580	Bacteria	21062
443	Ga0501046_0060936	3300049580	Bacteria	2952
444	Ga0501046_0281954	3300049580	Bacteria	1217
445	Ga0501047_0018992	3300049581	Bacteria	6593
446	Ga0501048_0008738	3300049582	Bacteria	7634
447	Ga0501048_0048538	3300049582	Bacteria	3028
448	Ga0501068_0001831	3300049584	Bacteria	11281
449	Ga0501070_0379985	3300049586	Bacteria	1144
450	Ga0501073_0270965	3300049589	Bacteria	1171
451	Ga0501076_0086710	3300049592	Bacteria	2516
452	Ga0501076_0648858	3300049592	Bacteria	871
453	Ga0501077_0031017	3300049593	Bacteria	3401
454	Ga0501216_023978	3300049660	Bacteria	1088
455	Ga0501081_0038454	3300049743	Bacteria	3269
456	Ga0501035_0000889	3300049822	Bacteria	31637
457	Ga0501035_0059417	3300049822	Bacteria	3404
458	Ga0501035_0215299	3300049822	Bacteria	1642
459	Ga0501044_0000062	3300049823	Bacteria	131395
460	Ga0501044_0000389	3300049823	Bacteria	54483
461	Ga0501044_0002064	3300049823	Bacteria	23156
462	Ga0501044_0053815	3300049823	Bacteria	4139
463	Ga0501045_0000607	3300049824	Bacteria	22605
464	Ga0501045_0029793	3300049824	Bacteria	3947
465	nmdc:mga00v17_124916_c1	3300050491	Bacteria	1641
466	nmdc:mga0k408_2018_c1	3300050493	Bacteria	10889
467	nmdc:mga05p37_1126_c1	3300050507	Bacteria	30703
468	nmdc:mga05p37_604268_c1	3300050507	Bacteria	1237
469	nmdc:mga09592_1655_c1	3300050508	Bacteria	17927
470	nmdc:mga09592_97115_c1	3300050508	Bacteria	2521
471	nmdc:mga08y16_130901_c1	3300050511	Bacteria	2609
472	nmdc:mga08y16_38095_c1	3300050511	Bacteria	5049
473	nmdc:mga08y16_4849_c1	3300050511	Bacteria	14041
474	nmdc:mga08y16_51110_c1	3300050511	Bacteria	4324
475	nmdc:mga08y16_54458_c1	3300050511	Bacteria	4180
476	nmdc:mga0n895_10612_c1	3300050512	Bacteria	8155
477	nmdc:mga0n895_87725_c1	3300050512	Bacteria	3110
478	nmdc:mga0rr50_107327_c1	3300050513	Bacteria	2204
479	nmdc:mga0rr50_1816_c1	3300050513	Bacteria	11807
480	nmdc:mga0rr50_255544_c1	3300050513	Bacteria	1456
481	nmdc:mga0rr50_6468_c1	3300050513	Bacteria	7135
482	nmdc:mga08x19_13104_c1	3300050514	Bacteria	5008
483	nmdc:mga08x19_353830_c1	3300050514	Bacteria	1026
484	nmdc:mga08x19_3563_c1	3300050514	Bacteria	9267
485	nmdc:mga08x19_38447_c1	3300050514	Bacteria	3040
486	nmdc:mga08x19_99400_c1	3300050514	Bacteria	1929
487	nmdc:mga0a205_100639_c1	3300050515	Bacteria	2789
488	nmdc:mga0a205_124336_c1	3300050515	Bacteria	2479
489	nmdc:mga0a205_156644_c1	3300050515	Bacteria	2176
490	nmdc:mga0a205_3207_c1	3300050515	Bacteria	14532
491	Ga0495595_0033625	3300053084	Bacteria	2315
492	Ga0495619_0030325	3300053085	Bacteria	3500
493	Ga0495619_0101940	3300053085	Bacteria	1955
494	Ga0590071_024452	3300059421	Bacteria	1431
495	Ga0590075_086499	3300059424	Bacteria	813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049593	Ga0501077_0031017	Ga0501077_0031017_953_1546	197
2	3300005459	Ga0068867_100340286	Ga0068867_1003402862	198
3	3300005546	Ga0070696_100709640	Ga0070696_1007096402	205
4	3300026118	Ga0207675_100600753	Ga0207675_1006007532	205
5	3300005444	Ga0070694_100030431	Ga0070694_1000304315	207
6	3300005547	Ga0070693_100388010	Ga0070693_1003880102	207
7	3300006852	Ga0075433_10531900	Ga0075433_105319002	208
8	3300009147	Ga0114129_10625986	Ga0114129_106259862	208
9	3300025942	Ga0207689_10008725	Ga0207689_100087259	208
10	3300046473	Ga0495582_0018344	Ga0495582_0018344_1019_1645	208
11	3300050515	nmdc:mga0a205_124336_c1	nmdc:mga0a205_124336_c1_1656_2309	208
12	iso_pu_bacteria	8001522603	8001526475	208
13	3300025918	Ga0207662_10118876	Ga0207662_101188763	210
14	3300005546	Ga0070696_100077807	Ga0070696_1000778072	211
15	3300005615	Ga0070702_100102846	Ga0070702_1001028462	211
16	3300006871	Ga0075434_100004910	Ga0075434_1000049105	211
17	3300006914	Ga0075436_100051039	Ga0075436_1000510392	211
18	3300007076	Ga0075435_100005202	Ga0075435_1000052027	211
19	3300009094	Ga0111539_10019692	Ga0111539_1001969211	211
20	3300009176	Ga0105242_10401567	Ga0105242_104015671	211
21	3300025936	Ga0207670_10050306	Ga0207670_100503062	211
22	3300027907	Ga0207428_10143095	Ga0207428_101430952	211
23	3300035086	Ga0373934_0018128	Ga0373934_0018128_1376_2011	211
24	3300035117	Ga0373953_0042817	Ga0373953_0042817_622_1257	211
25	3300035118	Ga0373954_0000266	Ga0373954_0000266_17431_18066	211
26	3300035119	Ga0373956_0055708	Ga0373956_0055708_842_1477	211
27	3300036401	Ga0373937_0005745	Ga0373937_0005745_5906_6541	211
28	3300046517	Ga0495630_0085122	Ga0495630_0085122_346_981	211
29	3300046533	Ga0495640_0194961	Ga0495640_0194961_106_741	211
30	3300046535	Ga0495586_0023610	Ga0495586_0023610_2104_2739	211
31	3300046663	Ga0495635_0086191	Ga0495635_0086191_1381_2016	211
32	3300047319	Ga0495674_0072245	Ga0495674_0072245_647_1282	211
33	3300050508	nmdc:mga09592_97115_c1	nmdc:mga09592_97115_c1_353_988	211
34	3300050511	nmdc:mga08y16_130901_c1	nmdc:mga08y16_130901_c1_742_1377	211
35	3300050512	nmdc:mga0n895_10612_c1	nmdc:mga0n895_10612_c1_5982_6617	211
36	3300050513	nmdc:mga0rr50_255544_c1	nmdc:mga0rr50_255544_c1_394_1029	211
37	3300050513	nmdc:mga0rr50_6468_c1	nmdc:mga0rr50_6468_c1_6228_6863	211
38	3300050515	nmdc:mga0a205_100639_c1	nmdc:mga0a205_100639_c1_780_1415	211
39	3300049568	Ga0501031_0007840	Ga0501031_0007840_1369_2007	212
40	3300049569	Ga0501032_0000036	Ga0501032_0000036_67627_68265	212
41	3300049569	Ga0501032_0003205	Ga0501032_0003205_10240_10878	212
42	3300049569	Ga0501032_0082136	Ga0501032_0082136_893_1531	212
43	3300049570	Ga0501033_0002208	Ga0501033_0002208_6500_7138	212
44	3300049570	Ga0501033_0003067	Ga0501033_0003067_1798_2436	212
45	3300049570	Ga0501033_0003901	Ga0501033_0003901_9999_10637	212
46	3300049571	Ga0501034_0014505	Ga0501034_0014505_1798_2436	212
47	3300049572	Ga0501036_0002365	Ga0501036_0002365_2199_2837	212
48	3300049572	Ga0501036_0020294	Ga0501036_0020294_2218_2856	212
49	3300049572	Ga0501036_0022423	Ga0501036_0022423_3641_4279	212
50	3300049573	Ga0501037_0000793	Ga0501037_0000793_15013_15651	212
51	3300049573	Ga0501037_0089353	Ga0501037_0089353_450_1088	212
52	3300049573	Ga0501037_0131555	Ga0501037_0131555_663_1301	212
53	3300049574	Ga0501038_0001677	Ga0501038_0001677_13999_14637	212
54	3300049574	Ga0501038_0005737	Ga0501038_0005737_10203_10841	212
55	3300049574	Ga0501038_0027295	Ga0501038_0027295_2713_3351	212
56	3300049574	Ga0501038_0300406	Ga0501038_0300406_142_780	212
57	3300049575	Ga0501039_0000386	Ga0501039_0000386_20654_21292	212
58	3300049575	Ga0501039_0016619	Ga0501039_0016619_2068_2706	212
59	3300049576	Ga0501040_0000455	Ga0501040_0000455_10440_11078	212
60	3300049578	Ga0501042_0000031	Ga0501042_0000031_30246_30884	212
61	3300049579	Ga0501043_0000157	Ga0501043_0000157_12773_13411	212
62	3300049579	Ga0501043_0022555	Ga0501043_0022555_3636_4274	212
63	3300049579	Ga0501043_0032782	Ga0501043_0032782_552_1190	212
64	3300049580	Ga0501046_0001694	Ga0501046_0001694_10440_11078	212
65	3300049580	Ga0501046_0281954	Ga0501046_0281954_34_672	212
66	3300049581	Ga0501047_0018992	Ga0501047_0018992_3899_4537	212
67	3300049582	Ga0501048_0008738	Ga0501048_0008738_2625_3263	212
68	3300049584	Ga0501068_0001831	Ga0501068_0001831_4822_5460	212
69	3300049586	Ga0501070_0379985	Ga0501070_0379985_371_1009	212
70	3300049822	Ga0501035_0000889	Ga0501035_0000889_10198_10836	212
71	3300049822	Ga0501035_0059417	Ga0501035_0059417_878_1516	212
72	3300049823	Ga0501044_0000389	Ga0501044_0000389_24113_24751	212
73	3300049823	Ga0501044_0002064	Ga0501044_0002064_14434_15072	212
74	3300049823	Ga0501044_0053815	Ga0501044_0053815_1109_1747	212
75	3300049824	Ga0501045_0000607	Ga0501045_0000607_9799_10437	212
76	3300049824	Ga0501045_0029793	Ga0501045_0029793_1872_2510	212
77	iso_pu_bacteria	8055225921	8055228281	212
78	3300009094	Ga0111539_10072574	Ga0111539_100725742	213
79	3300009094	Ga0111539_10074045	Ga0111539_100740453	213
80	3300025933	Ga0207706_10279817	Ga0207706_102798172	213
81	3300025938	Ga0207704_10186426	Ga0207704_101864262	213
82	3300027907	Ga0207428_10037740	Ga0207428_100377403	213
83	3300032004	Ga0307414_10814491	Ga0307414_108144911	213
84	3300037418	Ga0395900_0218993	Ga0395900_0218993_895_1536	213
85	3300048911	Ga0496108_0006405	Ga0496108_0006405_4779_5420	213
86	3300048912	Ga0496109_0017330	Ga0496109_0017330_1758_2399	213
87	3300048914	Ga0496111_0285101	Ga0496111_0285101_379_1020	213
88	3300048916	Ga0496113_0511792	Ga0496113_0511792_121_762	213
89	3300048917	Ga0496114_0010695	Ga0496114_0010695_5283_5924	213
90	3300049574	Ga0501038_0078325	Ga0501038_0078325_228_869	213
91	3300050511	nmdc:mga08y16_38095_c1	nmdc:mga08y16_38095_c1_770_1411	213
92	3300045051	Ga0451576_0213743	Ga0451576_0213743_1092_1736	214
93	3300049571	Ga0501034_0074608	Ga0501034_0074608_1413_2102	214
94	3300049574	Ga0501038_0007673	Ga0501038_0007673_6050_6739	214
95	3300049575	Ga0501039_0071029	Ga0501039_0071029_1360_2049	214
96	3300049579	Ga0501043_0040310	Ga0501043_0040310_975_1664	214
97	3300049822	Ga0501035_0215299	Ga0501035_0215299_509_1198	214
98	iso_pu_bacteria	2739367655	2739612935	214
99	iso_pu_bacteria	2855730933	2855732580	214
100	iso_pu_bacteria	2855767633	2855769288	214
101	iso_pu_bacteria	2857542790	2857546848	214
102	iso_pu_bacteria	2881927736	2881928085	214
103	3300005614	Ga0068856_100439568	Ga0068856_1004395682	216
104	3300009545	Ga0105237_10533825	Ga0105237_105338252	216
105	3300026078	Ga0207702_10177245	Ga0207702_101772452	216
106	3300031911	Ga0307412_10426774	Ga0307412_104267742	216
107	3300037418	Ga0395900_0057552	Ga0395900_0057552_3186_3842	216
108	3300048913	Ga0496110_0753644	Ga0496110_0753644_116_790	216
109	3300003203	JGI25406J46586_10032142	JGI25406J46586_100321422	217
110	3300004625	Ga0055543_1012095	Ga0055543_10120952	217
111	3300005262	Ga0065165_1000074	Ga0065165_100007447	217
112	3300005328	Ga0070676_10089431	Ga0070676_100894313	217
113	3300005330	Ga0070690_100000525	Ga0070690_1000005252	217
114	3300005330	Ga0070690_100357954	Ga0070690_1003579541	217
115	3300005334	Ga0068869_100009815	Ga0068869_1000098153	217
116	3300005334	Ga0068869_100075172	Ga0068869_1000751722	217
117	3300005340	Ga0070689_100000288	Ga0070689_10000028822	217
118	3300005340	Ga0070689_100102156	Ga0070689_1001021562	217
119	3300005341	Ga0070691_10143188	Ga0070691_101431881	217
120	3300005343	Ga0070687_100273442	Ga0070687_1002734421	217
121	3300005435	Ga0070714_100012639	Ga0070714_1000126394	217
122	3300005441	Ga0070700_100000241	Ga0070700_1000002416	217
123	3300005444	Ga0070694_100046160	Ga0070694_1000461603	217
124	3300005444	Ga0070694_100262660	Ga0070694_1002626602	217
125	3300005458	Ga0070681_10002547	Ga0070681_100025476	217
126	3300005458	Ga0070681_10420213	Ga0070681_104202132	217
127	3300005459	Ga0068867_100011581	Ga0068867_1000115813	217
128	3300005459	Ga0068867_100148158	Ga0068867_1001481582	217
129	3300005467	Ga0070706_100222700	Ga0070706_1002227002	217
130	3300005467	Ga0070706_100506550	Ga0070706_1005065502	217
131	3300005471	Ga0070698_100608768	Ga0070698_1006087682	217
132	3300005518	Ga0070699_100093440	Ga0070699_1000934404	217
133	3300005530	Ga0070679_100022031	Ga0070679_1000220317	217
134	3300005536	Ga0070697_100001057	Ga0070697_1000010573	217
135	3300005544	Ga0070686_100006108	Ga0070686_1000061083	217
136	3300005545	Ga0070695_100000298	Ga0070695_10000029825	217
137	3300005546	Ga0070696_100002472	Ga0070696_1000024727	217
138	3300005546	Ga0070696_100114996	Ga0070696_1001149962	217
139	3300005547	Ga0070693_100483551	Ga0070693_1004835511	217
140	3300005718	Ga0068866_10002898	Ga0068866_100028982	217
141	3300005719	Ga0068861_100958922	Ga0068861_1009589222	217
142	3300005840	Ga0068870_10134443	Ga0068870_101344432	217
143	3300005841	Ga0068863_100917482	Ga0068863_1009174821	217
144	3300005842	Ga0068858_100005846	Ga0068858_10000584612	217
145	3300005843	Ga0068860_100030340	Ga0068860_1000303405	217
146	3300005844	Ga0068862_100257147	Ga0068862_1002571472	217
147	3300005985	Ga0081539_10001364	Ga0081539_100013647	217
148	3300006173	Ga0070716_100287749	Ga0070716_1002877492	217
149	3300006237	Ga0097621_100001153	Ga0097621_10000115315	217
150	3300006844	Ga0075428_100000532	Ga0075428_10000053232	217
151	3300006852	Ga0075433_10059938	Ga0075433_100599382	217
152	3300006871	Ga0075434_100011723	Ga0075434_1000117233	217
153	3300006880	Ga0075429_100000324	Ga0075429_10000032412	217
154	3300006881	Ga0068865_100024180	Ga0068865_1000241802	217
155	3300006914	Ga0075436_100009070	Ga0075436_1000090704	217
156	3300006914	Ga0075436_100027479	Ga0075436_1000274796	217
157	3300006914	Ga0075436_100074204	Ga0075436_1000742044	217
158	3300007076	Ga0075435_100000887	Ga0075435_1000008877	217
159	3300007076	Ga0075435_100078200	Ga0075435_1000782004	217
160	3300007265	Ga0099794_10017672	Ga0099794_100176723	217
161	3300007788	Ga0099795_10052863	Ga0099795_100528632	217
162	3300009094	Ga0111539_10011581	Ga0111539_100115815	217
163	3300009094	Ga0111539_10080009	Ga0111539_100800092	217
164	3300009098	Ga0105245_10000515	Ga0105245_1000051530	217
165	3300009147	Ga0114129_10014186	Ga0114129_1001418612	217
166	3300009147	Ga0114129_10141094	Ga0114129_101410942	217
167	3300009148	Ga0105243_10006067	Ga0105243_100060679	217
168	3300009176	Ga0105242_10001066	Ga0105242_1000106619	217
169	3300009177	Ga0105248_10804902	Ga0105248_108049021	217
170	3300009545	Ga0105237_10313598	Ga0105237_103135982	217
171	3300009551	Ga0105238_10423423	Ga0105238_104234231	217
172	3300009553	Ga0105249_10031943	Ga0105249_100319436	217
173	3300010159	Ga0099796_10078520	Ga0099796_100785202	217
174	3300011119	Ga0105246_10359803	Ga0105246_103598032	217
175	3300013297	Ga0157378_10000746	Ga0157378_100007467	217
176	3300013297	Ga0157378_10331790	Ga0157378_103317902	217
177	3300014326	Ga0157380_10015130	Ga0157380_100151306	217
178	3300014745	Ga0157377_10205143	Ga0157377_102051432	217
179	3300014968	Ga0157379_10215160	Ga0157379_102151602	217
180	3300017792	Ga0163161_10176245	Ga0163161_101762451	217
181	3300017792	Ga0163161_10423331	Ga0163161_104233311	217
182	3300025898	Ga0207692_10227700	Ga0207692_102277001	217
183	3300025899	Ga0207642_10146347	Ga0207642_101463472	217
184	3300025901	Ga0207688_10434735	Ga0207688_104347352	217
185	3300025907	Ga0207645_10181727	Ga0207645_101817272	217
186	3300025910	Ga0207684_10193932	Ga0207684_101939322	217
187	3300025912	Ga0207707_10005405	Ga0207707_1000540513	217
188	3300025917	Ga0207660_10059649	Ga0207660_100596492	217
189	3300025917	Ga0207660_10870958	Ga0207660_108709581	217
190	3300025918	Ga0207662_10100073	Ga0207662_101000732	217
191	3300025921	Ga0207652_10015482	Ga0207652_100154822	217
192	3300025929	Ga0207664_10080713	Ga0207664_100807132	217
193	3300025934	Ga0207686_10031499	Ga0207686_100314993	217
194	3300025935	Ga0207709_10011240	Ga0207709_100112403	217
195	3300025936	Ga0207670_10057480	Ga0207670_100574802	217
196	3300025936	Ga0207670_10072695	Ga0207670_100726953	217
197	3300025936	Ga0207670_10870469	Ga0207670_108704691	217
198	3300025938	Ga0207704_10002488	Ga0207704_100024884	217
199	3300025939	Ga0207665_10601335	Ga0207665_106013351	217
200	3300025942	Ga0207689_10000067	Ga0207689_1000006756	217
201	3300025961	Ga0207712_10875273	Ga0207712_108752731	217
202	3300026023	Ga0207677_10160561	Ga0207677_101605611	217
203	3300026035	Ga0207703_10053875	Ga0207703_100538753	217
204	3300026075	Ga0207708_10000067	Ga0207708_1000006779	217
205	3300026088	Ga0207641_10223524	Ga0207641_102235242	217
206	3300026089	Ga0207648_10000232	Ga0207648_100002328	217
207	3300026089	Ga0207648_10446218	Ga0207648_104462182	217
208	3300026118	Ga0207675_100000258	Ga0207675_1000002583	217
209	3300027907	Ga0207428_10000835	Ga0207428_1000083511	217
210	3300027907	Ga0207428_10136063	Ga0207428_101360632	217
211	3300028380	Ga0268265_10028957	Ga0268265_100289571	217
212	3300031344	Ga0265316_10378919	Ga0265316_103789192	217
213	3300031616	Ga0307508_10221881	Ga0307508_102218812	217
214	3300031665	Ga0316575_10000732	Ga0316575_100007325	217
215	3300031824	Ga0307413_10056831	Ga0307413_100568313	217
216	3300031824	Ga0307413_10221986	Ga0307413_102219862	217
217	3300034818	Ga0373950_0003727	Ga0373950_0003727_556_1209	217
218	3300035084	Ga0373928_0009613	Ga0373928_0009613_543_1196	217
219	3300035085	Ga0373929_0016548	Ga0373929_0016548_203_856	217
220	3300035088	Ga0373940_0004143	Ga0373940_0004143_1475_2128	217
221	3300035091	Ga0373951_0006769	Ga0373951_0006769_817_1470	217
222	3300035112	Ga0373932_0004155	Ga0373932_0004155_2309_2962	217
223	3300035112	Ga0373932_0070472	Ga0373932_0070472_192_845	217
224	3300035112	Ga0373932_0075163	Ga0373932_0075163_144_797	217
225	3300035114	Ga0373939_0051558	Ga0373939_0051558_585_1238	217
226	3300035121	Ga0373960_0018041	Ga0373960_0018041_461_1114	217
227	3300035172	Ga0373955_0127272	Ga0373955_0127272_801_1454	217
228	3300035207	Ga0373942_0019022	Ga0373942_0019022_249_902	217
229	3300035241	Ga0373961_0153133	Ga0373961_0153133_55_708	217
230	3300035242	Ga0373962_0006162	Ga0373962_0006162_1606_2259	217
231	3300035691	Ga0373931_0016082	Ga0373931_0016082_725_1378	217
232	3300035691	Ga0373931_0102871	Ga0373931_0102871_517_1170	217
233	3300035724	Ga0373933_0094562	Ga0373933_0094562_153_806	217
234	3300035724	Ga0373933_0251953	Ga0373933_0251953_16_669	217
235	3300036401	Ga0373937_0077738	Ga0373937_0077738_1709_2362	217
236	3300037068	Ga0373925_0353958	Ga0373925_0353958_471_1124	217
237	3300042876	Ga0451577_0001514	Ga0451577_0001514_11214_11867	217
238	3300042876	Ga0451577_0039821	Ga0451577_0039821_1885_2538	217
239	3300042876	Ga0451577_0272756	Ga0451577_0272756_125_778	217
240	3300042876	Ga0451577_0652786	Ga0451577_0652786_199_852	217
241	3300044658	Ga0466972_0004984	Ga0466972_0004984_4454_5107	217
242	3300044712	Ga0453684_0011179	Ga0453684_0011179_1254_1907	217
243	3300044712	Ga0453684_0019065	Ga0453684_0019065_5129_5782	217
244	3300044712	Ga0453684_0087587	Ga0453684_0087587_2516_3169	217
245	3300044712	Ga0453684_0090628	Ga0453684_0090628_2520_3173	217
246	3300044712	Ga0453684_0139599	Ga0453684_0139599_1118_1771	217
247	3300044712	Ga0453684_0191370	Ga0453684_0191370_1453_2106	217
248	3300044712	Ga0453684_0248747	Ga0453684_0248747_521_1174	217
249	3300044712	Ga0453684_0471096	Ga0453684_0471096_392_1126	217
250	3300045051	Ga0451576_0009282	Ga0451576_0009282_8492_9145	217
251	3300045051	Ga0451576_0027479	Ga0451576_0027479_5446_6099	217
252	3300045051	Ga0451576_0041328	Ga0451576_0041328_1571_2224	217
253	3300045051	Ga0451576_0063562	Ga0451576_0063562_3183_3836	217
254	3300046454	Ga0495592_0466560	Ga0495592_0466560_30_683	217
255	3300046615	Ga0495656_0106449	Ga0495656_0106449_217_870	217
256	3300046674	Ga0495588_0226194	Ga0495588_0226194_18_671	217
257	3300047315	Ga0495581_0061408	Ga0495581_0061408_220_873	217
258	3300047471	Ga0495684_0213998	Ga0495684_0213998_455_1108	217
259	3300048903	Ga0496100_0265538	Ga0496100_0265538_117_770	217
260	3300048905	Ga0496102_0096749	Ga0496102_0096749_735_1388	217
261	3300048908	Ga0496105_0092645	Ga0496105_0092645_14_667	217
262	3300048911	Ga0496108_0016828	Ga0496108_0016828_190_843	217
263	3300048913	Ga0496110_0034594	Ga0496110_0034594_1395_2048	217
264	3300048914	Ga0496111_0462891	Ga0496111_0462891_130_783	217
265	3300049580	Ga0501046_0060936	Ga0501046_0060936_446_1099	217
266	3300049582	Ga0501048_0048538	Ga0501048_0048538_2140_2793	217
267	3300049589	Ga0501073_0270965	Ga0501073_0270965_337_990	217
268	3300049592	Ga0501076_0086710	Ga0501076_0086710_774_1427	217
269	3300049592	Ga0501076_0648858	Ga0501076_0648858_117_770	217
270	3300049743	Ga0501081_0038454	Ga0501081_0038454_2169_2822	217
271	3300050491	nmdc:mga00v17_124916_c1	nmdc:mga00v17_124916_c1_28_681	217
272	3300050507	nmdc:mga05p37_1126_c1	nmdc:mga05p37_1126_c1_28232_28885	217
273	3300050508	nmdc:mga09592_1655_c1	nmdc:mga09592_1655_c1_1095_1748	217
274	3300050511	nmdc:mga08y16_4849_c1	nmdc:mga08y16_4849_c1_3015_3668	217
275	3300050511	nmdc:mga08y16_54458_c1	nmdc:mga08y16_54458_c1_1078_1731	217
276	3300050512	nmdc:mga0n895_87725_c1	nmdc:mga0n895_87725_c1_1291_1944	217
277	3300050513	nmdc:mga0rr50_107327_c1	nmdc:mga0rr50_107327_c1_422_1075	217
278	3300050513	nmdc:mga0rr50_1816_c1	nmdc:mga0rr50_1816_c1_8719_9372	217
279	3300050514	nmdc:mga08x19_13104_c1	nmdc:mga08x19_13104_c1_230_883	217
280	3300050514	nmdc:mga08x19_353830_c1	nmdc:mga08x19_353830_c1_207_860	217
281	3300050514	nmdc:mga08x19_3563_c1	nmdc:mga08x19_3563_c1_6267_6920	217
282	3300050514	nmdc:mga08x19_99400_c1	nmdc:mga08x19_99400_c1_580_1233	217
283	3300050515	nmdc:mga0a205_156644_c1	nmdc:mga0a205_156644_c1_971_1624	217
284	3300050515	nmdc:mga0a205_3207_c1	nmdc:mga0a205_3207_c1_13350_14003	217
285	3300053085	Ga0495619_0101940	Ga0495619_0101940_528_1181	217
286	3300002244	JGI24742J22300_10044515	JGI24742J22300_100445152	218
287	3300003163	Ga0006759J45824_1060182	Ga0006759J45824_10601821	218
288	3300003544	Ga0007417J51691_1029735	Ga0007417J51691_10297351	218
289	3300003574	Ga0007410J51695_1038368	Ga0007410J51695_10383681	218
290	3300003575	Ga0007409J51694_1014788	Ga0007409J51694_10147882	218
291	3300003577	Ga0007416J51690_1024881	Ga0007416J51690_10248812	218
292	3300003693	Ga0032354_1027395	Ga0032354_10273951	218
293	3300005290	Ga0065712_10136099	Ga0065712_101360991	218
294	3300005328	Ga0070676_10038787	Ga0070676_100387872	218
295	3300005329	Ga0070683_100011251	Ga0070683_1000112512	218
296	3300005333	Ga0070677_10008719	Ga0070677_100087192	218
297	3300005334	Ga0068869_100018841	Ga0068869_1000188417	218
298	3300005338	Ga0068868_100364468	Ga0068868_1003644681	218
299	3300005340	Ga0070689_100023335	Ga0070689_1000233357	218
300	3300005343	Ga0070687_100012830	Ga0070687_1000128301	218
301	3300005344	Ga0070661_100130850	Ga0070661_1001308502	218
302	3300005345	Ga0070692_10246125	Ga0070692_102461251	218
303	3300005347	Ga0070668_100187533	Ga0070668_1001875332	218
304	3300005355	Ga0070671_100200224	Ga0070671_1002002242	218
305	3300005356	Ga0070674_100011298	Ga0070674_1000112983	218
306	3300005356	Ga0070674_100019277	Ga0070674_1000192774	218
307	3300005366	Ga0070659_100038961	Ga0070659_1000389612	218
308	3300005435	Ga0070714_100271648	Ga0070714_1002716482	218
309	3300005436	Ga0070713_100199920	Ga0070713_1001999202	218
310	3300005439	Ga0070711_100029977	Ga0070711_1000299774	218
311	3300005441	Ga0070700_100007416	Ga0070700_1000074165	218
312	3300005445	Ga0070708_100056954	Ga0070708_1000569544	218
313	3300005455	Ga0070663_100081975	Ga0070663_1000819754	218
314	3300005455	Ga0070663_100126179	Ga0070663_1001261791	218
315	3300005456	Ga0070678_100130195	Ga0070678_1001301952	218
316	3300005457	Ga0070662_100133435	Ga0070662_1001334352	218
317	3300005459	Ga0068867_100050522	Ga0068867_1000505222	218
318	3300005459	Ga0068867_100060803	Ga0068867_1000608032	218
319	3300005466	Ga0070685_10040706	Ga0070685_100407064	218
320	3300005467	Ga0070706_100056054	Ga0070706_1000560543	218
321	3300005467	Ga0070706_100156603	Ga0070706_1001566033	218
322	3300005468	Ga0070707_100088069	Ga0070707_1000880693	218
323	3300005471	Ga0070698_100193578	Ga0070698_1001935782	218
324	3300005471	Ga0070698_100574397	Ga0070698_1005743972	218
325	3300005518	Ga0070699_100237079	Ga0070699_1002370792	218
326	3300005535	Ga0070684_100183581	Ga0070684_1001835811	218
327	3300005536	Ga0070697_100121675	Ga0070697_1001216752	218
328	3300005536	Ga0070697_100190310	Ga0070697_1001903101	218
329	3300005539	Ga0068853_100427111	Ga0068853_1004271112	218
330	3300005543	Ga0070672_100205382	Ga0070672_1002053822	218
331	3300005544	Ga0070686_100452348	Ga0070686_1004523482	218
332	3300005545	Ga0070695_100444509	Ga0070695_1004445092	218
333	3300005549	Ga0070704_100049505	Ga0070704_1000495052	218
334	3300005563	Ga0068855_100327399	Ga0068855_1003273992	218
335	3300005563	Ga0068855_100611213	Ga0068855_1006112132	218
336	3300005577	Ga0068857_100017048	Ga0068857_1000170482	218
337	3300005615	Ga0070702_100261524	Ga0070702_1002615242	218
338	3300005617	Ga0068859_100164610	Ga0068859_1001646103	218
339	3300005718	Ga0068866_10063865	Ga0068866_100638652	218
340	3300005719	Ga0068861_100106551	Ga0068861_1001065514	218
341	3300005841	Ga0068863_100195293	Ga0068863_1001952932	218
342	3300005841	Ga0068863_100315572	Ga0068863_1003155722	218
343	3300005843	Ga0068860_100090257	Ga0068860_1000902573	218
344	3300005843	Ga0068860_100400629	Ga0068860_1004006292	218
345	3300005844	Ga0068862_100147834	Ga0068862_1001478343	218
346	3300006173	Ga0070716_100346103	Ga0070716_1003461032	218
347	3300006195	Ga0075366_10000666	Ga0075366_100006666	218
348	3300006237	Ga0097621_100093888	Ga0097621_1000938882	218
349	3300006237	Ga0097621_100397432	Ga0097621_1003974322	218
350	3300006237	Ga0097621_100473952	Ga0097621_1004739522	218
351	3300006881	Ga0068865_100054614	Ga0068865_1000546144	218
352	3300006881	Ga0068865_100297285	Ga0068865_1002972852	218
353	3300006931	Ga0097620_100164610	Ga0097620_1001646103	218
354	3300009094	Ga0111539_10859233	Ga0111539_108592331	218
355	3300009147	Ga0114129_10474598	Ga0114129_104745981	218
356	3300009176	Ga0105242_10017457	Ga0105242_100174576	218
357	3300009177	Ga0105248_10316878	Ga0105248_103168782	218
358	3300009177	Ga0105248_10816714	Ga0105248_108167142	218
359	3300009553	Ga0105249_10121156	Ga0105249_101211562	218
360	3300013296	Ga0157374_10607542	Ga0157374_106075422	218
361	3300013306	Ga0163162_10232647	Ga0163162_102326472	218
362	3300013308	Ga0157375_10187147	Ga0157375_101871474	218
363	3300014325	Ga0163163_10212716	Ga0163163_102127163	218
364	3300014326	Ga0157380_10013785	Ga0157380_100137852	218
365	3300014326	Ga0157380_10053703	Ga0157380_100537034	218
366	3300014745	Ga0157377_10002865	Ga0157377_100028658	218
367	3300014968	Ga0157379_10014938	Ga0157379_100149388	218
368	3300014968	Ga0157379_10023168	Ga0157379_100231687	218
369	3300014969	Ga0157376_10160502	Ga0157376_101605022	218
370	3300014969	Ga0157376_11147081	Ga0157376_111470811	218
371	3300017792	Ga0163161_10191402	Ga0163161_101914022	218
372	3300017792	Ga0163161_10238355	Ga0163161_102383551	218
373	3300025228	Ga0209672_104865	Ga0209672_1048653	218
374	3300025271	Ga0207666_1009927	Ga0207666_10099272	218
375	3300025272	Ga0209455_1001352	Ga0209455_10013524	218
376	3300025315	Ga0207697_10000552	Ga0207697_100005523	218
377	3300025893	Ga0207682_10000696	Ga0207682_1000069615	218
378	3300025899	Ga0207642_10030306	Ga0207642_100303061	218
379	3300025904	Ga0207647_10377062	Ga0207647_103770621	218
380	3300025907	Ga0207645_10001675	Ga0207645_1000167517	218
381	3300025908	Ga0207643_10000579	Ga0207643_100005791	218
382	3300025918	Ga0207662_10000516	Ga0207662_1000051617	218
383	3300025920	Ga0207649_10105468	Ga0207649_101054682	218
384	3300025920	Ga0207649_10250509	Ga0207649_102505091	218
385	3300025923	Ga0207681_10296726	Ga0207681_102967262	218
386	3300025925	Ga0207650_10001400	Ga0207650_1000140015	218
387	3300025926	Ga0207659_10187499	Ga0207659_101874992	218
388	3300025929	Ga0207664_10032610	Ga0207664_100326102	218
389	3300025931	Ga0207644_10263611	Ga0207644_102636112	218
390	3300025932	Ga0207690_10295347	Ga0207690_102953471	218
391	3300025933	Ga0207706_10778271	Ga0207706_107782711	218
392	3300025934	Ga0207686_10014752	Ga0207686_100147522	218
393	3300025936	Ga0207670_10058454	Ga0207670_100584543	218
394	3300025937	Ga0207669_10004355	Ga0207669_100043552	218
395	3300025937	Ga0207669_10164540	Ga0207669_101645402	218
396	3300025938	Ga0207704_10099665	Ga0207704_100996653	218
397	3300025938	Ga0207704_10120852	Ga0207704_101208522	218
398	3300025940	Ga0207691_10836261	Ga0207691_108362611	218
399	3300025941	Ga0207711_10200175	Ga0207711_102001752	218
400	3300025941	Ga0207711_11118317	Ga0207711_111183171	218
401	3300025942	Ga0207689_10001066	Ga0207689_100010669	218
402	3300025949	Ga0207667_10170549	Ga0207667_101705491	218
403	3300025960	Ga0207651_10012732	Ga0207651_100127325	218
404	3300025960	Ga0207651_10222881	Ga0207651_102228812	218
405	3300025961	Ga0207712_10093941	Ga0207712_100939413	218
406	3300025986	Ga0207658_10049555	Ga0207658_100495552	218
407	3300025986	Ga0207658_10436189	Ga0207658_104361891	218
408	3300026035	Ga0207703_10022100	Ga0207703_100221002	218
409	3300026067	Ga0207678_10003679	Ga0207678_100036792	218
410	3300026067	Ga0207678_10129304	Ga0207678_101293041	218
411	3300026075	Ga0207708_10000693	Ga0207708_100006935	218
412	3300026088	Ga0207641_10055165	Ga0207641_100551652	218
413	3300026088	Ga0207641_10441954	Ga0207641_104419542	218
414	3300026089	Ga0207648_10001872	Ga0207648_1000187217	218
415	3300026089	Ga0207648_10010290	Ga0207648_100102905	218
416	3300026089	Ga0207648_10013843	Ga0207648_100138433	218
417	3300026116	Ga0207674_10006474	Ga0207674_100064749	218
418	3300026118	Ga0207675_100020582	Ga0207675_1000205829	218
419	3300026121	Ga0207683_10007938	Ga0207683_1000793810	218
420	3300027876	Ga0209974_10004035	Ga0209974_100040354	218
421	3300027907	Ga0207428_10062983	Ga0207428_100629833	218
422	3300028379	Ga0268266_10102244	Ga0268266_101022443	218
423	3300028380	Ga0268265_10247242	Ga0268265_102472422	218
424	3300028381	Ga0268264_10045118	Ga0268264_100451182	218
425	3300028381	Ga0268264_10344238	Ga0268264_103442382	218
426	3300028666	Ga0265336_10044088	Ga0265336_100440882	218
427	3300029957	Ga0265324_10006096	Ga0265324_100060965	218
428	3300029957	Ga0265324_10073147	Ga0265324_100731472	218
429	3300031235	Ga0265330_10001645	Ga0265330_100016459	218
430	3300031241	Ga0265325_10056768	Ga0265325_100567684	218
431	3300031250	Ga0265331_10005024	Ga0265331_100050244	218
432	3300031250	Ga0265331_10034129	Ga0265331_100341293	218
433	3300031250	Ga0265331_10037547	Ga0265331_100375472	218
434	3300031251	Ga0265327_10000237	Ga0265327_1000023738	218
435	3300031251	Ga0265327_10024011	Ga0265327_100240114	218
436	3300031507	Ga0307509_10654941	Ga0307509_106549411	218
437	3300031711	Ga0265314_10001850	Ga0265314_100018502	218
438	3300031731	Ga0307405_10427464	Ga0307405_104274642	218
439	3300032133	Ga0316583_10010847	Ga0316583_100108472	218
440	3300035170	Ga0373943_0126054	Ga0373943_0126054_502_1158	218
441	3300035172	Ga0373955_0236078	Ga0373955_0236078_171_827	218
442	3300035398	Ga0316574_0000266	Ga0316574_0000266_11365_12024	218
443	3300035691	Ga0373931_0011745	Ga0373931_0011745_502_1158	218
444	3300035724	Ga0373933_0234760	Ga0373933_0234760_371_1036	218
445	3300035725	Ga0373947_0050464	Ga0373947_0050464_349_1005	218
446	3300036647	Ga0316582_0076574	Ga0316582_0076574_590_1264	218
447	3300037068	Ga0373925_0006322	Ga0373925_0006322_5822_6478	218
448	3300038443	Ga0395901_0015047	Ga0395901_0015047_3125_3781	218
449	3300042876	Ga0451577_0022931	Ga0451577_0022931_1347_2003	218
450	3300044673	Ga0453683_0149915	Ga0453683_0149915_36_695	218
451	3300044673	Ga0453683_0343937	Ga0453683_0343937_149_805	218
452	3300045051	Ga0451576_0000034	Ga0451576_0000034_21050_21706	218
453	3300046455	Ga0495603_0101786	Ga0495603_0101786_810_1466	218
454	3300046459	Ga0495629_0064549	Ga0495629_0064549_1327_1983	218
455	3300046471	Ga0495650_0013751	Ga0495650_0013751_1259_1915	218
456	3300046473	Ga0495582_0037277	Ga0495582_0037277_332_988	218
457	3300046476	Ga0495662_0030922	Ga0495662_0030922_1199_1855	218
458	3300046491	Ga0495584_0000016	Ga0495584_0000016_102550_103215	218
459	3300046506	Ga0495583_0000633	Ga0495583_0000633_15266_15931	218
460	3300046507	Ga0495606_0002601	Ga0495606_0002601_3674_4330	218
461	3300046517	Ga0495630_0175212	Ga0495630_0175212_934_1590	218
462	3300046539	Ga0495621_0002899	Ga0495621_0002899_1858_2514	218
463	3300046543	Ga0495645_0015095	Ga0495645_0015095_3493_4149	218
464	3300046558	Ga0495633_0196401	Ga0495633_0196401_99_755	218
465	3300046683	Ga0495658_0054300	Ga0495658_0054300_519_1175	218
466	3300046683	Ga0495658_0289036	Ga0495658_0289036_342_998	218
467	3300046689	Ga0495613_0006186	Ga0495613_0006186_338_994	218
468	3300046809	Ga0495600_0020583	Ga0495600_0020583_2386_3042	218
469	3300047315	Ga0495581_0005831	Ga0495581_0005831_5075_5731	218
470	3300047322	Ga0495680_0181671	Ga0495680_0181671_17_673	218
471	3300047443	Ga0495687_134952	Ga0495687_134952_164_829	218
472	3300047471	Ga0495684_0070629	Ga0495684_0070629_1425_2081	218
473	3300047472	Ga0495686_0005281	Ga0495686_0005281_1949_2605	218
474	3300048903	Ga0496100_0084195	Ga0496100_0084195_482_1138	218
475	3300048904	Ga0496101_0018724	Ga0496101_0018724_1676_2332	218
476	3300048907	Ga0496104_0023226	Ga0496104_0023226_2059_2715	218
477	3300048907	Ga0496104_0181005	Ga0496104_0181005_167_823	218
478	3300048908	Ga0496105_0167219	Ga0496105_0167219_452_1108	218
479	3300048909	Ga0496106_0049782	Ga0496106_0049782_1135_1791	218
480	3300048910	Ga0496107_0081481	Ga0496107_0081481_878_1534	218
481	3300048911	Ga0496108_0059658	Ga0496108_0059658_211_867	218
482	3300048912	Ga0496109_0071700	Ga0496109_0071700_1221_1877	218
483	3300048912	Ga0496109_0134494	Ga0496109_0134494_638_1294	218
484	3300048912	Ga0496109_0317043	Ga0496109_0317043_32_688	218
485	3300048913	Ga0496110_0004013	Ga0496110_0004013_4153_4809	218
486	3300048914	Ga0496111_0122384	Ga0496111_0122384_895_1551	218
487	3300048915	Ga0496112_0202356	Ga0496112_0202356_219_875	218
488	3300048917	Ga0496114_0595001	Ga0496114_0595001_308_964	218
489	3300048924	Ga0496121_0036502	Ga0496121_0036502_2364_3020	218
490	3300048927	Ga0496124_0000036	Ga0496124_0000036_113304_113960	218
491	3300049572	Ga0501036_0272348	Ga0501036_0272348_79_753	218
492	3300049579	Ga0501043_0099510	Ga0501043_0099510_1092_1748	218
493	3300049660	Ga0501216_023978	Ga0501216_023978_264_920	218
494	3300049823	Ga0501044_0000062	Ga0501044_0000062_95437_96093	218
495	3300050493	nmdc:mga0k408_2018_c1	nmdc:mga0k408_2018_c1_5430_6086	218
496	3300050507	nmdc:mga05p37_604268_c1	nmdc:mga05p37_604268_c1_532_1188	218
497	3300050511	nmdc:mga08y16_51110_c1	nmdc:mga08y16_51110_c1_293_949	218
498	3300050514	nmdc:mga08x19_38447_c1	nmdc:mga08x19_38447_c1_2019_2675	218
499	3300053084	Ga0495595_0033625	Ga0495595_0033625_749_1414	218
500	3300053085	Ga0495619_0030325	Ga0495619_0030325_573_1229	218
501	3300059421	Ga0590071_024452	Ga0590071_024452_588_1253	218
502	3300059424	Ga0590075_086499	Ga0590075_086499_96_761	218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

32

214

0.99 PF05191

ADK_lid

Adenylate kinase, active site lid

150

185

0.98 PF13207

AAA_17

AAA domain

33

161

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6s36-assembly1.cif.gz_A	crystal structure of e. coli adenylate kinase r119k mutant	0.9384	1	217
6s36-assembly1.cif.gz_A	crystal structure of e. coli adenylate kinase r119k mutant	0.9343	1	217
6rze-assembly1.cif.gz_A	crystal structure of e. coli adenylate kinase r119a mutant	0.9327	1	217
6rze-assembly1.cif.gz_A	crystal structure of e. coli adenylate kinase r119a mutant	0.9286	1	217
4np6-assembly2.cif.gz_D	crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor	0.9084	1	217

ID	Description	Score	Start	End	Superfamily
af_Q4D4A2_1_210_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8991	1	216	3.40.50.300
af_Q4D4A2_1_210_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8871	1	216	3.40.50.300
af_A4I9I1_1_215_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8862	1	216	3.40.50.300
3umfA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8793	3	216	3.40.50.300
af_Q96MA6_268_474_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8696	2	215	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A520G5U1-F1-model_v4	Adenylate kinase (EC 2.7.4.3)	0.9946	57	216	GO:0004017 GO:0005524 GO:0005737
AF-A0A355PGB4-F1-model_v4	Adenylate kinase (EC 2.7.4.3)	0.9915	81	217	GO:0004017 GO:0005524 GO:0005737
AF-A0A258UUR4-F1-model_v4	Adenylate kinase (EC 2.7.4.3)	0.9899	56	217	GO:0004017 GO:0005524 GO:0005737
AF-A0A3D2AJ35-F1-model_v4	Adenylate kinase (EC 2.7.4.3)	0.9894	57	216	GO:0004017 GO:0005524 GO:0005737
AF-A0A355PGB4-F1-model_v4	Adenylate kinase (EC 2.7.4.3)	0.9844	81	217	GO:0004017 GO:0005524 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
94.41	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455893

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00406

ADK

Adenylate kinase

32

214

0.99

PF05191

ADK_lid

Adenylate kinase, active site lid

150

185

0.98

PF13207

AAA_17

AAA domain

33

161

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map