F455135

General Info

Members Datasets Scaffolds Average Seq Length
498 267 996 252

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10138770|Ga0065707_101387703
Length 284
Sequence VSAYERFQTRQSDVAFGLPLREPLFRAEADTSFKDHFSRQAAGYAKFRPRYPQKLFDYLGSIAPSRQLAWDCGTGNGQAAVGLASVFDRVIATDASEHQIANAQSHKIVEYRVVPAENSGIGSETVDLIMVAQALHWFDLDRFYAEARRVLKSDGVLAASAYNLLHIEPAIDEVVNRYYYEVVGPFWPPERKLVEQFADLPFPFHKVDAPKFEMTAQWNLDHLLGYLQTWSSTQRFLAAKGSDPLEQIMDELRSAWRNAKQTRHVLWPLTLRVGIKASGESPKE

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
184 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
185 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
267 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 7.23
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 22.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10138770 3300005295 Unclassified 1802
2 rootH2_10238300 3300003320 Bacteria 3208
3 rootH2_10314158 3300003320 Unclassified 2005
4 rootL2_10060197 3300003322 Bacteria 9463
5 Ga0065704_10011190 3300005289 Bacteria 2146
6 Ga0065704_10032676 3300005289 Bacteria 1447
7 Ga0065712_10129026 3300005290 Bacteria 1572
8 Ga0065712_10142441 3300005290 Unclassified 1438
9 Ga0065712_10168919 3300005290 Unclassified 1250
10 Ga0065712_10234157 3300005290 Unclassified 1001
11 Ga0065715_10159184 3300005293 Unclassified 1646
12 Ga0065715_10203628 3300005293 Unclassified 1348
13 Ga0065707_10028833 3300005295 Bacteria 1591
14 Ga0065707_10125596 3300005295 Unclassified 2020
15 Ga0070676_10138565 3300005328 Unclassified 1546
16 Ga0070683_100514929 3300005329 Bacteria 1143
17 Ga0070690_100105940 3300005330 Bacteria 1870
18 Ga0070670_100277030 3300005331 Bacteria 1464
19 Ga0068869_100166570 3300005334 Bacteria 1719
20 Ga0070666_10052133 3300005335 Bacteria 2757
21 Ga0070666_10088769 3300005335 Bacteria 2121
22 Ga0070666_10118747 3300005335 Bacteria 1833
23 Ga0070680_100124158 3300005336 Bacteria 2156
24 Ga0070682_100000012 3300005337 Bacteria 265658
25 Ga0070682_100425899 3300005337 Unclassified 1010
26 Ga0070687_100044381 3300005343 Bacteria 2264
27 Ga0070661_100118933 3300005344 Bacteria 1977
28 Ga0070661_100202400 3300005344 Unclassified 1517
29 Ga0070661_100299648 3300005344 Bacteria 1251
30 Ga0070692_10012418 3300005345 Bacteria 3942
31 Ga0070692_10136579 3300005345 Bacteria 1383
32 Ga0070668_100118609 3300005347 Unclassified 2112
33 Ga0070668_100228708 3300005347 Bacteria 1536
34 Ga0070669_100065601 3300005353 Bacteria 2675
35 Ga0070669_100214999 3300005353 Bacteria 1518
36 Ga0070669_100362743 3300005353 Bacteria 1178
37 Ga0070675_100004348 3300005354 Bacteria 10805
38 Ga0070675_100050257 3300005354 Bacteria 3423
39 Ga0070675_100068596 3300005354 Bacteria 2937
40 Ga0070675_100111042 3300005354 Unclassified 2320
41 Ga0070671_100032775 3300005355 Unclassified 4293
42 Ga0070671_100063114 3300005355 Bacteria 3084
43 Ga0070671_100342600 3300005355 Bacteria 1275
44 Ga0070671_100352965 3300005355 Unclassified 1255
45 Ga0070671_100398316 3300005355 Bacteria 1177
46 Ga0070671_100555168 3300005355 Unclassified 991
47 Ga0070673_100114242 3300005364 Unclassified 2243
48 Ga0070673_100118201 3300005364 Unclassified 2207
49 Ga0070673_100177513 3300005364 Bacteria 1821
50 Ga0070688_100001889 3300005365 Bacteria 10508
51 Ga0070659_100085086 3300005366 Bacteria 2529
52 Ga0070659_100616627 3300005366 Bacteria 933
53 Ga0070667_100038244 3300005367 Bacteria 4023
54 Ga0070709_10009434 3300005434 Bacteria 5385
55 Ga0070709_10027850 3300005434 Bacteria 3364
56 Ga0070714_100023616 3300005435 Bacteria 5054
57 Ga0070714_100033074 3300005435 Bacteria 4321
58 Ga0070714_100387643 3300005435 Bacteria 1318
59 Ga0070713_100020501 3300005436 Bacteria 5069
60 Ga0070713_100041820 3300005436 Bacteria 3737
61 Ga0070713_100068249 3300005436 Bacteria 2996
62 Ga0070710_10285617 3300005437 Bacteria 1072
63 Ga0070711_100005465 3300005439 Bacteria 7602
64 Ga0070711_100008073 3300005439 Bacteria 6429
65 Ga0070711_100030669 3300005439 Bacteria 3562
66 Ga0070711_100238312 3300005439 Bacteria 1421
67 Ga0070705_100063330 3300005440 Bacteria 2205
68 Ga0070705_100073762 3300005440 Bacteria 2072
69 Ga0070694_100021964 3300005444 Bacteria 4085
70 Ga0070694_100101585 3300005444 Bacteria 2035
71 Ga0070694_100199584 3300005444 Bacteria 1490
72 Ga0070708_100000357 3300005445 Bacteria 34509
73 Ga0070708_100483262 3300005445 Unclassified 1168
74 Ga0070663_100165676 3300005455 Unclassified 1704
75 Ga0070663_100226061 3300005455 Unclassified 1471
76 Ga0070663_100253855 3300005455 Unclassified 1392
77 Ga0070678_100154893 3300005456 Unclassified 1850
78 Ga0070678_100233792 3300005456 Bacteria 1534
79 Ga0070678_100402534 3300005456 Bacteria 1189
80 Ga0070662_100038514 3300005457 Bacteria 3396
81 Ga0070662_100069848 3300005457 Bacteria 2587
82 Ga0070662_100182862 3300005457 Unclassified 1654
83 Ga0070681_10229015 3300005458 Bacteria 1773
84 Ga0070681_10690579 3300005458 Unclassified 936
85 Ga0070706_100049151 3300005467 Unclassified 3892
86 Ga0070706_100372333 3300005467 Unclassified 1331
87 Ga0070706_100401737 3300005467 Unclassified 1275
88 Ga0070707_100008350 3300005468 Bacteria 9615
89 Ga0070707_100107556 3300005468 Unclassified 2705
90 Ga0070707_100591503 3300005468 Unclassified 1072
91 Ga0070698_100059745 3300005471 Unclassified 3849
92 Ga0070699_100227853 3300005518 Bacteria 1661
93 Ga0070699_100434862 3300005518 Bacteria 1189
94 Ga0070684_100005454 3300005535 Bacteria 9744
95 Ga0070684_100142405 3300005535 Unclassified 2168
96 Ga0070684_100216987 3300005535 Unclassified 1745
97 Ga0070697_100002187 3300005536 Bacteria 14999
98 Ga0070697_100021784 3300005536 Bacteria 5080
99 Ga0070697_100023379 3300005536 Bacteria 4914
100 Ga0070697_100030094 3300005536 Bacteria 4359
101 Ga0070697_100100238 3300005536 Bacteria 2405
102 Ga0068853_100317468 3300005539 Unclassified 1444
103 Ga0068853_100340591 3300005539 Bacteria 1393
104 Ga0068853_100536499 3300005539 Unclassified 1107
105 Ga0070672_100034108 3300005543 Bacteria 3860
106 Ga0070672_100052062 3300005543 Bacteria 3195
107 Ga0070672_100251904 3300005543 Bacteria 1487
108 Ga0070686_100017399 3300005544 Bacteria 4200
109 Ga0070686_100279097 3300005544 Bacteria 1231
110 Ga0070696_100000226 3300005546 Bacteria 34078
111 Ga0070696_100042481 3300005546 Bacteria 3142
112 Ga0070693_100073102 3300005547 Bacteria 2025
113 Ga0070704_100002081 3300005549 Bacteria 11118
114 Ga0070704_100309085 3300005549 Unclassified 1320
115 Ga0068855_100428571 3300005563 Unclassified 1446
116 Ga0070664_100204099 3300005564 Bacteria 1765
117 Ga0068857_100047846 3300005577 Bacteria 3798
118 Ga0068852_100266868 3300005616 Bacteria 1646
119 Ga0068859_100025526 3300005617 Bacteria 5927
120 Ga0068851_10008149 3300005834 Bacteria 4838
121 Ga0068863_100012519 3300005841 Bacteria 8185
122 Ga0068863_100013955 3300005841 Bacteria 7745
123 Ga0068858_100000768 3300005842 Bacteria 33486
124 Ga0068858_100017702 3300005842 Bacteria 6677
125 Ga0068860_100001016 3300005843 Bacteria 31083
126 Ga0081455_10003472 3300005937 Bacteria 18114
127 Ga0081455_10006011 3300005937 Bacteria 13156
128 Ga0081455_10008922 3300005937 Bacteria 10365
129 Ga0081455_10014023 3300005937 Bacteria 7877
130 Ga0081455_10089184 3300005937 Bacteria 2503
131 Ga0081455_10163946 3300005937 Bacteria 1700
132 Ga0081455_10192937 3300005937 Bacteria 1532
133 Ga0081540_1000018 3300005983 Bacteria 164931
134 Ga0070717_10030502 3300006028 Bacteria 4332
135 Ga0070717_10396347 3300006028 Bacteria 1239
136 Ga0075364_10472234 3300006051 Unclassified 857
137 Ga0070715_10005935 3300006163 Bacteria 4117
138 Ga0070715_10075714 3300006163 Bacteria 1514
139 Ga0070716_100004436 3300006173 Bacteria 6711
140 Ga0070716_100036083 3300006173 Bacteria 2723
141 Ga0070716_100061718 3300006173 Bacteria 2170
142 Ga0070712_100175564 3300006175 Bacteria 1666
143 Ga0070712_100238222 3300006175 Unclassified 1448
144 Ga0070712_100443752 3300006175 Bacteria 1079
145 Ga0068871_100024119 3300006358 Bacteria 4714
146 Ga0075428_100282509 3300006844 Bacteria 1786
147 Ga0075428_100364102 3300006844 Bacteria 1551
148 Ga0075428_100384791 3300006844 Unclassified 1504
149 Ga0075433_10012668 3300006852 Bacteria 6823
150 Ga0075433_10218892 3300006852 Unclassified 1691
151 Ga0068865_100548026 3300006881 Bacteria 971
152 Ga0068865_100596543 3300006881 Unclassified 933
153 Ga0075436_100002835 3300006914 Bacteria 11872
154 Ga0075436_100009736 3300006914 Bacteria 6576
155 Ga0075436_100129934 3300006914 Unclassified 1766
156 Ga0075436_100260354 3300006914 Unclassified 1237
157 Ga0097620_100025527 3300006931 Bacteria 5927
158 Ga0075435_100075887 3300007076 Bacteria 2754
159 Ga0099795_10034533 3300007788 Bacteria 1762
160 Ga0105240_10071292 3300009093 Unclassified 4298
161 Ga0105240_10474714 3300009093 Bacteria 1395
162 Ga0111539_10001041 3300009094 Bacteria 36433
163 Ga0111539_10378831 3300009094 Bacteria 1647
164 Ga0111539_10712500 3300009094 Unclassified 1168
165 Ga0114129_10088775 3300009147 Bacteria 4286
166 Ga0114129_10388404 3300009147 Bacteria 1842
167 Ga0114129_10644439 3300009147 Bacteria 1368
168 Ga0105243_10492947 3300009148 Unclassified 1159
169 Ga0105241_10833197 3300009174 Bacteria 852
170 Ga0105242_10007528 3300009176 Bacteria 8380
171 Ga0105242_10077968 3300009176 Bacteria 2765
172 Ga0105248_10211700 3300009177 Bacteria 2184
173 Ga0105237_10046181 3300009545 Bacteria 4382
174 Ga0105238_10105656 3300009551 Bacteria 2797
175 Ga0105249_10020278 3300009553 Bacteria 5943
176 Ga0105249_10627645 3300009553 Unclassified 1131
177 Ga0099796_10004017 3300010159 Bacteria 3501
178 Ga0105239_10015237 3300010375 Bacteria 8518
179 Ga0105239_10282998 3300010375 Unclassified 1867
180 Ga0157371_10192411 3300013102 Bacteria 1461
181 Ga0157369_10449165 3300013105 Unclassified 1335
182 Ga0157374_10061741 3300013296 Unclassified 3511
183 Ga0157374_10172945 3300013296 Bacteria 2108
184 Ga0157374_10413689 3300013296 Bacteria 1346
185 Ga0157374_10629756 3300013296 Unclassified 1084
186 Ga0157374_10645260 3300013296 Bacteria 1070
187 Ga0157378_10006487 3300013297 Bacteria 10230
188 Ga0157378_10098553 3300013297 Bacteria 2665
189 Ga0157378_10243335 3300013297 Unclassified 1719
190 Ga0157378_10808363 3300013297 Bacteria 964
191 Ga0163162_10088495 3300013306 Bacteria 3176
192 Ga0163162_10333062 3300013306 Bacteria 1650
193 Ga0163162_10436306 3300013306 Unclassified 1442
194 Ga0157372_10906690 3300013307 Unclassified 1023
195 Ga0157375_10008707 3300013308 Bacteria 8892
196 Ga0157375_10073631 3300013308 Bacteria 3435
197 Ga0157375_10115374 3300013308 Unclassified 2789
198 Ga0157375_10196668 3300013308 Bacteria 2171
199 Ga0157375_10257403 3300013308 Unclassified 1907
200 Ga0157375_10260266 3300013308 Bacteria 1896
201 Ga0157375_10532252 3300013308 Bacteria 1338
202 Ga0157375_10739119 3300013308 Unclassified 1136
203 Ga0163163_10223066 3300014325 Unclassified 1934
204 Ga0163163_10311148 3300014325 Unclassified 1628
205 Ga0163163_10368634 3300014325 Unclassified 1493
206 Ga0163163_10626257 3300014325 Bacteria 1139
207 Ga0157380_10193890 3300014326 Unclassified 1796
208 Ga0157379_10005670 3300014968 Bacteria 10734
209 Ga0157379_10129646 3300014968 Bacteria 2269
210 Ga0157379_10274979 3300014968 Unclassified 1532
211 Ga0157376_10172519 3300014969 Bacteria 1971
212 Ga0157376_10249177 3300014969 Bacteria 1658
213 Ga0157376_10336033 3300014969 Bacteria 1441
214 Ga0163161_10009842 3300017792 Bacteria 6622
215 Ga0163161_10083196 3300017792 Bacteria 2359
216 Ga0207666_1005942 3300025271 Bacteria 1571
217 Ga0207673_1000419 3300025290 Bacteria 4363
218 Ga0207697_10000853 3300025315 Bacteria 17252
219 Ga0207697_10003364 3300025315 Bacteria 7948
220 Ga0207697_10005009 3300025315 Bacteria 6230
221 Ga0207697_10176722 3300025315 Unclassified 935
222 Ga0207656_10068631 3300025321 Unclassified 1571
223 Ga0207688_10006301 3300025901 Bacteria 6460
224 Ga0207680_10078877 3300025903 Bacteria 2063
225 Ga0207685_10013740 3300025905 Bacteria 2514
226 Ga0207699_10069118 3300025906 Bacteria 2152
227 Ga0207699_10123131 3300025906 Bacteria 1680
228 Ga0207645_10002843 3300025907 Bacteria 13430
229 Ga0207645_10018363 3300025907 Unclassified 4602
230 Ga0207645_10321360 3300025907 Unclassified 1032
231 Ga0207645_10343043 3300025907 Unclassified 999
232 Ga0207695_10149408 3300025913 Bacteria 2277
233 Ga0207671_10027055 3300025914 Bacteria 4290
234 Ga0207693_10002587 3300025915 Bacteria 15719
235 Ga0207693_10016132 3300025915 Bacteria 5975
236 Ga0207693_10016690 3300025915 Bacteria 5865
237 Ga0207693_10225963 3300025915 Unclassified 1470
238 Ga0207663_10010810 3300025916 Bacteria 4873
239 Ga0207663_10024219 3300025916 Bacteria 3494
240 Ga0207663_10176640 3300025916 Bacteria 1521
241 Ga0207657_10245613 3300025919 Unclassified 1428
242 Ga0207649_10030362 3300025920 Bacteria 3200
243 Ga0207652_10371698 3300025921 Bacteria 1290
244 Ga0207646_10004148 3300025922 Bacteria 15909
245 Ga0207646_10070557 3300025922 Unclassified 3120
246 Ga0207681_10046349 3300025923 Bacteria 2924
247 Ga0207650_10077689 3300025925 Bacteria 2510
248 Ga0207659_10104523 3300025926 Bacteria 2141
249 Ga0207659_10151514 3300025926 Bacteria 1811
250 Ga0207700_10071788 3300025928 Bacteria 2667
251 Ga0207700_10811174 3300025928 Unclassified 837
252 Ga0207644_10030962 3300025931 Bacteria 3726
253 Ga0207644_10132989 3300025931 Bacteria 1907
254 Ga0207644_10230296 3300025931 Bacteria 1472
255 Ga0207644_10327862 3300025931 Unclassified 1239
256 Ga0207644_10585633 3300025931 Bacteria 925
257 Ga0207690_10338974 3300025932 Bacteria 1186
258 Ga0207706_10029139 3300025933 Bacteria 4929
259 Ga0207706_10036608 3300025933 Bacteria 4358
260 Ga0207706_10080905 3300025933 Bacteria 2855
261 Ga0207706_10259742 3300025933 Unclassified 1516
262 Ga0207670_10226215 3300025936 Bacteria 1434
263 Ga0207704_10448504 3300025938 Unclassified 1029
264 Ga0207665_10005026 3300025939 Bacteria 8828
265 Ga0207665_10107828 3300025939 Bacteria 1953
266 Ga0207665_10259233 3300025939 Unclassified 1287
267 Ga0207691_10019150 3300025940 Bacteria 6480
268 Ga0207691_10032948 3300025940 Bacteria 4828
269 Ga0207691_10051141 3300025940 Bacteria 3779
270 Ga0207691_10333271 3300025940 Bacteria 1300
271 Ga0207711_10394538 3300025941 Unclassified 1285
272 Ga0207661_10066754 3300025944 Bacteria 2923
273 Ga0207661_10420553 3300025944 Bacteria 1214
274 Ga0207679_10157233 3300025945 Unclassified 1857
275 Ga0207667_10153086 3300025949 Bacteria 2373
276 Ga0207651_10077242 3300025960 Unclassified 2383
277 Ga0207668_10021725 3300025972 Bacteria 4097
278 Ga0207668_10115922 3300025972 Unclassified 2019
279 Ga0207668_10210445 3300025972 Unclassified 1555
280 Ga0207658_10014019 3300025986 Bacteria 5486
281 Ga0207677_10250614 3300026023 Bacteria 1438
282 Ga0207703_10000326 3300026035 Bacteria 51867
283 Ga0207703_10017925 3300026035 Bacteria 5529
284 Ga0207639_10508191 3300026041 Bacteria 1102
285 Ga0207678_10110578 3300026067 Archaea 2344
286 Ga0207678_10141595 3300026067 Bacteria 2052
287 Ga0207641_10000117 3300026088 Bacteria 117830
288 Ga0207676_10375499 3300026095 Unclassified 1322
289 Ga0207676_10692477 3300026095 Unclassified 987
290 Ga0207674_10074749 3300026116 Bacteria 3399
291 Ga0207683_10021648 3300026121 Bacteria 5509
292 Ga0207683_10207038 3300026121 Bacteria 1784
293 Ga0209981_1002590 3300027378 Bacteria 2310
294 Ga0210000_1002372 3300027462 Bacteria 2679
295 Ga0209971_1051891 3300027682 Bacteria 991
296 Ga0209966_1003120 3300027695 Bacteria 2778
297 Ga0209974_10059632 3300027876 Unclassified 1290
298 Ga0268266_10026727 3300028379 Unclassified 4911
299 Ga0268266_10225616 3300028379 Unclassified 1724
300 Ga0268266_10238033 3300028379 Bacteria 1679
301 Ga0268264_10000647 3300028381 Bacteria 41034
302 Ga0268264_10022132 3300028381 Bacteria 5188
303 Ga0265319_1000026 3300028563 Bacteria 141358
304 Ga0265319_1003608 3300028563 Bacteria 8005
305 Ga0265319_1048501 3300028563 Bacteria 1409
306 Ga0265318_10001777 3300028577 Bacteria 12256
307 Ga0265320_10002381 3300031240 Bacteria 13124
308 Ga0265320_10017264 3300031240 Bacteria 4013
309 Ga0265320_10117766 3300031240 Bacteria 1213
310 Ga0265325_10001688 3300031241 Bacteria 15335
311 Ga0265340_10134737 3300031247 Bacteria 1131
312 Ga0265331_10070622 3300031250 Bacteria 1634
313 Ga0265316_10277071 3300031344 Bacteria 1226
314 Ga0307408_100162175 3300031548 Bacteria 1777
315 Ga0316575_10069976 3300031665 Bacteria 1409
316 Ga0265314_10005049 3300031711 Bacteria 12031
317 Ga0307412_10523333 3300031911 Bacteria 991
318 Ga0307416_100793190 3300032002 Bacteria 1042
319 Ga0307414_10015420 3300032004 Bacteria 4612
320 Ga0307411_10389424 3300032005 Bacteria 1149
321 Ga0316593_10011504 3300032168 Bacteria 2573
322 Ga0373929_0000010 3300035085 Bacteria 192939
323 Ga0373929_0009004 3300035085 Bacteria 1845
324 Ga0373953_0074743 3300035117 Bacteria 1402
325 Ga0373953_0202240 3300035117 Bacteria 859
326 Ga0373960_0019934 3300035121 Bacteria 1768
327 Ga0373943_0036133 3300035170 Bacteria 2365
328 Ga0373946_0111014 3300035171 Bacteria 1241
329 Ga0373955_0048415 3300035172 Unclassified 2305
330 Ga0373961_0002139 3300035241 Bacteria 5242
331 Ga0316574_0209789 3300035398 Bacteria 1250
332 Ga0316574_0231859 3300035398 Unclassified 1181
333 Ga0373924_0028208 3300035410 Bacteria 2236
334 Ga0373935_0038997 3300035692 Bacteria 2976
335 Ga0373933_0015336 3300035724 Bacteria 4272
336 Ga0373933_0059737 3300035724 Bacteria 2297
337 Ga0373947_0033907 3300035725 Bacteria 3018
338 Ga0373947_0124329 3300035725 Bacteria 1641
339 Ga0373937_0067758 3300036401 Bacteria 3289
340 Ga0310109_018857 3300036534 Eukaryota 932
341 Ga0373925_0049181 3300037068 Bacteria 3143
342 Ga0395899_0034864 3300037312 Bacteria 3779
343 Ga0395900_0005333 3300037418 Bacteria 13470
344 Ga0395900_0010506 3300037418 Bacteria 9471
345 Ga0395900_0022193 3300037418 Bacteria 6494
346 Ga0395900_0256492 3300037418 Unclassified 1748
347 Ga0395900_0276901 3300037418 Bacteria 1671
348 Ga0395900_0320626 3300037418 Unclassified 1530
349 Ga0395898_0017498 3300037466 Bacteria 7318
350 Ga0395905_0008994 3300037471 Bacteria 9801
351 Ga0395905_0028081 3300037471 Bacteria 5306
352 Ga0395905_0028560 3300037471 Bacteria 5258
353 Ga0395905_0042047 3300037471 Bacteria 4288
354 Ga0395905_0175222 3300037471 Bacteria 2014
355 Ga0395901_0005469 3300038443 Bacteria 12862
356 Ga0395901_0065397 3300038443 Bacteria 3786
357 Ga0395901_0106018 3300038443 Unclassified 2950
358 Ga0400484_30100 3300038725 Bacteria 3079
359 Ga0400488_12055 3300038741 Bacteria 1480
360 Ga0400483_010853 3300039062 Bacteria 8609
361 Ga0436365_1351276 3300039437 Unclassified 1169
362 Ga0451807_2072833 3300041486 Unclassified 1025
363 Ga0451837_1684472 3300041494 Bacteria 965
364 Ga0439455_0010189 3300042012 Bacteria 2060
365 Ga0451577_0073796 3300042876 Bacteria 3044
366 Ga0453683_0000790 3300044673 Bacteria 31276
367 Ga0453683_0108683 3300044673 Bacteria 1743
368 Ga0453683_0136275 3300044673 Bacteria 1548
369 Ga0453684_0000878 3300044712 Bacteria 100519
370 Ga0453684_0036238 3300044712 Bacteria 6801
371 Ga0453684_0409504 3300044712 Bacteria 1517
372 Ga0453684_0555406 3300044712 Unclassified 1264
373 Ga0451576_0041296 3300045051 Bacteria 4878
374 Ga0451576_0337066 3300045051 Bacteria 1579
375 Ga0495592_0005751 3300046454 Bacteria 9179
376 Ga0495592_0121401 3300046454 Unclassified 1838
377 Ga0495653_0278031 3300046463 Unclassified 1100
378 Ga0495582_0247740 3300046473 Bacteria 1022
379 Ga0495662_0022298 3300046476 Bacteria 3059
380 Ga0495584_0002621 3300046491 Bacteria 10140
381 Ga0495596_0005206 3300046500 Bacteria 6185
382 Ga0495618_0056760 3300046514 Bacteria 2479
383 Ga0495628_0015953 3300046516 Bacteria 6268
384 Ga0495628_0131146 3300046516 Bacteria 1917
385 Ga0495630_0010444 3300046517 Bacteria 6704
386 Ga0495630_0023526 3300046517 Bacteria 4555
387 Ga0495652_0044557 3300046529 Bacteria 3819
388 Ga0495652_0114610 3300046529 Bacteria 2162
389 Ga0495586_0105840 3300046535 Bacteria 1564
390 Ga0495598_0017477 3300046537 Bacteria 1849
391 Ga0495597_0011884 3300046542 Bacteria 4212
392 Ga0495645_0006784 3300046543 Bacteria 7955
393 Ga0495645_0054376 3300046543 Bacteria 2909
394 Ga0495667_0070830 3300046559 Bacteria 2274
395 Ga0495657_0056952 3300046675 Bacteria 2601
396 Ga0495599_0009556 3300046678 Bacteria 5931
397 Ga0495623_0008172 3300046679 Bacteria 6804
398 Ga0495646_0033810 3300046680 Bacteria 3178
399 Ga0495658_0102314 3300046683 Bacteria 1712
400 Ga0495658_0218268 3300046683 Unclassified 1193
401 Ga0495669_0006521 3300046684 Bacteria 4879
402 Ga0495613_0119535 3300046689 Unclassified 1893
403 Ga0495613_0265719 3300046689 Bacteria 1194
404 Ga0495636_0165244 3300047318 Bacteria 998
405 Ga0495675_0054981 3300047444 Bacteria 2525
406 Ga0495675_0100688 3300047444 Bacteria 1808
407 Ga0495684_0353011 3300047471 Bacteria 1043
408 Ga0495602_0103519 3300048088 Bacteria 2330
409 Ga0496100_0042276 3300048903 Bacteria 2911
410 Ga0496100_0331637 3300048903 Bacteria 1145
411 Ga0496100_0698421 3300048903 Unclassified 792
412 Ga0496101_0068286 3300048904 Bacteria 2598
413 Ga0496102_0048857 3300048905 Bacteria 3848
414 Ga0496102_0307332 3300048905 Bacteria 1494
415 Ga0496104_0296233 3300048907 Unclassified 1530
416 Ga0496105_0053724 3300048908 Unclassified 3327
417 Ga0496105_0401031 3300048908 Unclassified 1089
418 Ga0496106_0166834 3300048909 Bacteria 1743
419 Ga0496107_0006454 3300048910 Bacteria 8066
420 Ga0496107_0280728 3300048910 Unclassified 1240
421 Ga0496108_0081911 3300048911 Bacteria 2736
422 Ga0496108_0134715 3300048911 Unclassified 2124
423 Ga0496108_0205279 3300048911 Bacteria 1710
424 Ga0496108_0209077 3300048911 Unclassified 1694
425 Ga0496108_0250210 3300048911 Bacteria 1542
426 Ga0496108_0320028 3300048911 Bacteria 1352
427 Ga0496109_0109917 3300048912 Bacteria 2563
428 Ga0496109_0110040 3300048912 Bacteria 2561
429 Ga0496109_0198822 3300048912 Unclassified 1884
430 Ga0496109_0659678 3300048912 Bacteria 983
431 Ga0496110_0680187 3300048913 Unclassified 930
432 Ga0496112_0030504 3300048915 Bacteria 5219
433 Ga0496112_0037936 3300048915 Bacteria 4705
434 Ga0496112_0063481 3300048915 Bacteria 3643
435 Ga0496112_0123121 3300048915 Bacteria 2564
436 Ga0496112_0140214 3300048915 Bacteria 2387
437 Ga0496113_0166972 3300048916 Bacteria 1742
438 Ga0496113_0213243 3300048916 Unclassified 1537
439 Ga0496113_0272037 3300048916 Bacteria 1354
440 Ga0496114_0151321 3300048917 Bacteria 2013
441 Ga0496115_0026625 3300048918 Unclassified 4515
442 Ga0496115_0034211 3300048918 Bacteria 4016
443 Ga0496115_0659101 3300048918 Bacteria 826
444 Ga0496116_0006436 3300048919 Bacteria 10646
445 Ga0496118_0209384 3300048921 Bacteria 1146
446 Ga0496125_0000289 3300048928 Bacteria 99535
447 Ga0496126_0174815 3300048929 Bacteria 1827
448 Ga0501034_0000209 3300049571 Bacteria 111455
449 Ga0501034_0038707 3300049571 Bacteria 4829
450 Ga0501036_0391525 3300049572 Bacteria 1159
451 Ga0501043_0005836 3300049579 Bacteria 9904
452 Ga0501046_0009188 3300049580 Bacteria 8562
453 Ga0501046_0128326 3300049580 Bacteria 1924
454 Ga0501047_0002043 3300049581 Bacteria 19294
455 Ga0501047_0027953 3300049581 Bacteria 5437
456 Ga0501067_0024315 3300049583 Bacteria 3360
457 Ga0501067_0285609 3300049583 Bacteria 919
458 Ga0501068_0001185 3300049584 Bacteria 13874
459 Ga0501068_0097355 3300049584 Bacteria 1821
460 Ga0501069_0052058 3300049585 Bacteria 2279
461 Ga0501070_0000028 3300049586 Bacteria 140133
462 Ga0501070_0000330 3300049586 Bacteria 43031
463 Ga0501073_0028650 3300049589 Bacteria 3979
464 Ga0501073_0107978 3300049589 Bacteria 1931
465 Ga0501073_0139047 3300049589 Bacteria 1683
466 Ga0501074_0009210 3300049590 Bacteria 7175
467 Ga0501077_0010414 3300049593 Bacteria 5786
468 Ga0501080_0007342 3300049742 Bacteria 9948
469 Ga0501080_0024476 3300049742 Bacteria 5595
470 Ga0501080_0038001 3300049742 Bacteria 4496
471 Ga0501080_0286325 3300049742 Bacteria 1497
472 Ga0501083_0010289 3300049744 Bacteria 6591
473 Ga0501083_0050086 3300049744 Bacteria 2812
474 Ga0501083_0165200 3300049744 Bacteria 1447
475 Ga0501241_005075 3300049758 Bacteria 2461
476 nmdc:mga05p37_47278_c1 3300050507 Bacteria 5292
477 nmdc:mga08y16_181617_c1 3300050511 Bacteria 2185
478 nmdc:mga08y16_290592_c1 3300050511 Bacteria 1685
479 nmdc:mga0n895_29506_c1 3300050512 Bacteria 5233
480 nmdc:mga0n895_567894_c1 3300050512 Unclassified 1139
481 nmdc:mga0rr50_62248_c1 3300050513 Bacteria 2814
482 nmdc:mga08x19_184723_c1 3300050514 Bacteria 1424
483 nmdc:mga08x19_376148_c1 3300050514 Unclassified 994
484 nmdc:mga08x19_388004_c1 3300050514 Unclassified 978
485 nmdc:mga08x19_57_c1 3300050514 Bacteria 120271
486 nmdc:mga0a205_110674_c1 3300050515 Bacteria 2645
487 Ga0495601_0002238 3300053077 Bacteria 10901
488 Ga0495595_0131887 3300053084 Bacteria 1222
489 Ga0495619_0052921 3300053085 Bacteria 2684
490 Ga0495619_0218296 3300053085 Unclassified 1321
491 Ga0500555_003147 3300053103 Bacteria 4704
492 Ga0501084_0499281 3300054114 Bacteria 1028
493 Ga0501082_0000166 3300060353 Bacteria 56493
494 Ga0501082_0016853 3300060353 Bacteria 6291
495 Ga0530510_0131171 3300061734 Bacteria 1844
496 Ga0530510_0491946 3300061734 Bacteria 929
497 2673165566 2671180531 Bacteria 9045424
498 2945927421 2945924605 Bacteria 4296724
499 Ga0065707_10138770
500 rootH2_10238300
501 rootH2_10314158
502 rootL2_10060197
503 Ga0065704_10011190
504 Ga0065704_10032676
505 Ga0065712_10129026
506 Ga0065712_10142441
507 Ga0065712_10168919
508 Ga0065712_10234157
509 Ga0065715_10159184
510 Ga0065715_10203628
511 Ga0065707_10028833
512 Ga0065707_10125596
513 Ga0070676_10138565
514 Ga0070683_100514929
515 Ga0070690_100105940
516 Ga0070670_100277030
517 Ga0068869_100166570
518 Ga0070666_10052133
519 Ga0070666_10088769
520 Ga0070666_10118747
521 Ga0070680_100124158
522 Ga0070682_100000012
523 Ga0070682_100425899
524 Ga0070687_100044381
525 Ga0070661_100118933
526 Ga0070661_100202400
527 Ga0070661_100299648
528 Ga0070692_10012418
529 Ga0070692_10136579
530 Ga0070668_100118609
531 Ga0070668_100228708
532 Ga0070669_100065601
533 Ga0070669_100214999
534 Ga0070669_100362743
535 Ga0070675_100004348
536 Ga0070675_100050257
537 Ga0070675_100068596
538 Ga0070675_100111042
539 Ga0070671_100032775
540 Ga0070671_100063114
541 Ga0070671_100342600
542 Ga0070671_100352965
543 Ga0070671_100398316
544 Ga0070671_100555168
545 Ga0070673_100114242
546 Ga0070673_100118201
547 Ga0070673_100177513
548 Ga0070688_100001889
549 Ga0070659_100085086
550 Ga0070659_100616627
551 Ga0070667_100038244
552 Ga0070709_10009434
553 Ga0070709_10027850
554 Ga0070714_100023616
555 Ga0070714_100033074
556 Ga0070714_100387643
557 Ga0070713_100020501
558 Ga0070713_100041820
559 Ga0070713_100068249
560 Ga0070710_10285617
561 Ga0070711_100005465
562 Ga0070711_100008073
563 Ga0070711_100030669
564 Ga0070711_100238312
565 Ga0070705_100063330
566 Ga0070705_100073762
567 Ga0070694_100021964
568 Ga0070694_100101585
569 Ga0070694_100199584
570 Ga0070708_100000357
571 Ga0070708_100483262
572 Ga0070663_100165676
573 Ga0070663_100226061
574 Ga0070663_100253855
575 Ga0070678_100154893
576 Ga0070678_100233792
577 Ga0070678_100402534
578 Ga0070662_100038514
579 Ga0070662_100069848
580 Ga0070662_100182862
581 Ga0070681_10229015
582 Ga0070681_10690579
583 Ga0070706_100049151
584 Ga0070706_100372333
585 Ga0070706_100401737
586 Ga0070707_100008350
587 Ga0070707_100107556
588 Ga0070707_100591503
589 Ga0070698_100059745
590 Ga0070699_100227853
591 Ga0070699_100434862
592 Ga0070684_100005454
593 Ga0070684_100142405
594 Ga0070684_100216987
595 Ga0070697_100002187
596 Ga0070697_100021784
597 Ga0070697_100023379
598 Ga0070697_100030094
599 Ga0070697_100100238
600 Ga0068853_100317468
601 Ga0068853_100340591
602 Ga0068853_100536499
603 Ga0070672_100034108
604 Ga0070672_100052062
605 Ga0070672_100251904
606 Ga0070686_100017399
607 Ga0070686_100279097
608 Ga0070696_100000226
609 Ga0070696_100042481
610 Ga0070693_100073102
611 Ga0070704_100002081
612 Ga0070704_100309085
613 Ga0068855_100428571
614 Ga0070664_100204099
615 Ga0068857_100047846
616 Ga0068852_100266868
617 Ga0068859_100025526
618 Ga0068851_10008149
619 Ga0068863_100012519
620 Ga0068863_100013955
621 Ga0068858_100000768
622 Ga0068858_100017702
623 Ga0068860_100001016
624 Ga0081455_10003472
625 Ga0081455_10006011
626 Ga0081455_10008922
627 Ga0081455_10014023
628 Ga0081455_10089184
629 Ga0081455_10163946
630 Ga0081455_10192937
631 Ga0081540_1000018
632 Ga0070717_10030502
633 Ga0070717_10396347
634 Ga0075364_10472234
635 Ga0070715_10005935
636 Ga0070715_10075714
637 Ga0070716_100004436
638 Ga0070716_100036083
639 Ga0070716_100061718
640 Ga0070712_100175564
641 Ga0070712_100238222
642 Ga0070712_100443752
643 Ga0068871_100024119
644 Ga0075428_100282509
645 Ga0075428_100364102
646 Ga0075428_100384791
647 Ga0075433_10012668
648 Ga0075433_10218892
649 Ga0068865_100548026
650 Ga0068865_100596543
651 Ga0075436_100002835
652 Ga0075436_100009736
653 Ga0075436_100129934
654 Ga0075436_100260354
655 Ga0097620_100025527
656 Ga0075435_100075887
657 Ga0099795_10034533
658 Ga0105240_10071292
659 Ga0105240_10474714
660 Ga0111539_10001041
661 Ga0111539_10378831
662 Ga0111539_10712500
663 Ga0114129_10088775
664 Ga0114129_10388404
665 Ga0114129_10644439
666 Ga0105243_10492947
667 Ga0105241_10833197
668 Ga0105242_10007528
669 Ga0105242_10077968
670 Ga0105248_10211700
671 Ga0105237_10046181
672 Ga0105238_10105656
673 Ga0105249_10020278
674 Ga0105249_10627645
675 Ga0099796_10004017
676 Ga0105239_10015237
677 Ga0105239_10282998
678 Ga0157371_10192411
679 Ga0157369_10449165
680 Ga0157374_10061741
681 Ga0157374_10172945
682 Ga0157374_10413689
683 Ga0157374_10629756
684 Ga0157374_10645260
685 Ga0157378_10006487
686 Ga0157378_10098553
687 Ga0157378_10243335
688 Ga0157378_10808363
689 Ga0163162_10088495
690 Ga0163162_10333062
691 Ga0163162_10436306
692 Ga0157372_10906690
693 Ga0157375_10008707
694 Ga0157375_10073631
695 Ga0157375_10115374
696 Ga0157375_10196668
697 Ga0157375_10257403
698 Ga0157375_10260266
699 Ga0157375_10532252
700 Ga0157375_10739119
701 Ga0163163_10223066
702 Ga0163163_10311148
703 Ga0163163_10368634
704 Ga0163163_10626257
705 Ga0157380_10193890
706 Ga0157379_10005670
707 Ga0157379_10129646
708 Ga0157379_10274979
709 Ga0157376_10172519
710 Ga0157376_10249177
711 Ga0157376_10336033
712 Ga0163161_10009842
713 Ga0163161_10083196
714 Ga0207666_1005942
715 Ga0207673_1000419
716 Ga0207697_10000853
717 Ga0207697_10003364
718 Ga0207697_10005009
719 Ga0207697_10176722
720 Ga0207656_10068631
721 Ga0207688_10006301
722 Ga0207680_10078877
723 Ga0207685_10013740
724 Ga0207699_10069118
725 Ga0207699_10123131
726 Ga0207645_10002843
727 Ga0207645_10018363
728 Ga0207645_10321360
729 Ga0207645_10343043
730 Ga0207695_10149408
731 Ga0207671_10027055
732 Ga0207693_10002587
733 Ga0207693_10016132
734 Ga0207693_10016690
735 Ga0207693_10225963
736 Ga0207663_10010810
737 Ga0207663_10024219
738 Ga0207663_10176640
739 Ga0207657_10245613
740 Ga0207649_10030362
741 Ga0207652_10371698
742 Ga0207646_10004148
743 Ga0207646_10070557
744 Ga0207681_10046349
745 Ga0207650_10077689
746 Ga0207659_10104523
747 Ga0207659_10151514
748 Ga0207700_10071788
749 Ga0207700_10811174
750 Ga0207644_10030962
751 Ga0207644_10132989
752 Ga0207644_10230296
753 Ga0207644_10327862
754 Ga0207644_10585633
755 Ga0207690_10338974
756 Ga0207706_10029139
757 Ga0207706_10036608
758 Ga0207706_10080905
759 Ga0207706_10259742
760 Ga0207670_10226215
761 Ga0207704_10448504
762 Ga0207665_10005026
763 Ga0207665_10107828
764 Ga0207665_10259233
765 Ga0207691_10019150
766 Ga0207691_10032948
767 Ga0207691_10051141
768 Ga0207691_10333271
769 Ga0207711_10394538
770 Ga0207661_10066754
771 Ga0207661_10420553
772 Ga0207679_10157233
773 Ga0207667_10153086
774 Ga0207651_10077242
775 Ga0207668_10021725
776 Ga0207668_10115922
777 Ga0207668_10210445
778 Ga0207658_10014019
779 Ga0207677_10250614
780 Ga0207703_10000326
781 Ga0207703_10017925
782 Ga0207639_10508191
783 Ga0207678_10110578
784 Ga0207678_10141595
785 Ga0207641_10000117
786 Ga0207676_10375499
787 Ga0207676_10692477
788 Ga0207674_10074749
789 Ga0207683_10021648
790 Ga0207683_10207038
791 Ga0209981_1002590
792 Ga0210000_1002372
793 Ga0209971_1051891
794 Ga0209966_1003120
795 Ga0209974_10059632
796 Ga0268266_10026727
797 Ga0268266_10225616
798 Ga0268266_10238033
799 Ga0268264_10000647
800 Ga0268264_10022132
801 Ga0265319_1000026
802 Ga0265319_1003608
803 Ga0265319_1048501
804 Ga0265318_10001777
805 Ga0265320_10002381
806 Ga0265320_10017264
807 Ga0265320_10117766
808 Ga0265325_10001688
809 Ga0265340_10134737
810 Ga0265331_10070622
811 Ga0265316_10277071
812 Ga0307408_100162175
813 Ga0316575_10069976
814 Ga0265314_10005049
815 Ga0307412_10523333
816 Ga0307416_100793190
817 Ga0307414_10015420
818 Ga0307411_10389424
819 Ga0316593_10011504
820 Ga0373929_0000010
821 Ga0373929_0009004
822 Ga0373953_0074743
823 Ga0373953_0202240
824 Ga0373960_0019934
825 Ga0373943_0036133
826 Ga0373946_0111014
827 Ga0373955_0048415
828 Ga0373961_0002139
829 Ga0316574_0209789
830 Ga0316574_0231859
831 Ga0373924_0028208
832 Ga0373935_0038997
833 Ga0373933_0015336
834 Ga0373933_0059737
835 Ga0373947_0033907
836 Ga0373947_0124329
837 Ga0373937_0067758
838 Ga0310109_018857
839 Ga0373925_0049181
840 Ga0395899_0034864
841 Ga0395900_0005333
842 Ga0395900_0010506
843 Ga0395900_0022193
844 Ga0395900_0256492
845 Ga0395900_0276901
846 Ga0395900_0320626
847 Ga0395898_0017498
848 Ga0395905_0008994
849 Ga0395905_0028081
850 Ga0395905_0028560
851 Ga0395905_0042047
852 Ga0395905_0175222
853 Ga0395901_0005469
854 Ga0395901_0065397
855 Ga0395901_0106018
856 Ga0400484_30100
857 Ga0400488_12055
858 Ga0400483_010853
859 Ga0436365_1351276
860 Ga0451807_2072833
861 Ga0451837_1684472
862 Ga0439455_0010189
863 Ga0451577_0073796
864 Ga0453683_0000790
865 Ga0453683_0108683
866 Ga0453683_0136275
867 Ga0453684_0000878
868 Ga0453684_0036238
869 Ga0453684_0409504
870 Ga0453684_0555406
871 Ga0451576_0041296
872 Ga0451576_0337066
873 Ga0495592_0005751
874 Ga0495592_0121401
875 Ga0495653_0278031
876 Ga0495582_0247740
877 Ga0495662_0022298
878 Ga0495584_0002621
879 Ga0495596_0005206
880 Ga0495618_0056760
881 Ga0495628_0015953
882 Ga0495628_0131146
883 Ga0495630_0010444
884 Ga0495630_0023526
885 Ga0495652_0044557
886 Ga0495652_0114610
887 Ga0495586_0105840
888 Ga0495598_0017477
889 Ga0495597_0011884
890 Ga0495645_0006784
891 Ga0495645_0054376
892 Ga0495667_0070830
893 Ga0495657_0056952
894 Ga0495599_0009556
895 Ga0495623_0008172
896 Ga0495646_0033810
897 Ga0495658_0102314
898 Ga0495658_0218268
899 Ga0495669_0006521
900 Ga0495613_0119535
901 Ga0495613_0265719
902 Ga0495636_0165244
903 Ga0495675_0054981
904 Ga0495675_0100688
905 Ga0495684_0353011
906 Ga0495602_0103519
907 Ga0496100_0042276
908 Ga0496100_0331637
909 Ga0496100_0698421
910 Ga0496101_0068286
911 Ga0496102_0048857
912 Ga0496102_0307332
913 Ga0496104_0296233
914 Ga0496105_0053724
915 Ga0496105_0401031
916 Ga0496106_0166834
917 Ga0496107_0006454
918 Ga0496107_0280728
919 Ga0496108_0081911
920 Ga0496108_0134715
921 Ga0496108_0205279
922 Ga0496108_0209077
923 Ga0496108_0250210
924 Ga0496108_0320028
925 Ga0496109_0109917
926 Ga0496109_0110040
927 Ga0496109_0198822
928 Ga0496109_0659678
929 Ga0496110_0680187
930 Ga0496112_0030504
931 Ga0496112_0037936
932 Ga0496112_0063481
933 Ga0496112_0123121
934 Ga0496112_0140214
935 Ga0496113_0166972
936 Ga0496113_0213243
937 Ga0496113_0272037
938 Ga0496114_0151321
939 Ga0496115_0026625
940 Ga0496115_0034211
941 Ga0496115_0659101
942 Ga0496116_0006436
943 Ga0496118_0209384
944 Ga0496125_0000289
945 Ga0496126_0174815
946 Ga0501034_0000209
947 Ga0501034_0038707
948 Ga0501036_0391525
949 Ga0501043_0005836
950 Ga0501046_0009188
951 Ga0501046_0128326
952 Ga0501047_0002043
953 Ga0501047_0027953
954 Ga0501067_0024315
955 Ga0501067_0285609
956 Ga0501068_0001185
957 Ga0501068_0097355
958 Ga0501069_0052058
959 Ga0501070_0000028
960 Ga0501070_0000330
961 Ga0501073_0028650
962 Ga0501073_0107978
963 Ga0501073_0139047
964 Ga0501074_0009210
965 Ga0501077_0010414
966 Ga0501080_0007342
967 Ga0501080_0024476
968 Ga0501080_0038001
969 Ga0501080_0286325
970 Ga0501083_0010289
971 Ga0501083_0050086
972 Ga0501083_0165200
973 Ga0501241_005075
974 nmdc:mga05p37_47278_c1
975 nmdc:mga08y16_181617_c1
976 nmdc:mga08y16_290592_c1
977 nmdc:mga0n895_29506_c1
978 nmdc:mga0n895_567894_c1
979 nmdc:mga0rr50_62248_c1
980 nmdc:mga08x19_184723_c1
981 nmdc:mga08x19_376148_c1
982 nmdc:mga08x19_388004_c1
983 nmdc:mga08x19_57_c1
984 nmdc:mga0a205_110674_c1
985 Ga0495601_0002238
986 Ga0495595_0131887
987 Ga0495619_0052921
988 Ga0495619_0218296
989 Ga0500555_003147
990 Ga0501084_0499281
991 Ga0501082_0000166
992 Ga0501082_0016853
993 Ga0530510_0131171
994 Ga0530510_0491946
995 2673165566
996 2945927421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

69

155

0.96

PF08241

Methyltransf_11

Methyltransferase domain

70

159

0.93

PF13847

Methyltransf_31

Methyltransferase domain

67

219

0.84

PF08242

Methyltransf_12

Methyltransferase domain

70

157

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.9563 18 246
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.9288 18 246
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.8888 12 248
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.845 12 248
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8438 12 133
ID Description Score Start End Superfamily
af_Q54JJ5_11_259_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9551 6 247 3.40.50.150
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9437 18 246 3.40.50.150
af_Q9LEV6_5_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9366 8 246 3.40.50.150
af_C0HDZ4_6_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9147 10 246 3.40.50.150
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9106 18 246 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4P7DTW4-F1-model_v4 SAM-dependent methyltransferase 0.9893 1 249 GO:0008757
GO:0032259
AF-A0A2Z5SHK9-F1-model_v4 deleted 0.9882 2 248
AF-A0A7V7WI43-F1-model_v4 Class I SAM-dependent methyltransferase 0.9863 3 196 GO:0008757
GO:0032259
AF-A0A6H9L7V1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9859 4 249 GO:0008757
GO:0032259
AF-A0A4P7DTW4-F1-model_v4 SAM-dependent methyltransferase 0.9854 1 249 GO:0008757
GO:0032259

Map