F455697

General Info

Members Datasets Scaffolds Average Seq Length
501 291 490 97

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10014923|Ga0213875_100149231
Length 115
Sequence MSSANKSALAARRRAAKLSREAMYAIVRNPVITEKATTVGERNQMVFRVALDATKPEIKAAIEGLFSVKVTAVNTLIVKGKTKRFRGRPGRRSDVKKAYVELAQGQSIDLSTGLA

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221580 Devosia sp. Root635 Isolate Unclassified
3 2643221591 Devosia sp. Root685 Isolate Unclassified
4 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
5 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
6 2643221629 Devosia sp. Root105 Isolate Unclassified
7 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
8 2643221662 Devosia sp. Root413D1 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2643221674 Devosia sp. Root436 Isolate Unclassified
11 2932401849 Devosia sp. 2618 Isolate Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
172 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
265 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
269 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.63
Metatranscriptomes 11.18
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 2.79
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000830 3300003215 Bacteria 18874
2 Ga0006777J48905_1081902 3300003308 Bacteria 545
3 Ga0006780_1044058 3300003735 Bacteria 552
4 Ga0058862_12808773 3300004803 Bacteria 3691
5 Ga0070658_10094080 3300005327 Bacteria 2472
6 Ga0070683_101664720 3300005329 Bacteria 613
7 Ga0070680_100020347 3300005336 Bacteria 5268
8 Ga0070682_100792633 3300005337 Bacteria 769
9 Ga0068868_101901312 3300005338 Bacteria 564
10 Ga0070660_100001324 3300005339 Bacteria 16829
11 Ga0070689_101375863 3300005340 Bacteria 637
12 Ga0070691_10000386 3300005341 Bacteria 16019
13 Ga0070691_10000795 3300005341 Bacteria 12588
14 Ga0070661_100005946 3300005344 Bacteria 8403
15 Ga0070661_100584297 3300005344 Bacteria 902
16 Ga0070668_100050837 3300005347 Bacteria 3192
17 Ga0070659_100410917 3300005366 Bacteria 1144
18 Ga0070667_100853948 3300005367 Bacteria 846
19 Ga0070709_10003511 3300005434 Bacteria 8423
20 Ga0070714_100011419 3300005435 Bacteria 7044
21 Ga0070714_100990624 3300005435 Bacteria 818
22 Ga0070713_100000012 3300005436 Bacteria 137708
23 Ga0070713_100508190 3300005436 Bacteria 1138
24 Ga0070710_10947475 3300005437 Bacteria 624
25 Ga0070710_11314108 3300005437 Unclassified 538
26 Ga0070705_100068685 3300005440 Bacteria 2133
27 Ga0070708_101305242 3300005445 Bacteria 678
28 Ga0070681_10029349 3300005458 Bacteria 5523
29 Ga0070681_10221516 3300005458 Bacteria 1807
30 Ga0070699_100225191 3300005518 Bacteria 1672
31 Ga0070679_100057285 3300005530 Bacteria 3884
32 Ga0070679_101580192 3300005530 Bacteria 603
33 Ga0070684_101325896 3300005535 Bacteria 677
34 Ga0068853_100002660 3300005539 Bacteria 13466
35 Ga0070695_100003098 3300005545 Bacteria 9679
36 Ga0070693_100051681 3300005547 Bacteria 2354
37 Ga0070693_100054219 3300005547 Bacteria 2305
38 Ga0070693_100203035 3300005547 Bacteria 1289
39 Ga0070693_100745378 3300005547 Bacteria 721
40 Ga0068855_100012001 3300005563 Bacteria 10474
41 Ga0068855_100057023 3300005563 Bacteria 4580
42 Ga0070664_100858079 3300005564 Bacteria 850
43 Ga0070664_102154978 3300005564 Bacteria 529
44 Ga0068857_100007896 3300005577 Bacteria 9178
45 Ga0068854_100837950 3300005578 Bacteria 804
46 Ga0068856_100001032 3300005614 Bacteria 29659
47 Ga0068856_100034393 3300005614 Bacteria 4964
48 Ga0068856_100158389 3300005614 Bacteria 2274
49 Ga0068856_100221172 3300005614 Bacteria 1909
50 Ga0068856_100551362 3300005614 Bacteria 1174
51 Ga0068856_101043910 3300005614 Bacteria 835
52 Ga0068856_101577817 3300005614 Bacteria 670
53 Ga0068852_100006800 3300005616 Bacteria 8301
54 Ga0068864_101027904 3300005618 Bacteria 818
55 Ga0068858_100274655 3300005842 Bacteria 1604
56 Ga0068858_100342360 3300005842 Bacteria 1431
57 Ga0068862_101884812 3300005844 Bacteria 608
58 Ga0075363_100224636 3300006048 Bacteria 1077
59 Ga0075364_10475916 3300006051 Bacteria 854
60 Ga0075364_11177196 3300006051 Bacteria 520
61 Ga0070716_100046578 3300006173 Bacteria 2441
62 Ga0070716_100738028 3300006173 Bacteria 756
63 Ga0070712_100000902 3300006175 Bacteria 17764
64 Ga0070712_100576142 3300006175 Bacteria 950
65 Ga0075367_10068874 3300006178 Bacteria 2123
66 Ga0075369_10091481 3300006186 Bacteria 1358
67 Ga0075366_10096605 3300006195 Bacteria 1771
68 Ga0097621_100069869 3300006237 Bacteria 2900
69 Ga0075370_10094675 3300006353 Bacteria 1725
70 Ga0075370_10900220 3300006353 Bacteria 541
71 Ga0068871_100289882 3300006358 Bacteria 1434
72 Ga0068871_102215043 3300006358 Bacteria 524
73 Ga0075434_100129075 3300006871 Bacteria 2546
74 Ga0075434_100153113 3300006871 Bacteria 2326
75 Ga0075436_100002564 3300006914 Bacteria 12509
76 Ga0075436_100019157 3300006914 Bacteria 4689
77 Ga0075435_100177695 3300007076 Bacteria 1798
78 Ga0105240_10017473 3300009093 Bacteria 9666
79 Ga0105240_10389360 3300009093 Bacteria 1572
80 Ga0105240_10555162 3300009093 Bacteria 1270
81 Ga0105240_11557115 3300009093 Bacteria 692
82 Ga0105240_11758260 3300009093 Bacteria 647
83 Ga0105245_10745293 3300009098 Bacteria 1015
84 Ga0105245_11444059 3300009098 Bacteria 738
85 Ga0105241_10120327 3300009174 Bacteria 2113
86 Ga0105241_10159833 3300009174 Bacteria 1851
87 Ga0105241_10176283 3300009174 Bacteria 1770
88 Ga0105241_10347551 3300009174 Bacteria 1287
89 Ga0105241_11634568 3300009174 Bacteria 624
90 Ga0105248_11225997 3300009177 Bacteria 848
91 Ga0105237_10032303 3300009545 Bacteria 5300
92 Ga0105238_10001939 3300009551 Bacteria 20807
93 Ga0105238_10035831 3300009551 Bacteria 5044
94 Ga0105239_10060445 3300010375 Bacteria 4159
95 Ga0105239_13315078 3300010375 Bacteria 524
96 Ga0105239_13602993 3300010375 Bacteria 503
97 Ga0157373_10000820 3300013100 Bacteria 24076
98 Ga0157373_10049430 3300013100 Bacteria 2997
99 Ga0157371_10199235 3300013102 Bacteria 1435
100 Ga0157371_11314288 3300013102 Bacteria 560
101 Ga0157370_10003448 3300013104 Bacteria 18559
102 Ga0157370_10040902 3300013104 Bacteria 4474
103 Ga0157369_10001535 3300013105 Bacteria 28280
104 Ga0157374_10294923 3300013296 Bacteria 1603
105 Ga0157378_10804115 3300013297 Bacteria 966
106 Ga0163162_10363163 3300013306 Bacteria 1581
107 Ga0163162_12602856 3300013306 Bacteria 582
108 Ga0157372_10023820 3300013307 Bacteria 6641
109 Ga0157372_10059581 3300013307 Bacteria 4270
110 Ga0157372_10171999 3300013307 Bacteria 2506
111 Ga0157372_10213448 3300013307 Bacteria 2236
112 Ga0157372_10722197 3300013307 Bacteria 1159
113 Ga0157372_11473348 3300013307 Bacteria 784
114 Ga0157372_11864112 3300013307 Bacteria 691
115 Ga0157375_13248534 3300013308 Bacteria 542
116 Ga0163163_10056493 3300014325 Bacteria 3880
117 Ga0163163_11244725 3300014325 Bacteria 807
118 Ga0163163_11342325 3300014325 Bacteria 777
119 Ga0163163_11940963 3300014325 Bacteria 649
120 Ga0182008_10327796 3300014497 Bacteria 807
121 Ga0157379_10018171 3300014968 Bacteria 6195
122 Ga0157379_10038101 3300014968 Bacteria 4289
123 Ga0157379_10071200 3300014968 Bacteria 3111
124 Ga0157376_10346022 3300014969 Bacteria 1421
125 Ga0157376_11742471 3300014969 Bacteria 659
126 Ga0163161_11402451 3300017792 Bacteria 610
127 Ga0213874_10432912 3300021377 Bacteria 516
128 Ga0213876_10000421 3300021384 Bacteria 35344
129 Ga0213876_10457751 3300021384 Bacteria 679
130 Ga0213875_10014923 3300021388 Bacteria 3784
131 Ga0213875_10028865 3300021388 Bacteria 2631
132 Ga0213875_10184431 3300021388 Bacteria 980
133 Ga0213871_10151872 3300021441 Bacteria 705
134 Ga0209026_1018320 3300025250 Bacteria 1109
135 Ga0209676_1050469 3300025292 Bacteria 1097
136 Ga0209758_1000013 3300025297 Bacteria 873003
137 Ga0207699_10000164 3300025906 Bacteria 41177
138 Ga0207699_11374856 3300025906 Bacteria 522
139 Ga0207705_10000180 3300025909 Bacteria 66404
140 Ga0207654_10084942 3300025911 Bacteria 1914
141 Ga0207654_10102125 3300025911 Bacteria 1768
142 Ga0207654_10541599 3300025911 Bacteria 826
143 Ga0207707_10002211 3300025912 Bacteria 17599
144 Ga0207707_10429662 3300025912 Bacteria 1131
145 Ga0207695_10029506 3300025913 Bacteria 6057
146 Ga0207695_10396750 3300025913 Bacteria 1264
147 Ga0207695_10445276 3300025913 Bacteria 1178
148 Ga0207695_10544668 3300025913 Bacteria 1042
149 Ga0207671_10016535 3300025914 Bacteria 5730
150 Ga0207693_10001929 3300025915 Bacteria 18163
151 Ga0207693_10037608 3300025915 Bacteria 3814
152 Ga0207663_10191451 3300025916 Bacteria 1469
153 Ga0207660_10000110 3300025917 Bacteria 46792
154 Ga0207660_10485992 3300025917 Bacteria 1001
155 Ga0207657_10000241 3300025919 Bacteria 57958
156 Ga0207649_10000194 3300025920 Bacteria 50112
157 Ga0207652_10001654 3300025921 Bacteria 19554
158 Ga0207694_10008694 3300025924 Bacteria 7666
159 Ga0207694_10031812 3300025924 Bacteria 4033
160 Ga0207694_10895675 3300025924 Bacteria 750
161 Ga0207687_10303333 3300025927 Bacteria 1287
162 Ga0207687_11129468 3300025927 Bacteria 673
163 Ga0207700_10000295 3300025928 Bacteria 29631
164 Ga0207664_10028891 3300025929 Bacteria 4219
165 Ga0207664_11414258 3300025929 Bacteria 616
166 Ga0207690_10292625 3300025932 Bacteria 1272
167 Ga0207690_11131133 3300025932 Bacteria 653
168 Ga0207670_10892977 3300025936 Bacteria 744
169 Ga0207669_10539265 3300025937 Bacteria 940
170 Ga0207665_10070338 3300025939 Bacteria 2388
171 Ga0207661_10117898 3300025944 Bacteria 2256
172 Ga0207661_10890155 3300025944 Bacteria 820
173 Ga0207661_11870905 3300025944 Bacteria 546
174 Ga0207679_10812828 3300025945 Bacteria 853
175 Ga0207667_10006198 3300025949 Bacteria 14519
176 Ga0207667_10013025 3300025949 Bacteria 9546
177 Ga0207667_10024994 3300025949 Bacteria 6548
178 Ga0207668_11557841 3300025972 Bacteria 596
179 Ga0207658_10149838 3300025986 Bacteria 1899
180 Ga0207703_10044546 3300026035 Bacteria 3567
181 Ga0207703_10224569 3300026035 Bacteria 1681
182 Ga0207639_10010763 3300026041 Bacteria 6339
183 Ga0207702_10000315 3300026078 Bacteria 55383
184 Ga0207702_10009824 3300026078 Bacteria 8022
185 Ga0207702_10579822 3300026078 Bacteria 1099
186 Ga0207702_10631139 3300026078 Bacteria 1053
187 Ga0207702_10839870 3300026078 Bacteria 909
188 Ga0207702_11473593 3300026078 Bacteria 674
189 Ga0207702_11634739 3300026078 Bacteria 637
190 Ga0207676_10661181 3300026095 Bacteria 1009
191 Ga0207674_10001605 3300026116 Bacteria 29115
192 Ga0207674_10200318 3300026116 Bacteria 1946
193 Ga0207698_10036626 3300026142 Bacteria 3604
194 Ga0207698_12079595 3300026142 Bacteria 582
195 Ga0268265_10313520 3300028380 Bacteria 1417
196 Ga0268265_11562257 3300028380 Bacteria 664
197 Ga0268264_12546933 3300028381 Bacteria 516
198 Ga0265337_1083801 3300028556 Bacteria 871
199 Ga0265336_10166374 3300028666 Bacteria 656
200 Ga0265338_10309665 3300028800 Bacteria 1146
201 Ga0316182_1227941 3300030745 Bacteria 968
202 Ga0265332_10203971 3300031238 Bacteria 821
203 Ga0265332_10212412 3300031238 Bacteria 803
204 Ga0265325_10000820 3300031241 Bacteria 22557
205 Ga0265325_10012680 3300031241 Bacteria 4814
206 Ga0265340_10138662 3300031247 Bacteria 1113
207 Ga0265339_10005687 3300031249 Bacteria 8275
208 Ga0265331_10119323 3300031250 Bacteria 1206
209 Ga0265327_10005226 3300031251 Bacteria 10946
210 Ga0265316_10061302 3300031344 Bacteria 2922
211 Ga0307408_100927653 3300031548 Bacteria 798
212 Ga0265313_10001315 3300031595 Bacteria 23436
213 Ga0265313_10047949 3300031595 Bacteria 2064
214 Ga0265314_10004460 3300031711 Bacteria 12990
215 Ga0265314_10098246 3300031711 Bacteria 1889
216 Ga0265314_10137507 3300031711 Bacteria 1515
217 Ga0265314_10225166 3300031711 Bacteria 1091
218 Ga0265314_10227005 3300031711 Bacteria 1086
219 Ga0265342_10257424 3300031712 Bacteria 930
220 Ga0307405_10452206 3300031731 Bacteria 1018
221 Ga0307413_10002271 3300031824 Bacteria 7767
222 Ga0307413_11838117 3300031824 Bacteria 543
223 Ga0307410_10813726 3300031852 Bacteria 795
224 Ga0307406_10119121 3300031901 Bacteria 1832
225 Ga0307407_10114232 3300031903 Bacteria 1701
226 Ga0307407_10835703 3300031903 Bacteria 703
227 Ga0307412_10338458 3300031911 Bacteria 1203
228 Ga0307412_10595494 3300031911 Bacteria 935
229 Ga0307412_11261291 3300031911 Bacteria 664
230 Ga0307412_11743685 3300031911 Bacteria 572
231 Ga0307409_101230991 3300031995 Bacteria 772
232 Ga0307414_10358294 3300032004 Bacteria 1254
233 Ga0307414_10445229 3300032004 Bacteria 1135
234 Ga0307414_10667161 3300032004 Bacteria 938
235 Ga0307411_10427678 3300032005 Bacteria 1102
236 Ga0307411_10753026 3300032005 Bacteria 853
237 Ga0307411_10911607 3300032005 Bacteria 781
238 Ga0307415_100071944 3300032126 Bacteria 2434
239 Ga0307415_100943921 3300032126 Bacteria 798
240 Ga0316593_10005586 3300032168 Bacteria 3329
241 Ga0316593_10050501 3300032168 Bacteria 1404
242 Ga0373923_0596853 3300035111 Bacteria 544
243 Ga0373932_0041782 3300035112 Bacteria 1326
244 Ga0373932_0167090 3300035112 Bacteria 764
245 Ga0373957_0407957 3300035120 Bacteria 585
246 Ga0373943_0129614 3300035170 Bacteria 1349
247 Ga0373943_0616662 3300035170 Bacteria 640
248 Ga0373955_0017677 3300035172 Bacteria 3533
249 Ga0373931_0788435 3300035691 Bacteria 633
250 Ga0373935_0235103 3300035692 Bacteria 1277
251 Ga0373933_0246665 3300035724 Bacteria 1149
252 Ga0373933_0746233 3300035724 Bacteria 644
253 Ga0373937_0058492 3300036401 Bacteria 3541
254 Ga0373937_0542341 3300036401 Bacteria 1105
255 Ga0373937_1599824 3300036401 Bacteria 599
256 Ga0373937_1818248 3300036401 Bacteria 556
257 Ga0316582_1125678 3300036647 Bacteria 535
258 Ga0373925_0127468 3300037068 Bacteria 1981
259 Ga0436364_0000682 3300037853 Bacteria 2241
260 Ga0436364_0554982 3300037853 Bacteria 6536
261 Ga0436364_0586291 3300037853 Bacteria 97560
262 Ga0436365_0340931 3300039437 Bacteria 1168
263 Ga0436365_0630930 3300039437 Bacteria 601
264 Ga0436365_1505093 3300039437 Bacteria 2918
265 Ga0436365_1637588 3300039437 Bacteria 49130
266 Ga0436365_1652185 3300039437 Bacteria 660
267 Ga0436360_0764332 3300039438 Bacteria 1442
268 Ga0436360_0920335 3300039438 Bacteria 1450
269 Ga0436360_1031228 3300039438 Bacteria 563
270 Ga0436360_1157227 3300039438 Bacteria 1115
271 Ga0436360_1324784 3300039438 Bacteria 797
272 Ga0436363_1404294 3300039450 Bacteria 4549
273 Ga0436362_0587556 3300039453 Bacteria 1070
274 Ga0439439_0223197 3300041406 Bacteria 553
275 Ga0439461_0052874 3300041410 Bacteria 905
276 Ga0439466_0139938 3300041411 Bacteria 743
277 Ga0439465_0246044 3300041413 Bacteria 660
278 Ga0451789_1040143 3300041443 Bacteria 965
279 Ga0451792_23173 3300041445 Bacteria 512
280 Ga0451794_03409 3300041446 Bacteria 536
281 Ga0451791_0063844 3300041451 Bacteria 535
282 Ga0451791_0268437 3300041451 Bacteria 822
283 Ga0451801_43680 3300041455 Bacteria 562
284 Ga0451795_0203980 3300041456 Bacteria 789
285 Ga0451802_0642518 3300041460 Bacteria 638
286 Ga0451805_125400 3300041461 Bacteria 615
287 Ga0451833_0331039 3300041491 Bacteria 715
288 Ga0451845_0239639 3300041501 Bacteria 507
289 Ga0439441_043699 3300042001 Bacteria 905
290 Ga0439445_0141063 3300042004 Bacteria 699
291 Ga0439448_0271099 3300042005 Bacteria 601
292 Ga0439449_0097806 3300042007 Bacteria 1084
293 Ga0439462_0147411 3300042015 Bacteria 661
294 Ga0439446_0246033 3300042156 Bacteria 615
295 Ga0451577_0371323 3300042876 Bacteria 1298
296 Ga0453684_2211924 3300044712 Bacteria 549
297 Ga0466967_0404941 3300045976 Bacteria 1328
298 Ga0466967_0871669 3300045976 Bacteria 895
299 Ga0466967_0975239 3300045976 Bacteria 844
300 Ga0495580_0036721 3300046472 Bacteria 3517
301 Ga0495610_0040653 3300046512 Bacteria 2342
302 Ga0495630_0132271 3300046517 Bacteria 1895
303 Ga0495643_0450010 3300046522 Bacteria 561
304 Ga0495668_0493590 3300046616 Bacteria 675
305 Ga0495611_0417542 3300046648 Bacteria 613
306 Ga0495625_0572496 3300046660 Bacteria 681
307 Ga0495657_0141296 3300046675 Bacteria 1500
308 Ga0495623_0050531 3300046679 Bacteria 2633
309 Ga0495669_0000044 3300046684 Bacteria 85633
310 Ga0495669_0000371 3300046684 Bacteria 22866
311 Ga0495649_0627517 3300046694 Bacteria 529
312 Ga0495677_0023144 3300047445 Bacteria 2255
313 Ga0496102_0664674 3300048905 Bacteria 965
314 Ga0496106_0379828 3300048909 Bacteria 1135
315 Ga0496106_1297000 3300048909 Bacteria 565
316 Ga0496110_0357780 3300048913 Bacteria 1330
317 Ga0496110_0974744 3300048913 Bacteria 755
318 Ga0496124_0256921 3300048927 Bacteria 1288
319 Ga0496125_0000815 3300048928 Bacteria 50702
320 Ga0496125_0023733 3300048928 Bacteria 5655
321 Ga0496126_0000480 3300048929 Bacteria 79257
322 Ga0496126_0133942 3300048929 Bacteria 2139
323 Ga0496126_0482697 3300048929 Bacteria 993
324 Ga0501306_005105 3300049127 Bacteria 1494
325 Ga0501306_009483 3300049127 Bacteria 1208
326 Ga0501306_026822 3300049127 Bacteria 836
327 Ga0501308_040044 3300049128 Bacteria 657
328 Ga0501310_003705 3300049130 Bacteria 1504
329 Ga0501341_02105 3300049131 Bacteria 1053
330 Ga0501341_02423 3300049131 Bacteria 1008
331 Ga0501305_054820 3300049161 Bacteria 676
332 Ga0501307_022378 3300049162 Bacteria 830
333 Ga0501307_022590 3300049162 Bacteria 828
334 Ga0501313_014478 3300049529 Bacteria 934
335 Ga0501314_004138 3300049530 Bacteria 1193
336 Ga0501315_074828 3300049531 Bacteria 567
337 Ga0501316_017029 3300049532 Bacteria 888
338 Ga0501316_039006 3300049532 Bacteria 657
339 Ga0501317_054332 3300049533 Bacteria 643
340 Ga0501319_003698 3300049535 Bacteria 1036
341 Ga0501319_024439 3300049535 Bacteria 557
342 Ga0501320_016366 3300049536 Bacteria 820
343 Ga0501320_031740 3300049536 Bacteria 660
344 Ga0501320_034114 3300049536 Bacteria 645
345 Ga0501321_008994 3300049537 Bacteria 1071
346 Ga0501321_010431 3300049537 Bacteria 1020
347 Ga0501321_028338 3300049537 Bacteria 736
348 Ga0501322_013594 3300049538 Bacteria 658
349 Ga0501323_008914 3300049539 Bacteria 1174
350 Ga0501323_039722 3300049539 Bacteria 686
351 Ga0501324_016590 3300049540 Bacteria 724
352 Ga0501324_023410 3300049540 Bacteria 643
353 Ga0501325_003636 3300049541 Bacteria 1136
354 Ga0501325_026121 3300049541 Bacteria 645
355 Ga0501328_07265 3300049544 Bacteria 586
356 Ga0501329_07883 3300049545 Bacteria 631
357 Ga0501332_11664 3300049548 Bacteria 597
358 Ga0501334_02556 3300049550 Bacteria 1087
359 Ga0501338_19576 3300049554 Bacteria 500
360 Ga0501031_0071408 3300049568 Bacteria 2261
361 Ga0501031_0090980 3300049568 Bacteria 1990
362 Ga0501031_0333523 3300049568 Bacteria 982
363 Ga0501031_0742197 3300049568 Bacteria 630
364 Ga0501032_0288405 3300049569 Bacteria 1062
365 Ga0501032_0294266 3300049569 Bacteria 1050
366 Ga0501032_0625334 3300049569 Bacteria 684
367 Ga0501032_0655441 3300049569 Bacteria 667
368 Ga0501033_0109003 3300049570 Bacteria 2017
369 Ga0501033_0148779 3300049570 Bacteria 1690
370 Ga0501033_0659132 3300049570 Bacteria 714
371 Ga0501034_0066576 3300049571 Bacteria 3615
372 Ga0501034_0213220 3300049571 Bacteria 1885
373 Ga0501034_0247011 3300049571 Bacteria 1729
374 Ga0501034_0392517 3300049571 Bacteria 1311
375 Ga0501034_0700656 3300049571 Bacteria 911
376 Ga0501034_0820627 3300049571 Bacteria 822
377 Ga0501036_0109734 3300049572 Bacteria 2331
378 Ga0501036_0511071 3300049572 Bacteria 999
379 Ga0501036_0584288 3300049572 Bacteria 927
380 Ga0501037_0015651 3300049573 Bacteria 5584
381 Ga0501037_0050986 3300049573 Bacteria 3027
382 Ga0501037_0321929 3300049573 Bacteria 1070
383 Ga0501037_0640198 3300049573 Bacteria 711
384 Ga0501037_0828493 3300049573 Bacteria 610
385 Ga0501038_0044247 3300049574 Bacteria 3870
386 Ga0501038_0177720 3300049574 Bacteria 1719
387 Ga0501038_0219570 3300049574 Bacteria 1517
388 Ga0501043_0169190 3300049579 Bacteria 1705
389 Ga0501043_0577040 3300049579 Bacteria 833
390 Ga0501043_0594310 3300049579 Bacteria 818
391 Ga0501043_1026065 3300049579 Bacteria 586
392 Ga0501046_0012992 3300049580 Bacteria 7068
393 Ga0501046_0101892 3300049580 Bacteria 2202
394 Ga0501046_0121566 3300049580 Bacteria 1986
395 Ga0501046_0122100 3300049580 Bacteria 1981
396 Ga0501046_0400169 3300049580 Bacteria 992
397 Ga0501046_1207684 3300049580 Bacteria 519
398 Ga0501047_0019729 3300049581 Bacteria 6470
399 Ga0501047_0025781 3300049581 Bacteria 5653
400 Ga0501047_0027205 3300049581 Bacteria 5508
401 Ga0501047_0095267 3300049581 Bacteria 2855
402 Ga0501047_0111494 3300049581 Bacteria 2618
403 Ga0501047_0389956 3300049581 Bacteria 1226
404 Ga0501047_0985431 3300049581 Bacteria 656
405 Ga0501048_0102315 3300049582 Bacteria 2021
406 Ga0501048_0211995 3300049582 Bacteria 1374
407 Ga0501048_1325511 3300049582 Bacteria 517
408 Ga0501067_0005350 3300049583 Bacteria 7126
409 Ga0501067_0033573 3300049583 Bacteria 2846
410 Ga0501068_0423151 3300049584 Bacteria 860
411 Ga0501069_0005996 3300049585 Bacteria 6340
412 Ga0501069_0208376 3300049585 Bacteria 1134
413 Ga0501070_0001611 3300049586 Bacteria 20025
414 Ga0501070_0003398 3300049586 Bacteria 13819
415 Ga0501070_0624901 3300049586 Bacteria 857
416 Ga0501070_0663235 3300049586 Bacteria 827
417 Ga0501072_0013154 3300049588 Bacteria 6335
418 Ga0501073_0004494 3300049589 Bacteria 10476
419 Ga0501073_0017294 3300049589 Bacteria 5223
420 Ga0501073_0048979 3300049589 Bacteria 2963
421 Ga0501073_0414933 3300049589 Bacteria 930
422 Ga0501074_0010906 3300049590 Bacteria 6595
423 Ga0501225_0304278 3300049705 Bacteria 540
424 Ga0501079_0018448 3300049741 Bacteria 5331
425 Ga0501080_0006960 3300049742 Bacteria 10202
426 Ga0501080_0028291 3300049742 Bacteria 5213
427 Ga0501080_0142334 3300049742 Bacteria 2217
428 Ga0501080_0253758 3300049742 Bacteria 1603
429 Ga0501080_0708509 3300049742 Bacteria 887
430 Ga0501080_1100428 3300049742 Bacteria 686
431 Ga0501083_0366031 3300049744 Bacteria 938
432 Ga0501083_0446865 3300049744 Bacteria 841
433 Ga0501035_0013364 3300049822 Bacteria 7579
434 Ga0501035_0024934 3300049822 Bacteria 5484
435 Ga0501035_0134735 3300049822 Bacteria 2151
436 Ga0501035_0178365 3300049822 Bacteria 1831
437 Ga0501035_0520272 3300049822 Bacteria 977
438 Ga0501035_0683218 3300049822 Bacteria 829
439 Ga0501044_0028702 3300049823 Bacteria 5870
440 Ga0501044_0087802 3300049823 Bacteria 3140
441 Ga0501044_0236197 3300049823 Bacteria 1773
442 Ga0501044_0545236 3300049823 Bacteria 1057
443 Ga0501044_0583131 3300049823 Bacteria 1012
444 Ga0501044_0697989 3300049823 Bacteria 900
445 Ga0501044_0765300 3300049823 Bacteria 847
446 Ga0501044_0773014 3300049823 Bacteria 841
447 Ga0501044_1122855 3300049823 Bacteria 655
448 nmdc:mga03n38_489073_c1 3300050490 Bacteria 689
449 nmdc:mga00v17_207481_c1 3300050491 Bacteria 1267
450 nmdc:mga0k408_262086_c1 3300050493 Bacteria 1032
451 nmdc:mga06z11_195671_c1 3300050494 Bacteria 1172
452 nmdc:mga07m45_86553_c1 3300050496 Bacteria 1793
453 nmdc:mga0n895_129615_c1 3300050512 Bacteria 2547
454 nmdc:mga0n895_158795_c1 3300050512 Bacteria 2292
455 nmdc:mga0rr50_163926_c1 3300050513 Bacteria 1806
456 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
457 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
458 Ga0495612_0403865 3300053078 Bacteria 621
459 Ga0500643_000003 3300053087 Bacteria 876659
460 Ga0500646_0150602 3300053090 Bacteria 770
461 Ga0500555_061498 3300053103 Bacteria 1009
462 Ga0500562_111055 3300053108 Bacteria 747
463 Ga0500595_033265 3300053119 Bacteria 1712
464 Ga0500597_374807 3300053120 Bacteria 547
465 Ga0500608_168807 3300053122 Bacteria 940
466 Ga0500642_0441554 3300053130 Bacteria 560
467 Ga0500655_049063 3300053133 Bacteria 839
468 Ga0500568_0069253 3300053139 Bacteria 1353
469 Ga0500573_0280594 3300053140 Bacteria 843
470 Ga0500604_0000294 3300053151 Bacteria 13881
471 Ga0500616_0044593 3300053153 Bacteria 2365
472 Ga0500624_019940 3300053157 Bacteria 1070
473 Ga0500634_0000031 3300053161 Bacteria 75547
474 Ga0500611_115817 3300053727 Bacteria 709
475 Ga0501084_0030163 3300054114 Bacteria 4535
476 Ga0501084_0044330 3300054114 Bacteria 3724
477 Ga0501084_0127908 3300054114 Bacteria 2138
478 Ga0587084_063256 3300059477 Bacteria 683
479 Ga0587070_094488 3300059491 Bacteria 678
480 Ga0587077_095959 3300059493 Bacteria 705
481 Ga0587083_0101128 3300059505 Bacteria 718
482 Ga0587109_074821 3300059624 Bacteria 739
483 Ga0587062_051278 3300059639 Bacteria 699
484 Ga0587068_004290 3300059641 Bacteria 1877
485 Ga0587068_125347 3300059641 Bacteria 561
486 Ga0587072_001135 3300059643 Bacteria 3158
487 Ga0587079_049145 3300059647 Bacteria 880
488 Ga0587107_017865 3300059652 Bacteria 954
489 Ga0501082_0194897 3300060353 Bacteria 1762
490 Ga0530510_0792685 3300061734 Bacteria 723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049550 Ga0501334_02556 Ga0501334_02556_287_574 87
2 3300039438 Ga0436360_1324784 Ga0436360_1324784_490_771 92
3 3300045976 Ga0466967_0404941 Ga0466967_0404941_22_303 92
4 3300049541 Ga0501325_026121 Ga0501325_026121_103_384 92
5 3300005437 Ga0070710_11314108 Ga0070710_113141081 93
6 iso_pu_bacteria 2643221580 2643911582 93
7 iso_pu_bacteria 2643221591 2643963618 93
8 iso_pu_bacteria 2643221629 2644165901 93
9 iso_pu_bacteria 2643221662 2644347089 93
10 iso_pu_bacteria 2643221674 2644410374 93
11 iso_pu_bacteria 2932401849 2932403064 93
12 3300005435 Ga0070714_100990624 Ga0070714_1009906242 94
13 3300005535 Ga0070684_101325896 Ga0070684_1013258962 94
14 3300005547 Ga0070693_100203035 Ga0070693_1002030352 94
15 3300005547 Ga0070693_100745378 Ga0070693_1007453782 94
16 3300005614 Ga0068856_100551362 Ga0068856_1005513622 94
17 3300005614 Ga0068856_101577817 Ga0068856_1015778172 94
18 3300006175 Ga0070712_100576142 Ga0070712_1005761422 94
19 3300006237 Ga0097621_100069869 Ga0097621_1000698695 94
20 3300013307 Ga0157372_10023820 Ga0157372_100238206 94
21 3300013307 Ga0157372_10171999 Ga0157372_101719992 94
22 3300013307 Ga0157372_10722197 Ga0157372_107221972 94
23 3300013307 Ga0157372_11473348 Ga0157372_114733482 94
24 3300014497 Ga0182008_10327796 Ga0182008_103277962 94
25 3300014969 Ga0157376_10346022 Ga0157376_103460222 94
26 3300014969 Ga0157376_11742471 Ga0157376_117424712 94
27 3300021377 Ga0213874_10432912 Ga0213874_104329122 94
28 3300021384 Ga0213876_10000421 Ga0213876_100004216 94
29 3300025915 Ga0207693_10037608 Ga0207693_100376085 94
30 3300025929 Ga0207664_11414258 Ga0207664_114142582 94
31 3300026078 Ga0207702_10631139 Ga0207702_106311392 94
32 3300026078 Ga0207702_11473593 Ga0207702_114735932 94
33 3300035170 Ga0373943_0616662 Ga0373943_0616662_299_583 94
34 3300039437 Ga0436365_1505093 Ga0436365_1505093_526_810 94
35 3300039437 Ga0436365_1637588 Ga0436365_1637588_30823_31107 94
36 3300039450 Ga0436363_1404294 Ga0436363_1404294_144_428 94
37 3300045976 Ga0466967_0871669 Ga0466967_0871669_220_504 94
38 3300045976 Ga0466967_0975239 Ga0466967_0975239_431_715 94
39 3300003215 JGI25153J46596_10000830 JGI25153J46596_1000083029 95
40 3300003308 Ga0006777J48905_1081902 Ga0006777J48905_10819021 95
41 3300003735 Ga0006780_1044058 Ga0006780_10440581 95
42 3300004803 Ga0058862_12808773 Ga0058862_128087736 95
43 3300005327 Ga0070658_10094080 Ga0070658_100940803 95
44 3300005329 Ga0070683_101664720 Ga0070683_1016647201 95
45 3300005336 Ga0070680_100020347 Ga0070680_1000203475 95
46 3300005337 Ga0070682_100792633 Ga0070682_1007926332 95
47 3300005338 Ga0068868_101901312 Ga0068868_1019013122 95
48 3300005339 Ga0070660_100001324 Ga0070660_10000132414 95
49 3300005340 Ga0070689_101375863 Ga0070689_1013758631 95
50 3300005341 Ga0070691_10000386 Ga0070691_1000038626 95
51 3300005341 Ga0070691_10000795 Ga0070691_1000079513 95
52 3300005344 Ga0070661_100005946 Ga0070661_10000594616 95
53 3300005344 Ga0070661_100584297 Ga0070661_1005842972 95
54 3300005347 Ga0070668_100050837 Ga0070668_1000508373 95
55 3300005366 Ga0070659_100410917 Ga0070659_1004109173 95
56 3300005367 Ga0070667_100853948 Ga0070667_1008539481 95
57 3300005434 Ga0070709_10003511 Ga0070709_100035115 95
58 3300005435 Ga0070714_100011419 Ga0070714_1000114197 95
59 3300005436 Ga0070713_100000012 Ga0070713_100000012118 95
60 3300005436 Ga0070713_100508190 Ga0070713_1005081902 95
61 3300005437 Ga0070710_10947475 Ga0070710_109474752 95
62 3300005440 Ga0070705_100068685 Ga0070705_1000686855 95
63 3300005445 Ga0070708_101305242 Ga0070708_1013052422 95
64 3300005458 Ga0070681_10029349 Ga0070681_100293495 95
65 3300005458 Ga0070681_10221516 Ga0070681_102215163 95
66 3300005518 Ga0070699_100225191 Ga0070699_1002251912 95
67 3300005530 Ga0070679_100057285 Ga0070679_1000572853 95
68 3300005530 Ga0070679_101580192 Ga0070679_1015801921 95
69 3300005539 Ga0068853_100002660 Ga0068853_10000266021 95
70 3300005545 Ga0070695_100003098 Ga0070695_1000030987 95
71 3300005547 Ga0070693_100051681 Ga0070693_1000516813 95
72 3300005547 Ga0070693_100054219 Ga0070693_1000542192 95
73 3300005563 Ga0068855_100012001 Ga0068855_10001200110 95
74 3300005563 Ga0068855_100057023 Ga0068855_1000570234 95
75 3300005564 Ga0070664_100858079 Ga0070664_1008580792 95
76 3300005564 Ga0070664_102154978 Ga0070664_1021549782 95
77 3300005577 Ga0068857_100007896 Ga0068857_10000789617 95
78 3300005578 Ga0068854_100837950 Ga0068854_1008379502 95
79 3300005614 Ga0068856_100001032 Ga0068856_1000010325 95
80 3300005614 Ga0068856_100034393 Ga0068856_1000343935 95
81 3300005614 Ga0068856_100158389 Ga0068856_1001583894 95
82 3300005614 Ga0068856_100221172 Ga0068856_1002211722 95
83 3300005614 Ga0068856_101043910 Ga0068856_1010439102 95
84 3300005616 Ga0068852_100006800 Ga0068852_10000680011 95
85 3300005618 Ga0068864_101027904 Ga0068864_1010279042 95
86 3300005842 Ga0068858_100274655 Ga0068858_1002746551 95
87 3300005842 Ga0068858_100342360 Ga0068858_1003423602 95
88 3300005844 Ga0068862_101884812 Ga0068862_1018848122 95
89 3300006048 Ga0075363_100224636 Ga0075363_1002246363 95
90 3300006051 Ga0075364_10475916 Ga0075364_104759162 95
91 3300006051 Ga0075364_11177196 Ga0075364_111771962 95
92 3300006173 Ga0070716_100046578 Ga0070716_1000465782 95
93 3300006173 Ga0070716_100738028 Ga0070716_1007380282 95
94 3300006175 Ga0070712_100000902 Ga0070712_1000009024 95
95 3300006178 Ga0075367_10068874 Ga0075367_100688742 95
96 3300006186 Ga0075369_10091481 Ga0075369_100914813 95
97 3300006195 Ga0075366_10096605 Ga0075366_100966053 95
98 3300006353 Ga0075370_10094675 Ga0075370_100946752 95
99 3300006353 Ga0075370_10900220 Ga0075370_109002202 95
100 3300006358 Ga0068871_100289882 Ga0068871_1002898822 95
101 3300006358 Ga0068871_102215043 Ga0068871_1022150432 95
102 3300006871 Ga0075434_100129075 Ga0075434_1001290755 95
103 3300006871 Ga0075434_100153113 Ga0075434_1001531132 95
104 3300006914 Ga0075436_100002564 Ga0075436_10000256419 95
105 3300006914 Ga0075436_100019157 Ga0075436_1000191574 95
106 3300007076 Ga0075435_100177695 Ga0075435_1001776952 95
107 3300009093 Ga0105240_10017473 Ga0105240_100174735 95
108 3300009093 Ga0105240_10389360 Ga0105240_103893602 95
109 3300009093 Ga0105240_10555162 Ga0105240_105551622 95
110 3300009093 Ga0105240_11557115 Ga0105240_115571152 95
111 3300009093 Ga0105240_11758260 Ga0105240_117582602 95
112 3300009098 Ga0105245_10745293 Ga0105245_107452931 95
113 3300009098 Ga0105245_11444059 Ga0105245_114440592 95
114 3300009174 Ga0105241_10120327 Ga0105241_101203272 95
115 3300009174 Ga0105241_10159833 Ga0105241_101598334 95
116 3300009174 Ga0105241_10176283 Ga0105241_101762832 95
117 3300009174 Ga0105241_10347551 Ga0105241_103475512 95
118 3300009174 Ga0105241_11634568 Ga0105241_116345682 95
119 3300009177 Ga0105248_11225997 Ga0105248_112259972 95
120 3300009545 Ga0105237_10032303 Ga0105237_100323035 95
121 3300009551 Ga0105238_10001939 Ga0105238_100019395 95
122 3300009551 Ga0105238_10035831 Ga0105238_100358315 95
123 3300010375 Ga0105239_10060445 Ga0105239_100604459 95
124 3300010375 Ga0105239_13315078 Ga0105239_133150782 95
125 3300010375 Ga0105239_13602993 Ga0105239_136029932 95
126 3300013100 Ga0157373_10000820 Ga0157373_1000082034 95
127 3300013100 Ga0157373_10049430 Ga0157373_100494305 95
128 3300013102 Ga0157371_10199235 Ga0157371_101992352 95
129 3300013102 Ga0157371_11314288 Ga0157371_113142882 95
130 3300013104 Ga0157370_10003448 Ga0157370_1000344828 95
131 3300013104 Ga0157370_10040902 Ga0157370_100409023 95
132 3300013105 Ga0157369_10001535 Ga0157369_100015355 95
133 3300013296 Ga0157374_10294923 Ga0157374_102949233 95
134 3300013297 Ga0157378_10804115 Ga0157378_108041152 95
135 3300013306 Ga0163162_10363163 Ga0163162_103631633 95
136 3300013306 Ga0163162_12602856 Ga0163162_126028562 95
137 3300013307 Ga0157372_10059581 Ga0157372_100595815 95
138 3300013307 Ga0157372_10213448 Ga0157372_102134482 95
139 3300013307 Ga0157372_11864112 Ga0157372_118641122 95
140 3300013308 Ga0157375_13248534 Ga0157375_132485342 95
141 3300014325 Ga0163163_10056493 Ga0163163_100564932 95
142 3300014325 Ga0163163_11244725 Ga0163163_112447252 95
143 3300014325 Ga0163163_11342325 Ga0163163_113423252 95
144 3300014325 Ga0163163_11940963 Ga0163163_119409632 95
145 3300014968 Ga0157379_10018171 Ga0157379_100181715 95
146 3300014968 Ga0157379_10038101 Ga0157379_100381015 95
147 3300014968 Ga0157379_10071200 Ga0157379_100712005 95
148 3300017792 Ga0163161_11402451 Ga0163161_114024511 95
149 3300021384 Ga0213876_10457751 Ga0213876_104577512 95
150 3300021388 Ga0213875_10014923 Ga0213875_100149231 95
151 3300021388 Ga0213875_10028865 Ga0213875_100288655 95
152 3300021388 Ga0213875_10184431 Ga0213875_101844311 95
153 3300021441 Ga0213871_10151872 Ga0213871_101518722 95
154 3300025250 Ga0209026_1018320 Ga0209026_10183202 95
155 3300025292 Ga0209676_1050469 Ga0209676_10504692 95
156 3300025297 Ga0209758_1000013 Ga0209758_1000013908 95
157 3300025906 Ga0207699_10000164 Ga0207699_1000016435 95
158 3300025906 Ga0207699_11374856 Ga0207699_113748561 95
159 3300025909 Ga0207705_10000180 Ga0207705_1000018069 95
160 3300025911 Ga0207654_10084942 Ga0207654_100849423 95
161 3300025911 Ga0207654_10102125 Ga0207654_101021252 95
162 3300025911 Ga0207654_10541599 Ga0207654_105415992 95
163 3300025912 Ga0207707_10002211 Ga0207707_1000221111 95
164 3300025912 Ga0207707_10429662 Ga0207707_104296622 95
165 3300025913 Ga0207695_10029506 Ga0207695_100295068 95
166 3300025913 Ga0207695_10396750 Ga0207695_103967502 95
167 3300025913 Ga0207695_10445276 Ga0207695_104452761 95
168 3300025913 Ga0207695_10544668 Ga0207695_105446682 95
169 3300025914 Ga0207671_10016535 Ga0207671_100165355 95
170 3300025915 Ga0207693_10001929 Ga0207693_1000192928 95
171 3300025916 Ga0207663_10191451 Ga0207663_101914512 95
172 3300025917 Ga0207660_10000110 Ga0207660_1000011013 95
173 3300025917 Ga0207660_10485992 Ga0207660_104859922 95
174 3300025919 Ga0207657_10000241 Ga0207657_1000024116 95
175 3300025920 Ga0207649_10000194 Ga0207649_1000019467 95
176 3300025921 Ga0207652_10001654 Ga0207652_1000165413 95
177 3300025924 Ga0207694_10008694 Ga0207694_1000869414 95
178 3300025924 Ga0207694_10031812 Ga0207694_100318123 95
179 3300025924 Ga0207694_10895675 Ga0207694_108956751 95
180 3300025927 Ga0207687_10303333 Ga0207687_103033332 95
181 3300025927 Ga0207687_11129468 Ga0207687_111294682 95
182 3300025928 Ga0207700_10000295 Ga0207700_100002955 95
183 3300025929 Ga0207664_10028891 Ga0207664_100288914 95
184 3300025932 Ga0207690_10292625 Ga0207690_102926252 95
185 3300025932 Ga0207690_11131133 Ga0207690_111311331 95
186 3300025936 Ga0207670_10892977 Ga0207670_108929772 95
187 3300025937 Ga0207669_10539265 Ga0207669_105392652 95
188 3300025939 Ga0207665_10070338 Ga0207665_100703382 95
189 3300025944 Ga0207661_10117898 Ga0207661_101178985 95
190 3300025944 Ga0207661_10890155 Ga0207661_108901552 95
191 3300025944 Ga0207661_11870905 Ga0207661_118709052 95
192 3300025945 Ga0207679_10812828 Ga0207679_108128282 95
193 3300025949 Ga0207667_10006198 Ga0207667_100061988 95
194 3300025949 Ga0207667_10013025 Ga0207667_1001302512 95
195 3300025949 Ga0207667_10024994 Ga0207667_100249946 95
196 3300025972 Ga0207668_11557841 Ga0207668_115578412 95
197 3300025986 Ga0207658_10149838 Ga0207658_101498383 95
198 3300026035 Ga0207703_10044546 Ga0207703_100445464 95
199 3300026035 Ga0207703_10224569 Ga0207703_102245693 95
200 3300026041 Ga0207639_10010763 Ga0207639_100107638 95
201 3300026078 Ga0207702_10000315 Ga0207702_1000031546 95
202 3300026078 Ga0207702_10009824 Ga0207702_100098245 95
203 3300026078 Ga0207702_10579822 Ga0207702_105798222 95
204 3300026078 Ga0207702_10839870 Ga0207702_108398702 95
205 3300026078 Ga0207702_11634739 Ga0207702_116347392 95
206 3300026095 Ga0207676_10661181 Ga0207676_106611812 95
207 3300026116 Ga0207674_10001605 Ga0207674_1000160536 95
208 3300026116 Ga0207674_10200318 Ga0207674_102003183 95
209 3300026142 Ga0207698_10036626 Ga0207698_100366262 95
210 3300026142 Ga0207698_12079595 Ga0207698_120795952 95
211 3300028380 Ga0268265_10313520 Ga0268265_103135202 95
212 3300028380 Ga0268265_11562257 Ga0268265_115622572 95
213 3300028381 Ga0268264_12546933 Ga0268264_125469332 95
214 3300028556 Ga0265337_1083801 Ga0265337_10838012 95
215 3300028666 Ga0265336_10166374 Ga0265336_101663742 95
216 3300028800 Ga0265338_10309665 Ga0265338_103096652 95
217 3300030745 Ga0316182_1227941 Ga0316182_12279412 95
218 3300031238 Ga0265332_10203971 Ga0265332_102039712 95
219 3300031238 Ga0265332_10212412 Ga0265332_102124122 95
220 3300031241 Ga0265325_10000820 Ga0265325_1000082011 95
221 3300031241 Ga0265325_10012680 Ga0265325_100126806 95
222 3300031247 Ga0265340_10138662 Ga0265340_101386622 95
223 3300031249 Ga0265339_10005687 Ga0265339_100056878 95
224 3300031250 Ga0265331_10119323 Ga0265331_101193232 95
225 3300031251 Ga0265327_10005226 Ga0265327_100052261 95
226 3300031344 Ga0265316_10061302 Ga0265316_100613022 95
227 3300031548 Ga0307408_100927653 Ga0307408_1009276532 95
228 3300031595 Ga0265313_10001315 Ga0265313_100013153 95
229 3300031595 Ga0265313_10047949 Ga0265313_100479494 95
230 3300031711 Ga0265314_10004460 Ga0265314_100044606 95
231 3300031711 Ga0265314_10098246 Ga0265314_100982462 95
232 3300031711 Ga0265314_10137507 Ga0265314_101375072 95
233 3300031711 Ga0265314_10225166 Ga0265314_102251662 95
234 3300031711 Ga0265314_10227005 Ga0265314_102270052 95
235 3300031712 Ga0265342_10257424 Ga0265342_102574242 95
236 3300031731 Ga0307405_10452206 Ga0307405_104522062 95
237 3300031824 Ga0307413_10002271 Ga0307413_100022715 95
238 3300031824 Ga0307413_11838117 Ga0307413_118381171 95
239 3300031852 Ga0307410_10813726 Ga0307410_108137262 95
240 3300031901 Ga0307406_10119121 Ga0307406_101191212 95
241 3300031903 Ga0307407_10114232 Ga0307407_101142322 95
242 3300031903 Ga0307407_10835703 Ga0307407_108357032 95
243 3300031911 Ga0307412_10338458 Ga0307412_103384582 95
244 3300031911 Ga0307412_10595494 Ga0307412_105954942 95
245 3300031911 Ga0307412_11261291 Ga0307412_112612911 95
246 3300031911 Ga0307412_11743685 Ga0307412_117436852 95
247 3300031995 Ga0307409_101230991 Ga0307409_1012309912 95
248 3300032004 Ga0307414_10358294 Ga0307414_103582943 95
249 3300032004 Ga0307414_10445229 Ga0307414_104452292 95
250 3300032004 Ga0307414_10667161 Ga0307414_106671612 95
251 3300032005 Ga0307411_10427678 Ga0307411_104276781 95
252 3300032005 Ga0307411_10753026 Ga0307411_107530262 95
253 3300032005 Ga0307411_10911607 Ga0307411_109116072 95
254 3300032126 Ga0307415_100071944 Ga0307415_1000719442 95
255 3300032126 Ga0307415_100943921 Ga0307415_1009439212 95
256 3300032168 Ga0316593_10005586 Ga0316593_100055863 95
257 3300032168 Ga0316593_10050501 Ga0316593_100505012 95
258 3300035111 Ga0373923_0596853 Ga0373923_0596853_21_308 95
259 3300035112 Ga0373932_0041782 Ga0373932_0041782_516_803 95
260 3300035112 Ga0373932_0167090 Ga0373932_0167090_183_470 95
261 3300035120 Ga0373957_0407957 Ga0373957_0407957_264_551 95
262 3300035170 Ga0373943_0129614 Ga0373943_0129614_460_747 95
263 3300035172 Ga0373955_0017677 Ga0373955_0017677_1431_1718 95
264 3300035691 Ga0373931_0788435 Ga0373931_0788435_106_393 95
265 3300035692 Ga0373935_0235103 Ga0373935_0235103_291_578 95
266 3300035724 Ga0373933_0246665 Ga0373933_0246665_232_519 95
267 3300035724 Ga0373933_0746233 Ga0373933_0746233_294_587 95
268 3300036401 Ga0373937_0058492 Ga0373937_0058492_2541_2828 95
269 3300036401 Ga0373937_0542341 Ga0373937_0542341_446_739 95
270 3300036401 Ga0373937_1599824 Ga0373937_1599824_72_359 95
271 3300036401 Ga0373937_1818248 Ga0373937_1818248_171_467 95
272 3300036647 Ga0316582_1125678 Ga0316582_1125678_184_516 95
273 3300037068 Ga0373925_0127468 Ga0373925_0127468_881_1168 95
274 3300037853 Ga0436364_0000682 Ga0436364_0000682_814_1161 95
275 3300037853 Ga0436364_0554982 Ga0436364_0554982_5494_5832 95
276 3300037853 Ga0436364_0586291 Ga0436364_0586291_1997_2344 95
277 3300039437 Ga0436365_0340931 Ga0436365_0340931_191_532 95
278 3300039437 Ga0436365_0630930 Ga0436365_0630930_91_432 95
279 3300039437 Ga0436365_1652185 Ga0436365_1652185_285_623 95
280 3300039438 Ga0436360_0764332 Ga0436360_0764332_926_1258 95
281 3300039438 Ga0436360_0920335 Ga0436360_0920335_560_892 95
282 3300039438 Ga0436360_1031228 Ga0436360_1031228_142_462 95
283 3300039438 Ga0436360_1157227 Ga0436360_1157227_623_952 95
284 3300039453 Ga0436362_0587556 Ga0436362_0587556_616_936 95
285 3300041406 Ga0439439_0223197 Ga0439439_0223197_15_308 95
286 3300041410 Ga0439461_0052874 Ga0439461_0052874_156_449 95
287 3300041411 Ga0439466_0139938 Ga0439466_0139938_135_428 95
288 3300041413 Ga0439465_0246044 Ga0439465_0246044_135_428 95
289 3300041443 Ga0451789_1040143 Ga0451789_1040143_36_329 95
290 3300041445 Ga0451792_23173 Ga0451792_23173_63_356 95
291 3300041446 Ga0451794_03409 Ga0451794_03409_86_379 95
292 3300041451 Ga0451791_0063844 Ga0451791_0063844_35_328 95
293 3300041451 Ga0451791_0268437 Ga0451791_0268437_482_775 95
294 3300041455 Ga0451801_43680 Ga0451801_43680_109_402 95
295 3300041456 Ga0451795_0203980 Ga0451795_0203980_310_609 95
296 3300041460 Ga0451802_0642518 Ga0451802_0642518_222_515 95
297 3300041461 Ga0451805_125400 Ga0451805_125400_118_411 95
298 3300041491 Ga0451833_0331039 Ga0451833_0331039_60_353 95
299 3300041501 Ga0451845_0239639 Ga0451845_0239639_92_385 95
300 3300042001 Ga0439441_043699 Ga0439441_043699_148_441 95
301 3300042004 Ga0439445_0141063 Ga0439445_0141063_151_444 95
302 3300042005 Ga0439448_0271099 Ga0439448_0271099_278_568 95
303 3300042007 Ga0439449_0097806 Ga0439449_0097806_307_600 95
304 3300042015 Ga0439462_0147411 Ga0439462_0147411_166_459 95
305 3300042156 Ga0439446_0246033 Ga0439446_0246033_256_549 95
306 3300042876 Ga0451577_0371323 Ga0451577_0371323_836_1135 95
307 3300044712 Ga0453684_2211924 Ga0453684_2211924_124_423 95
308 3300046472 Ga0495580_0036721 Ga0495580_0036721_3007_3294 95
309 3300046512 Ga0495610_0040653 Ga0495610_0040653_1640_1966 95
310 3300046517 Ga0495630_0132271 Ga0495630_0132271_1030_1317 95
311 3300046522 Ga0495643_0450010 Ga0495643_0450010_62_388 95
312 3300046616 Ga0495668_0493590 Ga0495668_0493590_32_358 95
313 3300046648 Ga0495611_0417542 Ga0495611_0417542_162_488 95
314 3300046660 Ga0495625_0572496 Ga0495625_0572496_354_653 95
315 3300046675 Ga0495657_0141296 Ga0495657_0141296_1132_1419 95
316 3300046679 Ga0495623_0050531 Ga0495623_0050531_2269_2556 95
317 3300046684 Ga0495669_0000044 Ga0495669_0000044_82293_82592 95
318 3300046684 Ga0495669_0000371 Ga0495669_0000371_6158_6457 95
319 3300046694 Ga0495649_0627517 Ga0495649_0627517_141_467 95
320 3300047445 Ga0495677_0023144 Ga0495677_0023144_1011_1310 95
321 3300048905 Ga0496102_0664674 Ga0496102_0664674_142_441 95
322 3300048909 Ga0496106_0379828 Ga0496106_0379828_688_975 95
323 3300048909 Ga0496106_1297000 Ga0496106_1297000_189_476 95
324 3300048913 Ga0496110_0357780 Ga0496110_0357780_836_1129 95
325 3300048913 Ga0496110_0974744 Ga0496110_0974744_288_575 95
326 3300048927 Ga0496124_0256921 Ga0496124_0256921_76_369 95
327 3300048928 Ga0496125_0000815 Ga0496125_0000815_36719_37012 95
328 3300048928 Ga0496125_0023733 Ga0496125_0023733_1634_1933 95
329 3300048929 Ga0496126_0000480 Ga0496126_0000480_15454_15741 95
330 3300048929 Ga0496126_0133942 Ga0496126_0133942_942_1235 95
331 3300048929 Ga0496126_0482697 Ga0496126_0482697_331_624 95
332 3300049127 Ga0501306_005105 Ga0501306_005105_871_1170 95
333 3300049127 Ga0501306_009483 Ga0501306_009483_466_759 95
334 3300049127 Ga0501306_026822 Ga0501306_026822_378_671 95
335 3300049128 Ga0501308_040044 Ga0501308_040044_320_613 95
336 3300049130 Ga0501310_003705 Ga0501310_003705_852_1145 95
337 3300049131 Ga0501341_02105 Ga0501341_02105_359_652 95
338 3300049131 Ga0501341_02423 Ga0501341_02423_16_315 95
339 3300049161 Ga0501305_054820 Ga0501305_054820_333_626 95
340 3300049162 Ga0501307_022378 Ga0501307_022378_92_385 95
341 3300049162 Ga0501307_022590 Ga0501307_022590_444_737 95
342 3300049529 Ga0501313_014478 Ga0501313_014478_328_621 95
343 3300049530 Ga0501314_004138 Ga0501314_004138_860_1153 95
344 3300049531 Ga0501315_074828 Ga0501315_074828_77_376 95
345 3300049532 Ga0501316_017029 Ga0501316_017029_469_762 95
346 3300049532 Ga0501316_039006 Ga0501316_039006_38_331 95
347 3300049533 Ga0501317_054332 Ga0501317_054332_35_328 95
348 3300049535 Ga0501319_003698 Ga0501319_003698_317_616 95
349 3300049535 Ga0501319_024439 Ga0501319_024439_104_397 95
350 3300049536 Ga0501320_016366 Ga0501320_016366_400_693 95
351 3300049536 Ga0501320_031740 Ga0501320_031740_288_587 95
352 3300049536 Ga0501320_034114 Ga0501320_034114_310_603 95
353 3300049537 Ga0501321_008994 Ga0501321_008994_323_622 95
354 3300049537 Ga0501321_010431 Ga0501321_010431_293_616 95
355 3300049537 Ga0501321_028338 Ga0501321_028338_43_336 95
356 3300049538 Ga0501322_013594 Ga0501322_013594_353_646 95
357 3300049539 Ga0501323_008914 Ga0501323_008914_455_754 95
358 3300049539 Ga0501323_039722 Ga0501323_039722_315_608 95
359 3300049540 Ga0501324_016590 Ga0501324_016590_332_631 95
360 3300049540 Ga0501324_023410 Ga0501324_023410_45_338 95
361 3300049541 Ga0501325_003636 Ga0501325_003636_684_983 95
362 3300049544 Ga0501328_07265 Ga0501328_07265_31_324 95
363 3300049545 Ga0501329_07883 Ga0501329_07883_30_323 95
364 3300049548 Ga0501332_11664 Ga0501332_11664_270_563 95
365 3300049554 Ga0501338_19576 Ga0501338_19576_37_330 95
366 3300049568 Ga0501031_0071408 Ga0501031_0071408_609_914 95
367 3300049568 Ga0501031_0090980 Ga0501031_0090980_1453_1740 95
368 3300049568 Ga0501031_0333523 Ga0501031_0333523_430_723 95
369 3300049568 Ga0501031_0742197 Ga0501031_0742197_104_391 95
370 3300049569 Ga0501032_0288405 Ga0501032_0288405_399_686 95
371 3300049569 Ga0501032_0294266 Ga0501032_0294266_658_945 95
372 3300049569 Ga0501032_0625334 Ga0501032_0625334_174_473 95
373 3300049569 Ga0501032_0655441 Ga0501032_0655441_92_379 95
374 3300049570 Ga0501033_0109003 Ga0501033_0109003_1475_1774 95
375 3300049570 Ga0501033_0148779 Ga0501033_0148779_179_484 95
376 3300049570 Ga0501033_0659132 Ga0501033_0659132_186_473 95
377 3300049571 Ga0501034_0066576 Ga0501034_0066576_3024_3329 95
378 3300049571 Ga0501034_0213220 Ga0501034_0213220_1364_1657 95
379 3300049571 Ga0501034_0247011 Ga0501034_0247011_1410_1703 95
380 3300049571 Ga0501034_0392517 Ga0501034_0392517_123_416 95
381 3300049571 Ga0501034_0700656 Ga0501034_0700656_14_301 95
382 3300049571 Ga0501034_0820627 Ga0501034_0820627_92_391 95
383 3300049572 Ga0501036_0109734 Ga0501036_0109734_287_592 95
384 3300049572 Ga0501036_0511071 Ga0501036_0511071_214_501 95
385 3300049572 Ga0501036_0584288 Ga0501036_0584288_585_872 95
386 3300049573 Ga0501037_0015651 Ga0501037_0015651_2497_2802 95
387 3300049573 Ga0501037_0050986 Ga0501037_0050986_952_1239 95
388 3300049573 Ga0501037_0321929 Ga0501037_0321929_109_396 95
389 3300049573 Ga0501037_0640198 Ga0501037_0640198_281_568 95
390 3300049573 Ga0501037_0828493 Ga0501037_0828493_231_524 95
391 3300049574 Ga0501038_0044247 Ga0501038_0044247_1964_2269 95
392 3300049574 Ga0501038_0177720 Ga0501038_0177720_1054_1341 95
393 3300049574 Ga0501038_0219570 Ga0501038_0219570_241_528 95
394 3300049579 Ga0501043_0169190 Ga0501043_0169190_497_802 95
395 3300049579 Ga0501043_0577040 Ga0501043_0577040_61_348 95
396 3300049579 Ga0501043_0594310 Ga0501043_0594310_221_508 95
397 3300049579 Ga0501043_1026065 Ga0501043_1026065_70_357 95
398 3300049580 Ga0501046_0012992 Ga0501046_0012992_216_503 95
399 3300049580 Ga0501046_0101892 Ga0501046_0101892_474_761 95
400 3300049580 Ga0501046_0121566 Ga0501046_0121566_784_1089 95
401 3300049580 Ga0501046_0122100 Ga0501046_0122100_902_1189 95
402 3300049580 Ga0501046_0400169 Ga0501046_0400169_552_848 95
403 3300049580 Ga0501046_1207684 Ga0501046_1207684_181_468 95
404 3300049581 Ga0501047_0019729 Ga0501047_0019729_1590_1895 95
405 3300049581 Ga0501047_0025781 Ga0501047_0025781_1703_1990 95
406 3300049581 Ga0501047_0027205 Ga0501047_0027205_1066_1353 95
407 3300049581 Ga0501047_0095267 Ga0501047_0095267_771_1058 95
408 3300049581 Ga0501047_0111494 Ga0501047_0111494_1728_2015 95
409 3300049581 Ga0501047_0389956 Ga0501047_0389956_526_816 95
410 3300049581 Ga0501047_0985431 Ga0501047_0985431_155_442 95
411 3300049582 Ga0501048_0102315 Ga0501048_0102315_1298_1585 95
412 3300049582 Ga0501048_0211995 Ga0501048_0211995_403_690 95
413 3300049582 Ga0501048_1325511 Ga0501048_1325511_127_426 95
414 3300049583 Ga0501067_0005350 Ga0501067_0005350_1808_2095 95
415 3300049583 Ga0501067_0033573 Ga0501067_0033573_1778_2065 95
416 3300049584 Ga0501068_0423151 Ga0501068_0423151_300_605 95
417 3300049585 Ga0501069_0005996 Ga0501069_0005996_4392_4679 95
418 3300049585 Ga0501069_0208376 Ga0501069_0208376_113_400 95
419 3300049586 Ga0501070_0001611 Ga0501070_0001611_1688_1975 95
420 3300049586 Ga0501070_0003398 Ga0501070_0003398_2435_2722 95
421 3300049586 Ga0501070_0624901 Ga0501070_0624901_257_562 95
422 3300049586 Ga0501070_0663235 Ga0501070_0663235_450_737 95
423 3300049588 Ga0501072_0013154 Ga0501072_0013154_4325_4612 95
424 3300049589 Ga0501073_0004494 Ga0501073_0004494_8402_8689 95
425 3300049589 Ga0501073_0017294 Ga0501073_0017294_3656_3961 95
426 3300049589 Ga0501073_0048979 Ga0501073_0048979_858_1145 95
427 3300049589 Ga0501073_0414933 Ga0501073_0414933_31_318 95
428 3300049590 Ga0501074_0010906 Ga0501074_0010906_3874_4161 95
429 3300049705 Ga0501225_0304278 Ga0501225_0304278_166_459 95
430 3300049741 Ga0501079_0018448 Ga0501079_0018448_2203_2490 95
431 3300049742 Ga0501080_0006960 Ga0501080_0006960_5747_6034 95
432 3300049742 Ga0501080_0028291 Ga0501080_0028291_3167_3454 95
433 3300049742 Ga0501080_0142334 Ga0501080_0142334_394_699 95
434 3300049742 Ga0501080_0253758 Ga0501080_0253758_974_1261 95
435 3300049742 Ga0501080_0708509 Ga0501080_0708509_150_437 95
436 3300049742 Ga0501080_1100428 Ga0501080_1100428_248_535 95
437 3300049744 Ga0501083_0366031 Ga0501083_0366031_393_680 95
438 3300049744 Ga0501083_0446865 Ga0501083_0446865_460_747 95
439 3300049822 Ga0501035_0013364 Ga0501035_0013364_2978_3265 95
440 3300049822 Ga0501035_0024934 Ga0501035_0024934_3279_3566 95
441 3300049822 Ga0501035_0134735 Ga0501035_0134735_860_1147 95
442 3300049822 Ga0501035_0178365 Ga0501035_0178365_655_942 95
443 3300049822 Ga0501035_0520272 Ga0501035_0520272_612_899 95
444 3300049822 Ga0501035_0683218 Ga0501035_0683218_196_495 95
445 3300049823 Ga0501044_0028702 Ga0501044_0028702_3766_4053 95
446 3300049823 Ga0501044_0087802 Ga0501044_0087802_1739_2026 95
447 3300049823 Ga0501044_0236197 Ga0501044_0236197_650_955 95
448 3300049823 Ga0501044_0545236 Ga0501044_0545236_493_780 95
449 3300049823 Ga0501044_0583131 Ga0501044_0583131_114_401 95
450 3300049823 Ga0501044_0697989 Ga0501044_0697989_415_702 95
451 3300049823 Ga0501044_0765300 Ga0501044_0765300_179_478 95
452 3300049823 Ga0501044_0773014 Ga0501044_0773014_23_322 95
453 3300049823 Ga0501044_1122855 Ga0501044_1122855_299_592 95
454 3300050490 nmdc:mga03n38_489073_c1 nmdc:mga03n38_489073_c1_114_407 95
455 3300050491 nmdc:mga00v17_207481_c1 nmdc:mga00v17_207481_c1_857_1150 95
456 3300050493 nmdc:mga0k408_262086_c1 nmdc:mga0k408_262086_c1_556_849 95
457 3300050494 nmdc:mga06z11_195671_c1 nmdc:mga06z11_195671_c1_188_481 95
458 3300050496 nmdc:mga07m45_86553_c1 nmdc:mga07m45_86553_c1_1057_1350 95
459 3300050512 nmdc:mga0n895_129615_c1 nmdc:mga0n895_129615_c1_414_701 95
460 3300050512 nmdc:mga0n895_158795_c1 nmdc:mga0n895_158795_c1_259_546 95
461 3300050513 nmdc:mga0rr50_163926_c1 nmdc:mga0rr50_163926_c1_872_1159 95
462 3300050514 nmdc:mga08x19_14934_c1 nmdc:mga08x19_14934_c1_2947_3234 95
463 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_20660_20947 95
464 3300053078 Ga0495612_0403865 Ga0495612_0403865_162_449 95
465 3300053087 Ga0500643_000003 Ga0500643_000003_23410_23697 95
466 3300053090 Ga0500646_0150602 Ga0500646_0150602_472_759 95
467 3300053103 Ga0500555_061498 Ga0500555_061498_553_840 95
468 3300053108 Ga0500562_111055 Ga0500562_111055_133_426 95
469 3300053119 Ga0500595_033265 Ga0500595_033265_727_1014 95
470 3300053120 Ga0500597_374807 Ga0500597_374807_26_313 95
471 3300053122 Ga0500608_168807 Ga0500608_168807_310_609 95
472 3300053130 Ga0500642_0441554 Ga0500642_0441554_201_500 95
473 3300053133 Ga0500655_049063 Ga0500655_049063_280_567 95
474 3300053139 Ga0500568_0069253 Ga0500568_0069253_372_665 95
475 3300053140 Ga0500573_0280594 Ga0500573_0280594_209_502 95
476 3300053151 Ga0500604_0000294 Ga0500604_0000294_762_1055 95
477 3300053153 Ga0500616_0044593 Ga0500616_0044593_1942_2238 95
478 3300053157 Ga0500624_019940 Ga0500624_019940_206_499 95
479 3300053161 Ga0500634_0000031 Ga0500634_0000031_4671_4964 95
480 3300053727 Ga0500611_115817 Ga0500611_115817_130_417 95
481 3300054114 Ga0501084_0030163 Ga0501084_0030163_2744_3031 95
482 3300054114 Ga0501084_0044330 Ga0501084_0044330_1707_1994 95
483 3300054114 Ga0501084_0127908 Ga0501084_0127908_1027_1332 95
484 3300059477 Ga0587084_063256 Ga0587084_063256_46_339 95
485 3300059491 Ga0587070_094488 Ga0587070_094488_35_334 95
486 3300059493 Ga0587077_095959 Ga0587077_095959_125_418 95
487 3300059505 Ga0587083_0101128 Ga0587083_0101128_74_373 95
488 3300059624 Ga0587109_074821 Ga0587109_074821_284_601 95
489 3300059639 Ga0587062_051278 Ga0587062_051278_366_665 95
490 3300059641 Ga0587068_004290 Ga0587068_004290_1314_1607 95
491 3300059641 Ga0587068_125347 Ga0587068_125347_31_330 95
492 3300059643 Ga0587072_001135 Ga0587072_001135_2736_3029 95
493 3300059647 Ga0587079_049145 Ga0587079_049145_276_563 95
494 3300059652 Ga0587107_017865 Ga0587107_017865_125_418 95
495 3300060353 Ga0501082_0194897 Ga0501082_0194897_190_495 95
496 3300061734 Ga0530510_0792685 Ga0530510_0792685_337_630 95
497 iso_pu_bacteria 2524023250 2524609935 95
498 iso_pu_bacteria 2643221598 2643997885 95
499 iso_pu_bacteria 2643221614 2644088879 95
500 iso_pu_bacteria 2643221661 2644342241 95
501 iso_pu_bacteria 2643221666 2644369624 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

25

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9716 4 88
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9713 4 85
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9705 4 90
6ddg-assembly1.cif.gz_F structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.963 6 89
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.962 4 91
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9653 4 90 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.939 4 88 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9236 4 90 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9222 4 88 3.30.70.330
af_E9AG68_26_145_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9182 4 88 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1E5Q547-F1-model_v4 Large ribosomal subunit protein uL23 0.9931 4 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X7X7C2-F1-model_v4 Large ribosomal subunit protein uL23 0.9922 6 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0S7X6A9-F1-model_v4 Large ribosomal subunit protein uL23 0.9909 4 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419EVM5-F1-model_v4 Large ribosomal subunit protein uL23 0.9906 4 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3S0FW11-F1-model_v4 Large ribosomal subunit protein uL23 0.9901 4 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.95 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map