F453962

General Info

Members Datasets Scaffolds Average Seq Length
490 274 448 260

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10063371|Ga0307413_100633711
Length 289
Sequence MPPRRPAMTNNSLTKTDRSNTVNDTTHVPLPSIPAMRLLDDRALRLFVILAAFFCVNAVLAEFIGVKIFALEDTLGIAPLQWNLFGQSGSLSFTAGTLLWPVVFLMTDVINEFYGRRGVRLISWLAAGLIVYGFLFAFAAISLAPAGWWIKAAESQGVADYQAAFAAVFGQGLWTIGGSLVAFIIGQLIDVAVFHRIRDVTGEKHVWLRATGSTAVSQLVDSFVVLYIAFVLGPQHWPTSLFLAVSTVNYGYKMLAAVLMIPLLYLVRRGITRYLGERRAEQLRLEAAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2643221720 Lysobacter sp. Root916 Isolate Unclassified
14 2643221727 Lysobacter sp. Root96 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
26 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
27 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
28 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
29 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
30 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
31 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
32 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
33 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
34 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
35 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
36 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
37 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
38 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
142 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
254 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
271 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
272 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
273 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
274 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.43
Metatranscriptomes 0
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0.61
Rhizoplane 3.27
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3067580 2162886007 Bacteria 1705
2 SwRhRL2b_contig_520670 2162886007 Bacteria 3262
3 JGI25151J46595_10000070 3300003187 Bacteria 139035
4 JGI25151J46595_10015538 3300003187 Bacteria 3350
5 rootH2_10064251 3300003320 Bacteria 1938
6 Ga0055526_1000036 3300003771 Bacteria 135235
7 Ga0055537_1000089 3300003773 Bacteria 66623
8 Ga0055524_1000184 3300003775 Bacteria 69474
9 Ga0055536_1001459 3300003781 Bacteria 14208
10 Ga0055536_1007118 3300003781 Bacteria 5072
11 Ga0055536_1007736 3300003781 Bacteria 4754
12 Ga0055536_1010710 3300003781 Bacteria 3600
13 Ga0055534_1000221 3300003784 Bacteria 41847
14 Ga0055528_1000004 3300003790 Bacteria 285772
15 Ga0055530_10003420 3300003791 Bacteria 9042
16 Ga0055531_10003189 3300003794 Bacteria 10536
17 Ga0055531_10008359 3300003794 Bacteria 5474
18 Ga0055531_10016462 3300003794 Bacteria 3187
19 Ga0055531_10023233 3300003794 Bacteria 2333
20 Ga0058692_1000011 3300003856 Bacteria 321321
21 Ga0058692_1000024 3300003856 Bacteria 219702
22 Ga0065704_10072059 3300005289 Bacteria 9260
23 Ga0065704_10088993 3300005289 Bacteria 2893
24 Ga0065712_10184205 3300005290 Bacteria 1178
25 Ga0065707_10081966 3300005295 Bacteria 26944
26 Ga0070670_100039849 3300005331 Bacteria 4040
27 Ga0070677_10051992 3300005333 Bacteria 1661
28 Ga0070680_100041726 3300005336 Bacteria 3721
29 Ga0070682_100194542 3300005337 Bacteria 1426
30 Ga0070660_100153677 3300005339 Bacteria 1852
31 Ga0070668_100002994 3300005347 Bacteria 12485
32 Ga0070668_100073168 3300005347 Bacteria 2672
33 Ga0070668_100483289 3300005347 Bacteria 1070
34 Ga0070669_100061670 3300005353 Bacteria 2756
35 Ga0070669_100069487 3300005353 Bacteria 2601
36 Ga0070675_100225080 3300005354 Bacteria 1635
37 Ga0070674_100112730 3300005356 Bacteria 1999
38 Ga0070678_100076731 3300005456 Bacteria 2518
39 Ga0070662_100086014 3300005457 Bacteria 2351
40 Ga0070662_100314504 3300005457 Bacteria 1275
41 Ga0068867_100017638 3300005459 Bacteria 5069
42 Ga0068867_100157471 3300005459 Bacteria 1789
43 Ga0070672_100027965 3300005543 Bacteria 4212
44 Ga0070672_100047127 3300005543 Bacteria 3344
45 Ga0070665_100041880 3300005548 Bacteria 4604
46 Ga0070665_100231431 3300005548 Bacteria 1848
47 Ga0070665_100397384 3300005548 Bacteria 1386
48 Ga0068864_100194579 3300005618 Bacteria 1860
49 Ga0068864_100536622 3300005618 Bacteria 1129
50 Ga0068866_10090484 3300005718 Bacteria 1665
51 Ga0068861_100004300 3300005719 Bacteria 9553
52 Ga0068870_10024591 3300005840 Bacteria 2981
53 Ga0068862_100023119 3300005844 Bacteria 5205
54 Ga0075364_10002507 3300006051 Bacteria 10279
55 Ga0075428_100013976 3300006844 Bacteria 8937
56 Ga0075428_100111160 3300006844 Bacteria 2985
57 Ga0075430_100003326 3300006846 Bacteria 13466
58 Ga0075430_100069643 3300006846 Bacteria 2951
59 Ga0075431_100004956 3300006847 Bacteria 13103
60 Ga0075431_100083281 3300006847 Bacteria 3302
61 Ga0075431_100217216 3300006847 Bacteria 1951
62 Ga0075429_100001381 3300006880 Bacteria 19862
63 Ga0075429_100069780 3300006880 Bacteria 3059
64 Ga0099826_10202682 3300006948 Bacteria 1084
65 Ga0105251_10000373 3300009011 Bacteria 43941
66 Ga0111539_10220640 3300009094 Bacteria 2208
67 Ga0111539_10330023 3300009094 Bacteria 1776
68 Ga0114129_10878116 3300009147 Bacteria 1138
69 Ga0105243_10008845 3300009148 Bacteria 7711
70 Ga0105243_10009285 3300009148 Bacteria 7503
71 Ga0105242_10114572 3300009176 Bacteria 2304
72 Ga0105242_10283786 3300009176 Unclassified 1505
73 Ga0105249_10732220 3300009553 Bacteria 1050
74 Ga0105246_10437480 3300011119 Bacteria 1096
75 Ga0157371_10043902 3300013102 Bacteria 3183
76 Ga0157371_10099438 3300013102 Bacteria 2063
77 Ga0157371_10282018 3300013102 Bacteria 1200
78 Ga0157370_10177545 3300013104 Bacteria 1979
79 Ga0157369_10059487 3300013105 Bacteria 4120
80 Ga0157369_10123399 3300013105 Bacteria 2747
81 Ga0157378_10269447 3300013297 Unclassified 1637
82 Ga0157372_10079996 3300013307 Bacteria 3697
83 Ga0157375_10181310 3300013308 Unclassified 2257
84 Ga0157375_10194425 3300013308 Bacteria 2184
85 Ga0157380_10006337 3300014326 Bacteria 8319
86 Ga0157380_10181917 3300014326 Bacteria 1848
87 Ga0157380_10199114 3300014326 Bacteria 1775
88 Ga0182008_10000045 3300014497 Bacteria 114620
89 Ga0157376_10084939 3300014969 Bacteria 2726
90 Ga0182006_1014762 3300015261 Bacteria 3360
91 Ga0182005_1001536 3300015265 Bacteria 9175
92 Ga0183360_10001 3300015689 Bacteria 3943671
93 Ga0163161_10082115 3300017792 Bacteria 2374
94 Ga0163161_10159488 3300017792 Bacteria 1720
95 Ga0163161_10231065 3300017792 Bacteria 1435
96 Ga0163161_10292656 3300017792 Bacteria 1280
97 Ga0163161_10418814 3300017792 Bacteria 1077
98 Ga0209565_1000001 3300025263 Bacteria 2950419
99 Ga0209565_1009859 3300025263 Bacteria 2393
100 Ga0209673_1000001 3300025273 Bacteria 3176258
101 Ga0209675_1000001 3300025291 Bacteria 2950293
102 Ga0209675_1007518 3300025291 Bacteria 4164
103 Ga0209675_1010623 3300025291 Bacteria 3125
104 Ga0209676_1000027 3300025292 Bacteria 560222
105 Ga0209676_1000117 3300025292 Bacteria 203251
106 Ga0209676_1001190 3300025292 Bacteria 28007
107 Ga0209676_1005724 3300025292 Bacteria 6383
108 Ga0209676_1005812 3300025292 Bacteria 6309
109 Ga0209676_1011124 3300025292 Bacteria 3663
110 Ga0209676_1012711 3300025292 Bacteria 3282
111 Ga0209025_1000015 3300025294 Bacteria 808120
112 Ga0209025_1001970 3300025294 Bacteria 23591
113 Ga0209025_1011451 3300025294 Bacteria 5839
114 Ga0209025_1032260 3300025294 Bacteria 2453
115 Ga0209025_1074294 3300025294 Bacteria 1188
116 Ga0209564_1000001 3300025295 Bacteria 3176258
117 Ga0209564_1005004 3300025295 Bacteria 7786
118 Ga0209564_1021256 3300025295 Bacteria 2341
119 Ga0209758_1042717 3300025297 Bacteria 1678
120 Ga0209050_1002371 3300025298 Bacteria 16372
121 Ga0209050_1014045 3300025298 Bacteria 3489
122 Ga0209050_1020065 3300025298 Bacteria 2504
123 Ga0209256_1000002 3300025299 Bacteria 1906740
124 Ga0209256_1002243 3300025299 Bacteria 16442
125 Ga0209256_1008409 3300025299 Bacteria 4793
126 Ga0209256_1009434 3300025299 Bacteria 4281
127 Ga0209257_1000148 3300025304 Bacteria 193131
128 Ga0209257_1000325 3300025304 Bacteria 99936
129 Ga0209257_1000349 3300025304 Bacteria 95064
130 Ga0209257_1000828 3300025304 Bacteria 44672
131 Ga0209257_1002788 3300025304 Bacteria 16480
132 Ga0209257_1010666 3300025304 Bacteria 4593
133 Ga0207713_1000690 3300025735 Bacteria 31690
134 Ga0207682_10082854 3300025893 Bacteria 1378
135 Ga0207642_10074765 3300025899 Bacteria 1625
136 Ga0207645_10009780 3300025907 Bacteria 6619
137 Ga0207643_10017081 3300025908 Bacteria 3962
138 Ga0207705_10208443 3300025909 Bacteria 1482
139 Ga0207660_10311786 3300025917 Bacteria 1255
140 Ga0207652_10023051 3300025921 Bacteria 5157
141 Ga0207652_10451081 3300025921 Bacteria 1159
142 Ga0207681_10051354 3300025923 Bacteria 2793
143 Ga0207650_10005213 3300025925 Bacteria 8865
144 Ga0207650_10478659 3300025925 Bacteria 1039
145 Ga0207644_10012209 3300025931 Bacteria 5700
146 Ga0207706_10011415 3300025933 Bacteria 8092
147 Ga0207686_10111488 3300025934 Bacteria 1846
148 Ga0207709_10001757 3300025935 Bacteria 14589
149 Ga0207709_10005894 3300025935 Bacteria 6917
150 Ga0207704_10185120 3300025938 Bacteria 1509
151 Ga0207691_10038300 3300025940 Bacteria 4436
152 Ga0207691_10201642 3300025940 Bacteria 1731
153 Ga0207689_10039715 3300025942 Bacteria 3895
154 Ga0207668_10040463 3300025972 Bacteria 3145
155 Ga0207668_10110269 3300025972 Bacteria 2063
156 Ga0207708_10063418 3300026075 Bacteria 2823
157 Ga0207708_10522115 3300026075 Bacteria 998
158 Ga0207648_10135354 3300026089 Bacteria 2170
159 Ga0207676_10510415 3300026095 Bacteria 1143
160 Ga0207675_100008659 3300026118 Bacteria 9566
161 Ga0207683_10051641 3300026121 Bacteria 3602
162 Ga0209371_1000007 3300027312 Bacteria 1050654
163 Ga0209371_1000016 3300027312 Bacteria 646301
164 Ga0210002_1008633 3300027617 Bacteria 1553
165 Ga0209983_1004722 3300027665 Bacteria 2849
166 Ga0209282_1183167 3300027666 Bacteria 980
167 Ga0209971_1001107 3300027682 Bacteria 6838
168 Ga0209971_1021174 3300027682 Bacteria 1547
169 Ga0209974_10003699 3300027876 Bacteria 5495
170 Ga0207428_10065754 3300027907 Bacteria 2859
171 Ga0268265_10313381 3300028380 Bacteria 1418
172 Ga0307515_10003654 3300028794 Bacteria 32330
173 Ga0268256_1000008 3300030500 Bacteria 1050654
174 Ga0268256_1000015 3300030500 Bacteria 646300
175 Ga0314311_1026358 3300030733 Bacteria 3012
176 Ga0316180_1091959 3300030736 Bacteria 1524
177 Ga0307513_10045777 3300031456 Bacteria 4778
178 Ga0307513_10047554 3300031456 Bacteria 4665
179 Ga0307509_10000229 3300031507 Bacteria 90514
180 Ga0307408_100127521 3300031548 Bacteria 1981
181 Ga0307408_100154098 3300031548 Bacteria 1817
182 Ga0307508_10173593 3300031616 Bacteria 1759
183 Ga0316579_10023667 3300031691 Bacteria 2759
184 Ga0316576_10004717 3300031727 Bacteria 8224
185 Ga0316576_10015733 3300031727 Bacteria 5085
186 Ga0316576_10022373 3300031727 Bacteria 4388
187 Ga0316578_10001021 3300031728 Bacteria 10737
188 Ga0307405_10035678 3300031731 Bacteria 2972
189 Ga0316577_10009574 3300031733 Bacteria 5215
190 Ga0307413_10006869 3300031824 Bacteria 5237
191 Ga0307413_10063371 3300031824 Bacteria 2292
192 Ga0307413_10071699 3300031824 Bacteria 2184
193 Ga0307413_10514044 3300031824 Bacteria 964
194 Ga0307406_10001915 3300031901 Bacteria 11328
195 Ga0307407_10013415 3300031903 Bacteria 3977
196 Ga0307407_10041722 3300031903 Bacteria 2568
197 Ga0307412_10013077 3300031911 Bacteria 4855
198 Ga0307412_10085591 3300031911 Bacteria 2191
199 Ga0307412_10268438 3300031911 Bacteria 1334
200 Ga0307412_10439822 3300031911 Bacteria 1071
201 Ga0307409_100007165 3300031995 Bacteria 6643
202 Ga0307409_100072782 3300031995 Bacteria 2738
203 Ga0307409_100158756 3300031995 Bacteria 1974
204 Ga0307416_100053226 3300032002 Bacteria 3246
205 Ga0307416_100798324 3300032002 Bacteria 1039
206 Ga0307414_10006562 3300032004 Bacteria 6495
207 Ga0307414_10020752 3300032004 Bacteria 4102
208 Ga0307414_10028223 3300032004 Bacteria 3637
209 Ga0307414_10030074 3300032004 Bacteria 3544
210 Ga0307414_10045905 3300032004 Bacteria 2994
211 Ga0307414_10087495 3300032004 Bacteria 2302
212 Ga0307414_10347931 3300032004 Bacteria 1271
213 Ga0307411_10002279 3300032005 Bacteria 8398
214 Ga0307411_10023352 3300032005 Bacteria 3661
215 Ga0307411_10145779 3300032005 Bacteria 1752
216 Ga0307411_10173036 3300032005 Bacteria 1630
217 Ga0307411_10188453 3300032005 Bacteria 1573
218 Ga0307411_10686735 3300032005 Bacteria 890
219 Ga0307415_100016487 3300032126 Bacteria 4407
220 Ga0307415_100300347 3300032126 Bacteria 1330
221 Ga0316585_10013088 3300032137 Bacteria 2468
222 Ga0316574_0000008 3300035398 Bacteria 48126
223 Ga0316574_0006890 3300035398 Bacteria 6182
224 Ga0316574_0062138 3300035398 Bacteria 2347
225 Ga0316584_0024567 3300036712 Bacteria 4411
226 Ga0395899_0052345 3300037312 Bacteria 3027
227 Ga0395900_0056989 3300037418 Bacteria 4022
228 Ga0395905_0000630 3300037471 Bacteria 47216
229 Ga0395905_0038623 3300037471 Bacteria 4479
230 Ga0395905_0133704 3300037471 Bacteria 2333
231 Ga0395905_0415854 3300037471 Bacteria 1240
232 Ga0395901_0087365 3300038443 Bacteria 3260
233 Ga0395901_0350419 3300038443 Bacteria 1524
234 Ga0237816_00247 3300039145 Bacteria 4514
235 Ga0439436_0008692 3300041404 Bacteria 3122
236 Ga0439436_0016988 3300041404 Bacteria 2179
237 Ga0439436_0025422 3300041404 Bacteria 1739
238 Ga0439436_0026453 3300041404 Bacteria 1701
239 Ga0439439_0007696 3300041406 Bacteria 2524
240 Ga0439465_0000252 3300041413 Bacteria 14694
241 Ga0439465_0000583 3300041413 Bacteria 11006
242 Ga0439465_0002285 3300041413 Bacteria 6297
243 Ga0439465_0017457 3300041413 Bacteria 2240
244 Ga0451787_842899 3300041441 Bacteria 1163
245 Ga0451789_0365576 3300041443 Bacteria 920
246 Ga0451791_1014610 3300041451 Bacteria 2740
247 Ga0451791_1616238 3300041451 Bacteria 1803
248 Ga0451797_0679444 3300041453 Bacteria 1951
249 Ga0451797_1447564 3300041453 Bacteria 1591
250 Ga0451800_0955444 3300041459 Bacteria 2596
251 Ga0451806_288496 3300041462 Bacteria 2384
252 Ga0451807_0225613 3300041486 Bacteria 2467
253 Ga0451807_1641294 3300041486 Bacteria 3334
254 Ga0451837_0369857 3300041494 Bacteria 1861
255 Ga0451853_2393446 3300041512 Bacteria 1429
256 Ga0439432_004661 3300042006 Bacteria 4994
257 Ga0439432_073648 3300042006 Bacteria 1039
258 Ga0439449_0001104 3300042007 Bacteria 10612
259 Ga0439449_0010040 3300042007 Bacteria 3581
260 Ga0439449_0012527 3300042007 Bacteria 3189
261 Ga0450896_001798 3300042133 Bacteria 2703
262 Ga0439446_0068500 3300042156 Bacteria 1082
263 Ga0439434_0001266 3300042435 Bacteria 7266
264 Ga0439435_0000429 3300042436 Bacteria 6567
265 Ga0450901_003710 3300042533 Bacteria 1591
266 Ga0451577_0003782 3300042876 Bacteria 16481
267 Ga0451577_0006451 3300042876 Bacteria 11695
268 Ga0451577_0018134 3300042876 Bacteria 6486
269 Ga0451577_0154026 3300042876 Bacteria 2068
270 Ga0451577_0177103 3300042876 Bacteria 1922
271 Ga0453683_0018973 3300044673 Bacteria 4411
272 Ga0453684_0000615 3300044712 Bacteria 130336
273 Ga0453684_0136753 3300044712 Bacteria 2932
274 Ga0453684_0188614 3300044712 Bacteria 2413
275 Ga0453684_0712935 3300044712 Bacteria 1089
276 Ga0453684_0743567 3300044712 Bacteria 1062
277 Ga0451576_0000632 3300045051 Bacteria 73171
278 Ga0451576_0141923 3300045051 Bacteria 2504
279 Ga0495638_0001513 3300046460 Bacteria 20923
280 Ga0495638_0009524 3300046460 Bacteria 6810
281 Ga0495607_0098547 3300046501 Bacteria 1569
282 Ga0495663_0000599 3300046525 Bacteria 12590
283 Ga0495663_0000673 3300046525 Bacteria 11816
284 Ga0495633_0002463 3300046558 Bacteria 13065
285 Ga0495656_0013697 3300046615 Bacteria 3023
286 Ga0495656_0069256 3300046615 Bacteria 1562
287 Ga0495668_0002228 3300046616 Bacteria 16436
288 Ga0495659_0022493 3300046664 Bacteria 2134
289 Ga0495636_0003876 3300047318 Bacteria 5835
290 Ga0495636_0007601 3300047318 Bacteria 4267
291 Ga0495672_0054206 3300047320 Bacteria 2345
292 Ga0495680_0134905 3300047322 Unclassified 1810
293 Ga0495686_0138608 3300047472 Bacteria 1437
294 Ga0496100_0134859 3300048903 Bacteria 1743
295 Ga0496108_0013046 3300048911 Bacteria 6772
296 Ga0496109_0269575 3300048912 Bacteria 1604
297 Ga0496110_0077800 3300048913 Bacteria 2952
298 Ga0496113_0019860 3300048916 Bacteria 4710
299 Ga0496114_0010174 3300048917 Bacteria 7483
300 Ga0496116_0003837 3300048919 Bacteria 14683
301 Ga0496117_0000476 3300048920 Bacteria 66684
302 Ga0496117_0001999 3300048920 Bacteria 27010
303 Ga0496117_0005376 3300048920 Bacteria 13485
304 Ga0496118_0000403 3300048921 Bacteria 72390
305 Ga0496118_0000404 3300048921 Bacteria 72202
306 Ga0496118_0029335 3300048921 Bacteria 4615
307 Ga0496118_0091768 3300048921 Bacteria 2087
308 Ga0496118_0113381 3300048921 Bacteria 1791
309 Ga0496119_0012167 3300048922 Bacteria 7021
310 Ga0496120_0000650 3300048923 Bacteria 51092
311 Ga0496121_0000678 3300048924 Bacteria 63439
312 Ga0496121_0001428 3300048924 Bacteria 40363
313 Ga0496121_0008448 3300048924 Bacteria 12103
314 Ga0496121_0039788 3300048924 Bacteria 4135
315 Ga0496122_0000209 3300048925 Bacteria 130440
316 Ga0496122_0004763 3300048925 Bacteria 16612
317 Ga0496122_0009509 3300048925 Bacteria 10225
318 Ga0496122_0187804 3300048925 Bacteria 1223
319 Ga0496123_0000106 3300048926 Bacteria 167799
320 Ga0496123_0004320 3300048926 Bacteria 15078
321 Ga0496123_0021135 3300048926 Bacteria 5067
322 Ga0496123_0093058 3300048926 Bacteria 1781
323 Ga0496124_0000032 3300048927 Bacteria 332524
324 Ga0496124_0012502 3300048927 Bacteria 8371
325 Ga0496124_0021941 3300048927 Bacteria 5872
326 Ga0496124_0275152 3300048927 Bacteria 1231
327 Ga0496125_0001440 3300048928 Bacteria 34598
328 Ga0496126_0008822 3300048929 Bacteria 10812
329 Ga0496126_0432311 3300048929 Bacteria 1062
330 Ga0501290_006530 3300049513 Bacteria 1461
331 Ga0501031_0047638 3300049568 Bacteria 2794
332 Ga0501031_0147618 3300049568 Bacteria 1536
333 Ga0501032_0011594 3300049569 Bacteria 6321
334 Ga0501032_0017311 3300049569 Bacteria 5060
335 Ga0501032_0218093 3300049569 Bacteria 1242
336 Ga0501033_0033311 3300049570 Bacteria 3868
337 Ga0501033_0044398 3300049570 Bacteria 3309
338 Ga0501033_0178324 3300049570 Bacteria 1524
339 Ga0501034_0000272 3300049571 Bacteria 93316
340 Ga0501034_0054250 3300049571 Bacteria 4035
341 Ga0501034_0139609 3300049571 Bacteria 2403
342 Ga0501034_0245936 3300049571 Bacteria 1734
343 Ga0501036_0001010 3300049572 Bacteria 21212
344 Ga0501036_0010164 3300049572 Bacteria 7756
345 Ga0501036_0011325 3300049572 Bacteria 7381
346 Ga0501036_0328080 3300049572 Bacteria 1279
347 Ga0501037_0002559 3300049573 Bacteria 13147
348 Ga0501037_0173070 3300049573 Bacteria 1534
349 Ga0501037_0184838 3300049573 Bacteria 1478
350 Ga0501038_0006795 3300049574 Bacteria 10566
351 Ga0501038_0016295 3300049574 Bacteria 6739
352 Ga0501038_0295760 3300049574 Bacteria 1271
353 Ga0501039_0019767 3300049575 Bacteria 5163
354 Ga0501039_0021204 3300049575 Bacteria 4985
355 Ga0501039_0094754 3300049575 Bacteria 2327
356 Ga0501040_0006933 3300049576 Bacteria 7336
357 Ga0501040_0011047 3300049576 Bacteria 5903
358 Ga0501040_0133192 3300049576 Bacteria 1748
359 Ga0501040_0194253 3300049576 Bacteria 1441
360 Ga0501041_0004292 3300049577 Bacteria 8249
361 Ga0501041_0005242 3300049577 Bacteria 7573
362 Ga0501041_0016955 3300049577 Bacteria 4334
363 Ga0501041_0023752 3300049577 Bacteria 3676
364 Ga0501041_0136550 3300049577 Bacteria 1528
365 Ga0501042_0003372 3300049578 Bacteria 10018
366 Ga0501042_0011266 3300049578 Bacteria 6028
367 Ga0501042_0289628 3300049578 Bacteria 1183
368 Ga0501043_0001655 3300049579 Bacteria 19357
369 Ga0501043_0045388 3300049579 Bacteria 3456
370 Ga0501043_0097522 3300049579 Bacteria 2311
371 Ga0501046_0005663 3300049580 Bacteria 11150
372 Ga0501046_0010781 3300049580 Bacteria 7837
373 Ga0501046_0037626 3300049580 Bacteria 3888
374 Ga0501047_0045909 3300049581 Bacteria 4223
375 Ga0501048_0006164 3300049582 Bacteria 9130
376 Ga0501048_0016986 3300049582 Bacteria 5363
377 Ga0501068_0005879 3300049584 Bacteria 6733
378 Ga0501068_0009637 3300049584 Bacteria 5408
379 Ga0501069_0036000 3300049585 Bacteria 2728
380 Ga0501069_0157809 3300049585 Bacteria 1306
381 Ga0501070_0055950 3300049586 Bacteria 3270
382 Ga0501071_0001892 3300049587 Bacteria 12444
383 Ga0501071_0046877 3300049587 Bacteria 3104
384 Ga0501071_0055659 3300049587 Bacteria 2856
385 Ga0501072_0000891 3300049588 Bacteria 21917
386 Ga0501072_0002249 3300049588 Bacteria 14417
387 Ga0501072_0073626 3300049588 Bacteria 2700
388 Ga0501072_0143410 3300049588 Bacteria 1905
389 Ga0501073_0229764 3300049589 Bacteria 1282
390 Ga0501074_0036543 3300049590 Bacteria 3558
391 Ga0501074_0054534 3300049590 Bacteria 2882
392 Ga0501075_0005471 3300049591 Bacteria 8684
393 Ga0501075_0011417 3300049591 Bacteria 6287
394 Ga0501075_0013776 3300049591 Bacteria 5779
395 Ga0501075_0035751 3300049591 Bacteria 3706
396 Ga0501076_0008622 3300049592 Bacteria 7479
397 Ga0501076_0009544 3300049592 Bacteria 7163
398 Ga0501076_0058633 3300049592 Bacteria 3061
399 Ga0501076_0101054 3300049592 Bacteria 2324
400 Ga0501076_0183435 3300049592 Bacteria 1706
401 Ga0501077_0005933 3300049593 Bacteria 7456
402 Ga0501077_0042088 3300049593 Bacteria 2906
403 Ga0501077_0137901 3300049593 Bacteria 1547
404 Ga0501216_012121 3300049660 Bacteria 1411
405 Ga0501235_038619 3300049669 Bacteria 1089
406 Ga0501257_033614 3300049686 Bacteria 1243
407 Ga0501079_0010407 3300049741 Bacteria 7071
408 Ga0501079_0235226 3300049741 Bacteria 1431
409 Ga0501079_0248418 3300049741 Bacteria 1390
410 Ga0501080_0007375 3300049742 Bacteria 9924
411 Ga0501080_0189668 3300049742 Bacteria 1889
412 Ga0501081_0000960 3300049743 Bacteria 17148
413 Ga0501081_0051482 3300049743 Bacteria 2840
414 Ga0501081_0081136 3300049743 Bacteria 2272
415 Ga0501083_0021341 3300049744 Bacteria 4500
416 Ga0501274_002353 3300049771 Bacteria 1480
417 Ga0501275_000074 3300049772 Bacteria 10065
418 Ga0501035_0090162 3300049822 Bacteria 2699
419 Ga0501035_0101563 3300049822 Bacteria 2523
420 Ga0501044_0054350 3300049823 Bacteria 4117
421 Ga0501044_0074726 3300049823 Bacteria 3442
422 Ga0501044_0822817 3300049823 Bacteria 807
423 Ga0501045_0001854 3300049824 Bacteria 14301
424 Ga0501045_0008480 3300049824 Bacteria 7164
425 Ga0501045_0076644 3300049824 Bacteria 2464
426 nmdc:mga00v17_1411_c1 3300050491 Bacteria 12608
427 nmdc:mga09592_7895_c1 3300050508 Bacteria 8650
428 nmdc:mga0qj67_256314_c1 3300050509 Bacteria 1419
429 nmdc:mga06r32_31079_c1 3300050510 Bacteria 5013
430 nmdc:mga06r32_318313_c1 3300050510 Bacteria 1541
431 nmdc:mga06r32_745_c1 3300050510 Bacteria 28580
432 nmdc:mga08y16_273324_c1 3300050511 Bacteria 1744
433 Ga0500658_0111352 3300053134 Bacteria 1205
434 Ga0500616_0042596 3300053153 Bacteria 2431
435 Ga0500622_0029474 3300053156 Bacteria 2886
436 Ga0501084_0123837 3300054114 Bacteria 2174
437 Ga0501084_0297319 3300054114 Bacteria 1363
438 Ga0501084_0318403 3300054114 Bacteria 1314
439 Ga0590071_037628 3300059421 Bacteria 1162
440 Ga0501082_0020786 3300060353 Bacteria 5660
441 Ga0501082_0058563 3300060353 Bacteria 3319
442 Ga0501082_0070815 3300060353 Bacteria 3002
443 Ga0501082_0081399 3300060353 Bacteria 2794
444 Ga0501082_0128170 3300060353 Bacteria 2201
445 Ga0530510_0001701 3300061734 Bacteria 14933
446 Ga0530510_0033416 3300061734 Bacteria 3703
447 Ga0530510_0074465 3300061734 Bacteria 2465
448 Ga0530510_0099588 3300061734 Bacteria 2125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10023051 Ga0207652_100230512 217
2 3300037471 Ga0395905_0038623 Ga0395905_0038623_306_1121 222
3 3300049771 Ga0501274_002353 Ga0501274_002353_763_1467 222
4 3300049742 Ga0501080_0189668 Ga0501080_0189668_529_1326 225
5 3300049743 Ga0501081_0081136 Ga0501081_0081136_595_1395 225
6 3300049568 Ga0501031_0147618 Ga0501031_0147618_656_1456 226
7 3300049577 Ga0501041_0136550 Ga0501041_0136550_500_1300 226
8 3300049587 Ga0501071_0055659 Ga0501071_0055659_871_1671 226
9 3300049588 Ga0501072_0143410 Ga0501072_0143410_190_990 226
10 3300049592 Ga0501076_0058633 Ga0501076_0058633_849_1649 226
11 3300049824 Ga0501045_0076644 Ga0501045_0076644_526_1326 226
12 3300061734 Ga0530510_0099588 Ga0530510_0099588_177_977 226
13 3300028794 Ga0307515_10003654 Ga0307515_100036549 229
14 3300031456 Ga0307513_10045777 Ga0307513_100457772 229
15 3300049569 Ga0501032_0017311 Ga0501032_0017311_1051_1851 229
16 3300049572 Ga0501036_0001010 Ga0501036_0001010_2865_3665 229
17 3300049575 Ga0501039_0094754 Ga0501039_0094754_629_1429 229
18 3300049577 Ga0501041_0016955 Ga0501041_0016955_1201_2001 229
19 3300049585 Ga0501069_0036000 Ga0501069_0036000_1729_2529 229
20 3300049587 Ga0501071_0046877 Ga0501071_0046877_278_1078 229
21 3300049588 Ga0501072_0073626 Ga0501072_0073626_89_889 229
22 3300049591 Ga0501075_0013776 Ga0501075_0013776_3575_4375 229
23 3300049592 Ga0501076_0008622 Ga0501076_0008622_2897_3697 229
24 3300049741 Ga0501079_0248418 Ga0501079_0248418_357_1157 229
25 3300049823 Ga0501044_0054350 Ga0501044_0054350_3113_3913 229
26 3300054114 Ga0501084_0318403 Ga0501084_0318403_215_1015 229
27 3300060353 Ga0501082_0070815 Ga0501082_0070815_2005_2805 229
28 3300061734 Ga0530510_0033416 Ga0530510_0033416_1971_2771 229
29 3300046460 Ga0495638_0009524 Ga0495638_0009524_4761_5495 230
30 3300049582 Ga0501048_0016986 Ga0501048_0016986_2280_3080 230
31 3300047472 Ga0495686_0138608 Ga0495686_0138608_687_1418 231
32 3300049572 Ga0501036_0328080 Ga0501036_0328080_103_903 232
33 3300049578 Ga0501042_0289628 Ga0501042_0289628_95_895 232
34 3300031911 Ga0307412_10268438 Ga0307412_102684382 233
35 3300032004 Ga0307414_10347931 Ga0307414_103479312 233
36 3300049592 Ga0501076_0101054 Ga0501076_0101054_678_1478 234
37 3300049741 Ga0501079_0235226 Ga0501079_0235226_53_853 234
38 3300049743 Ga0501081_0051482 Ga0501081_0051482_855_1655 234
39 3300049823 Ga0501044_0822817 Ga0501044_0822817_34_774 234
40 3300031548 Ga0307408_100127521 Ga0307408_1001275212 235
41 3300032002 Ga0307416_100798324 Ga0307416_1007983242 235
42 3300042156 Ga0439446_0068500 Ga0439446_0068500_74_871 235
43 3300005290 Ga0065712_10184205 Ga0065712_101842051 236
44 3300005459 Ga0068867_100157471 Ga0068867_1001574712 236
45 3300005543 Ga0070672_100047127 Ga0070672_1000471273 236
46 3300025938 Ga0207704_10185120 Ga0207704_101851202 236
47 3300025940 Ga0207691_10201642 Ga0207691_102016422 236
48 3300025942 Ga0207689_10039715 Ga0207689_100397153 236
49 3300026089 Ga0207648_10135354 Ga0207648_101353542 236
50 3300027682 Ga0209971_1021174 Ga0209971_10211742 236
51 3300031731 Ga0307405_10035678 Ga0307405_100356782 236
52 3300031824 Ga0307413_10006869 Ga0307413_100068695 236
53 3300031903 Ga0307407_10013415 Ga0307407_100134153 236
54 3300031903 Ga0307407_10041722 Ga0307407_100417221 236
55 3300031911 Ga0307412_10439822 Ga0307412_104398222 236
56 3300031995 Ga0307409_100072782 Ga0307409_1000727823 236
57 3300031995 Ga0307409_100158756 Ga0307409_1001587562 236
58 3300032002 Ga0307416_100053226 Ga0307416_1000532261 236
59 3300032005 Ga0307411_10002279 Ga0307411_1000227910 236
60 3300032005 Ga0307411_10145779 Ga0307411_101457793 236
61 3300032005 Ga0307411_10686735 Ga0307411_106867351 236
62 3300032126 Ga0307415_100016487 Ga0307415_1000164873 236
63 3300042133 Ga0450896_001798 Ga0450896_001798_215_1015 236
64 3300042435 Ga0439434_0001266 Ga0439434_0001266_4261_5061 236
65 3300042436 Ga0439435_0000429 Ga0439435_0000429_2335_3135 236
66 3300049513 Ga0501290_006530 Ga0501290_006530_411_1181 237
67 3300049772 Ga0501275_000074 Ga0501275_000074_2193_2963 237
68 3300005336 Ga0070680_100041726 Ga0070680_1000417262 238
69 3300005347 Ga0070668_100483289 Ga0070668_1004832891 238
70 3300005353 Ga0070669_100069487 Ga0070669_1000694872 238
71 3300005356 Ga0070674_100112730 Ga0070674_1001127302 238
72 3300005457 Ga0070662_100086014 Ga0070662_1000860143 238
73 3300005459 Ga0068867_100017638 Ga0068867_1000176382 238
74 3300005543 Ga0070672_100027965 Ga0070672_1000279652 238
75 3300005718 Ga0068866_10090484 Ga0068866_100904843 238
76 3300005840 Ga0068870_10024591 Ga0068870_100245914 238
77 3300005844 Ga0068862_100023119 Ga0068862_1000231197 238
78 3300006844 Ga0075428_100111160 Ga0075428_1001111603 238
79 3300006846 Ga0075430_100069643 Ga0075430_1000696432 238
80 3300006847 Ga0075431_100083281 Ga0075431_1000832813 238
81 3300006880 Ga0075429_100069780 Ga0075429_1000697801 238
82 3300009094 Ga0111539_10330023 Ga0111539_103300233 238
83 3300009176 Ga0105242_10114572 Ga0105242_101145723 238
84 3300009553 Ga0105249_10732220 Ga0105249_107322202 238
85 3300013308 Ga0157375_10194425 Ga0157375_101944252 238
86 3300014326 Ga0157380_10181917 Ga0157380_101819172 238
87 3300017792 Ga0163161_10292656 Ga0163161_102926562 238
88 3300025899 Ga0207642_10074765 Ga0207642_100747652 238
89 3300025907 Ga0207645_10009780 Ga0207645_100097802 238
90 3300025908 Ga0207643_10017081 Ga0207643_100170815 238
91 3300025917 Ga0207660_10311786 Ga0207660_103117861 238
92 3300025933 Ga0207706_10011415 Ga0207706_100114155 238
93 3300025934 Ga0207686_10111488 Ga0207686_101114881 238
94 3300025940 Ga0207691_10038300 Ga0207691_100383002 238
95 3300026075 Ga0207708_10063418 Ga0207708_100634181 238
96 3300026075 Ga0207708_10522115 Ga0207708_105221152 238
97 3300027617 Ga0210002_1008633 Ga0210002_10086331 238
98 3300027665 Ga0209983_1004722 Ga0209983_10047222 238
99 3300027682 Ga0209971_1001107 Ga0209971_10011075 238
100 3300027876 Ga0209974_10003699 Ga0209974_100036992 238
101 3300027907 Ga0207428_10065754 Ga0207428_100657542 238
102 3300032126 Ga0307415_100300347 Ga0307415_1003003472 238
103 3300044712 Ga0453684_0000615 Ga0453684_0000615_104607_105374 238
104 3300045051 Ga0451576_0000632 Ga0451576_0000632_24963_25730 238
105 3300049570 Ga0501033_0178324 Ga0501033_0178324_373_1218 238
106 3300050510 nmdc:mga06r32_31079_c1 nmdc:mga06r32_31079_c1_843_1607 238
107 3300050511 nmdc:mga08y16_273324_c1 nmdc:mga08y16_273324_c1_265_1029 238
108 3300046615 Ga0495656_0013697 Ga0495656_0013697_1591_2382 239
109 3300053156 Ga0500622_0029474 Ga0500622_0029474_1278_2033 239
110 3300005354 Ga0070675_100225080 Ga0070675_1002250803 240
111 3300005618 Ga0068864_100194579 Ga0068864_1001945792 240
112 3300009147 Ga0114129_10878116 Ga0114129_108781161 240
113 3300014326 Ga0157380_10199114 Ga0157380_101991142 240
114 3300026095 Ga0207676_10510415 Ga0207676_105104151 240
115 3300028380 Ga0268265_10313381 Ga0268265_103133812 240
116 3300031691 Ga0316579_10023667 Ga0316579_100236672 240
117 3300031727 Ga0316576_10004717 Ga0316576_100047172 240
118 3300031727 Ga0316576_10015733 Ga0316576_100157333 240
119 3300031727 Ga0316576_10022373 Ga0316576_100223732 240
120 3300031728 Ga0316578_10001021 Ga0316578_100010219 240
121 3300031733 Ga0316577_10009574 Ga0316577_100095744 240
122 3300032137 Ga0316585_10013088 Ga0316585_100130883 240
123 3300035398 Ga0316574_0000008 Ga0316574_0000008_11336_12106 240
124 3300035398 Ga0316574_0006890 Ga0316574_0006890_4111_4881 240
125 3300036712 Ga0316584_0024567 Ga0316584_0024567_684_1454 240
126 3300042876 Ga0451577_0006451 Ga0451577_0006451_6826_7596 240
127 3300042876 Ga0451577_0018134 Ga0451577_0018134_196_966 240
128 3300042876 Ga0451577_0177103 Ga0451577_0177103_462_1232 240
129 3300044673 Ga0453683_0018973 Ga0453683_0018973_112_882 240
130 3300044712 Ga0453684_0136753 Ga0453684_0136753_1285_2055 240
131 3300044712 Ga0453684_0188614 Ga0453684_0188614_1443_2213 240
132 3300044712 Ga0453684_0712935 Ga0453684_0712935_16_786 240
133 3300045051 Ga0451576_0141923 Ga0451576_0141923_269_1039 240
134 3300050509 nmdc:mga0qj67_256314_c1 nmdc:mga0qj67_256314_c1_549_1337 240
135 3300005353 Ga0070669_100061670 Ga0070669_1000616704 241
136 3300005548 Ga0070665_100041880 Ga0070665_1000418803 241
137 3300005548 Ga0070665_100397384 Ga0070665_1003973841 241
138 3300006847 Ga0075431_100217216 Ga0075431_1002172162 241
139 3300009176 Ga0105242_10283786 Ga0105242_102837862 241
140 3300013297 Ga0157378_10269447 Ga0157378_102694472 241
141 3300013308 Ga0157375_10181310 Ga0157375_101813102 241
142 3300017792 Ga0163161_10418814 Ga0163161_104188141 241
143 3300025923 Ga0207681_10051354 Ga0207681_100513544 241
144 3300031824 Ga0307413_10514044 Ga0307413_105140441 241
145 3300031995 Ga0307409_100007165 Ga0307409_1000071653 241
146 3300042876 Ga0451577_0154026 Ga0451577_0154026_314_1087 241
147 3300047320 Ga0495672_0054206 Ga0495672_0054206_1121_1948 241
148 3300048913 Ga0496110_0077800 Ga0496110_0077800_1659_2426 241
149 3300049568 Ga0501031_0047638 Ga0501031_0047638_746_1549 241
150 3300049569 Ga0501032_0011594 Ga0501032_0011594_2481_3284 241
151 3300049569 Ga0501032_0218093 Ga0501032_0218093_12_815 241
152 3300049570 Ga0501033_0044398 Ga0501033_0044398_1367_2170 241
153 3300049571 Ga0501034_0054250 Ga0501034_0054250_1803_2606 241
154 3300049571 Ga0501034_0139609 Ga0501034_0139609_569_1372 241
155 3300049571 Ga0501034_0245936 Ga0501034_0245936_588_1370 241
156 3300049572 Ga0501036_0010164 Ga0501036_0010164_3855_4658 241
157 3300049573 Ga0501037_0002559 Ga0501037_0002559_3089_3892 241
158 3300049574 Ga0501038_0006795 Ga0501038_0006795_3015_3818 241
159 3300049575 Ga0501039_0019767 Ga0501039_0019767_3497_4300 241
160 3300049579 Ga0501043_0045388 Ga0501043_0045388_1059_1862 241
161 3300049581 Ga0501047_0045909 Ga0501047_0045909_1173_1976 241
162 3300049586 Ga0501070_0055950 Ga0501070_0055950_67_870 241
163 3300049593 Ga0501077_0137901 Ga0501077_0137901_568_1371 241
164 3300049742 Ga0501080_0007375 Ga0501080_0007375_3127_3930 241
165 3300049822 Ga0501035_0090162 Ga0501035_0090162_737_1540 241
166 3300049823 Ga0501044_0074726 Ga0501044_0074726_619_1422 241
167 3300050510 nmdc:mga06r32_318313_c1 nmdc:mga06r32_318313_c1_507_1310 241
168 3300059421 Ga0590071_037628 Ga0590071_037628_263_1030 241
169 iso_pu_bacteria 2576861471 2578457508 241
170 iso_pu_bacteria 2818991457 2819660160 241
171 iso_pu_bacteria 2842757796 2842760479 241
172 iso_pu_bacteria 2852684882 2852685024 241
173 iso_pu_bacteria 2894414249 2894416129 241
174 iso_pu_bacteria 2939622612 2939624695 241
175 iso_pu_bacteria 8021622325 8021626036 241
176 iso_pu_bacteria 8021626552 8021629230 241
177 iso_pu_bacteria 8021648035 8021649601 241
178 3300003187 JGI25151J46595_10015538 JGI25151J46595_100155382 242
179 3300003320 rootH2_10064251 rootH2_100642513 242
180 3300003781 Ga0055536_1007736 Ga0055536_10077362 242
181 3300003781 Ga0055536_1010710 Ga0055536_10107102 242
182 3300003791 Ga0055530_10003420 Ga0055530_100034203 242
183 3300003794 Ga0055531_10016462 Ga0055531_100164623 242
184 3300003794 Ga0055531_10023233 Ga0055531_100232333 242
185 3300005333 Ga0070677_10051992 Ga0070677_100519922 242
186 3300005337 Ga0070682_100194542 Ga0070682_1001945421 242
187 3300005618 Ga0068864_100536622 Ga0068864_1005366221 242
188 3300006948 Ga0099826_10202682 Ga0099826_102026822 242
189 3300014969 Ga0157376_10084939 Ga0157376_100849393 242
190 3300025291 Ga0209675_1007518 Ga0209675_10075183 242
191 3300025292 Ga0209676_1005724 Ga0209676_10057243 242
192 3300025292 Ga0209676_1005812 Ga0209676_10058123 242
193 3300025292 Ga0209676_1011124 Ga0209676_10111243 242
194 3300025292 Ga0209676_1012711 Ga0209676_10127113 242
195 3300025294 Ga0209025_1001970 Ga0209025_10019703 242
196 3300025294 Ga0209025_1074294 Ga0209025_10742941 242
197 3300025295 Ga0209564_1005004 Ga0209564_10050046 242
198 3300025295 Ga0209564_1021256 Ga0209564_10212563 242
199 3300025298 Ga0209050_1002371 Ga0209050_10023715 242
200 3300025299 Ga0209256_1002243 Ga0209256_100224310 242
201 3300025299 Ga0209256_1008409 Ga0209256_10084093 242
202 3300025299 Ga0209256_1009434 Ga0209256_10094343 242
203 3300025304 Ga0209257_1000828 Ga0209257_100082819 242
204 3300025304 Ga0209257_1002788 Ga0209257_100278811 242
205 3300025304 Ga0209257_1010666 Ga0209257_10106663 242
206 3300025893 Ga0207682_10082854 Ga0207682_100828542 242
207 3300025925 Ga0207650_10478659 Ga0207650_104786592 242
208 3300027666 Ga0209282_1183167 Ga0209282_11831671 242
209 3300031824 Ga0307413_10063371 Ga0307413_100633711 242
210 3300031911 Ga0307412_10085591 Ga0307412_100855912 242
211 3300032004 Ga0307414_10030074 Ga0307414_100300743 242
212 3300032005 Ga0307411_10023352 Ga0307411_100233523 242
213 3300032005 Ga0307411_10173036 Ga0307411_101730362 242
214 3300032005 Ga0307411_10188453 Ga0307411_101884531 242
215 3300035398 Ga0316574_0062138 Ga0316574_0062138_353_1117 242
216 3300041404 Ga0439436_0016988 Ga0439436_0016988_657_1460 242
217 3300041404 Ga0439436_0025422 Ga0439436_0025422_818_1624 242
218 3300041406 Ga0439439_0007696 Ga0439439_0007696_644_1435 242
219 3300041413 Ga0439465_0002285 Ga0439465_0002285_1286_2089 242
220 3300041443 Ga0451789_0365576 Ga0451789_0365576_143_907 242
221 3300042006 Ga0439432_004661 Ga0439432_004661_34_840 242
222 3300042006 Ga0439432_073648 Ga0439432_073648_198_1004 242
223 3300042007 Ga0439449_0010040 Ga0439449_0010040_1804_2574 242
224 3300042007 Ga0439449_0012527 Ga0439449_0012527_898_1704 242
225 3300042876 Ga0451577_0003782 Ga0451577_0003782_11681_12451 242
226 3300044712 Ga0453684_0743567 Ga0453684_0743567_190_960 242
227 3300046615 Ga0495656_0069256 Ga0495656_0069256_274_1077 242
228 3300046664 Ga0495659_0022493 Ga0495659_0022493_891_1658 242
229 3300047318 Ga0495636_0003876 Ga0495636_0003876_1389_2156 242
230 3300047318 Ga0495636_0007601 Ga0495636_0007601_2964_3731 242
231 3300049570 Ga0501033_0033311 Ga0501033_0033311_446_1237 242
232 3300049572 Ga0501036_0011325 Ga0501036_0011325_6319_7167 242
233 3300049573 Ga0501037_0184838 Ga0501037_0184838_85_876 242
234 3300049574 Ga0501038_0016295 Ga0501038_0016295_1998_2789 242
235 3300049574 Ga0501038_0295760 Ga0501038_0295760_265_1113 242
236 3300049575 Ga0501039_0021204 Ga0501039_0021204_3549_4340 242
237 3300049576 Ga0501040_0006933 Ga0501040_0006933_5837_6685 242
238 3300049576 Ga0501040_0133192 Ga0501040_0133192_196_987 242
239 3300049576 Ga0501040_0194253 Ga0501040_0194253_91_870 242
240 3300049577 Ga0501041_0004292 Ga0501041_0004292_2762_3610 242
241 3300049577 Ga0501041_0005242 Ga0501041_0005242_1813_2604 242
242 3300049578 Ga0501042_0003372 Ga0501042_0003372_5268_6059 242
243 3300049578 Ga0501042_0011266 Ga0501042_0011266_3331_4179 242
244 3300049579 Ga0501043_0001655 Ga0501043_0001655_15160_15975 242
245 3300049579 Ga0501043_0097522 Ga0501043_0097522_745_1593 242
246 3300049580 Ga0501046_0005663 Ga0501046_0005663_21_869 242
247 3300049580 Ga0501046_0010781 Ga0501046_0010781_30_821 242
248 3300049582 Ga0501048_0006164 Ga0501048_0006164_191_1039 242
249 3300049584 Ga0501068_0005879 Ga0501068_0005879_3179_4027 242
250 3300049584 Ga0501068_0009637 Ga0501068_0009637_1611_2402 242
251 3300049585 Ga0501069_0157809 Ga0501069_0157809_426_1217 242
252 3300049587 Ga0501071_0001892 Ga0501071_0001892_10635_11483 242
253 3300049588 Ga0501072_0000891 Ga0501072_0000891_17170_18018 242
254 3300049589 Ga0501073_0229764 Ga0501073_0229764_84_932 242
255 3300049590 Ga0501074_0036543 Ga0501074_0036543_98_946 242
256 3300049590 Ga0501074_0054534 Ga0501074_0054534_1569_2360 242
257 3300049591 Ga0501075_0005471 Ga0501075_0005471_5511_6302 242
258 3300049591 Ga0501075_0035751 Ga0501075_0035751_113_961 242
259 3300049592 Ga0501076_0009544 Ga0501076_0009544_2299_3147 242
260 3300049592 Ga0501076_0183435 Ga0501076_0183435_795_1586 242
261 3300049593 Ga0501077_0005933 Ga0501077_0005933_4641_5489 242
262 3300049593 Ga0501077_0042088 Ga0501077_0042088_791_1582 242
263 3300049660 Ga0501216_012121 Ga0501216_012121_542_1348 242
264 3300049669 Ga0501235_038619 Ga0501235_038619_218_1024 242
265 3300049686 Ga0501257_033614 Ga0501257_033614_225_1094 242
266 3300049741 Ga0501079_0010407 Ga0501079_0010407_6093_6941 242
267 3300049743 Ga0501081_0000960 Ga0501081_0000960_2661_3509 242
268 3300049744 Ga0501083_0021341 Ga0501083_0021341_1448_2239 242
269 3300049822 Ga0501035_0101563 Ga0501035_0101563_38_832 242
270 3300049824 Ga0501045_0001854 Ga0501045_0001854_3190_4038 242
271 3300049824 Ga0501045_0008480 Ga0501045_0008480_5648_6439 242
272 3300053153 Ga0500616_0042596 Ga0500616_0042596_1370_2161 242
273 3300054114 Ga0501084_0123837 Ga0501084_0123837_191_1039 242
274 3300054114 Ga0501084_0297319 Ga0501084_0297319_541_1332 242
275 3300060353 Ga0501082_0081399 Ga0501082_0081399_86_865 242
276 3300060353 Ga0501082_0128170 Ga0501082_0128170_104_952 242
277 3300061734 Ga0530510_0001701 Ga0530510_0001701_8281_9129 242
278 iso_pu_bacteria 2571042365 2572253373 242
279 iso_pu_bacteria 2643221559 2643816248 242
280 iso_pu_bacteria 2643221573 2643879600 242
281 iso_pu_bacteria 2643221579 2643905626 242
282 iso_pu_bacteria 2643221581 2643913246 242
283 iso_pu_bacteria 2643221586 2643939067 242
284 iso_pu_bacteria 2643221612 2644077192 242
285 iso_pu_bacteria 2643221695 2644528715 242
286 iso_pu_bacteria 2643221720 2644662791 242
287 iso_pu_bacteria 2643221727 2644694581 242
288 iso_pu_bacteria 2643221728 2644698254 242
289 iso_pu_bacteria 2747842501 2748015969 242
290 iso_pu_bacteria 2923516293 2923517730 242
291 iso_pu_bacteria 8003014200 8003014827 242
292 2162886007 SwRhRL2b_contig_520670 SwRhRL2b_0393.00006570 243
293 3300003187 JGI25151J46595_10000070 JGI25151J46595_1000007042 243
294 3300003771 Ga0055526_1000036 Ga0055526_10000363 243
295 3300003773 Ga0055537_1000089 Ga0055537_10000893 243
296 3300003775 Ga0055524_1000184 Ga0055524_10001843 243
297 3300003781 Ga0055536_1001459 Ga0055536_10014594 243
298 3300003781 Ga0055536_1007118 Ga0055536_10071183 243
299 3300003784 Ga0055534_1000221 Ga0055534_100022142 243
300 3300003790 Ga0055528_1000004 Ga0055528_1000004148 243
301 3300003794 Ga0055531_10003189 Ga0055531_1000318910 243
302 3300003794 Ga0055531_10008359 Ga0055531_100083593 243
303 3300003856 Ga0058692_1000011 Ga0058692_100001178 243
304 3300005289 Ga0065704_10072059 Ga0065704_100720596 243
305 3300005295 Ga0065707_10081966 Ga0065707_1008196617 243
306 3300005339 Ga0070660_100153677 Ga0070660_1001536772 243
307 3300005347 Ga0070668_100002994 Ga0070668_1000029941 243
308 3300005347 Ga0070668_100073168 Ga0070668_1000731682 243
309 3300005456 Ga0070678_100076731 Ga0070678_1000767312 243
310 3300005457 Ga0070662_100314504 Ga0070662_1003145042 243
311 3300005548 Ga0070665_100231431 Ga0070665_1002314312 243
312 3300005719 Ga0068861_100004300 Ga0068861_1000043003 243
313 3300006051 Ga0075364_10002507 Ga0075364_100025075 243
314 3300006844 Ga0075428_100013976 Ga0075428_1000139766 243
315 3300006846 Ga0075430_100003326 Ga0075430_10000332612 243
316 3300006847 Ga0075431_100004956 Ga0075431_1000049566 243
317 3300006880 Ga0075429_100001381 Ga0075429_1000013816 243
318 3300009094 Ga0111539_10220640 Ga0111539_102206402 243
319 3300009148 Ga0105243_10009285 Ga0105243_100092854 243
320 3300013102 Ga0157371_10043902 Ga0157371_100439024 243
321 3300013102 Ga0157371_10099438 Ga0157371_100994382 243
322 3300013102 Ga0157371_10282018 Ga0157371_102820181 243
323 3300013104 Ga0157370_10177545 Ga0157370_101775453 243
324 3300013105 Ga0157369_10059487 Ga0157369_100594873 243
325 3300013105 Ga0157369_10123399 Ga0157369_101233992 243
326 3300013307 Ga0157372_10079996 Ga0157372_100799963 243
327 3300014326 Ga0157380_10006337 Ga0157380_100063372 243
328 3300014497 Ga0182008_10000045 Ga0182008_1000004559 243
329 3300015261 Ga0182006_1014762 Ga0182006_10147622 243
330 3300015689 Ga0183360_10001 Ga0183360_100012409 243
331 3300017792 Ga0163161_10082115 Ga0163161_100821152 243
332 3300017792 Ga0163161_10159488 Ga0163161_101594882 243
333 3300017792 Ga0163161_10231065 Ga0163161_102310652 243
334 3300025263 Ga0209565_1000001 Ga0209565_10000011449 243
335 3300025263 Ga0209565_1009859 Ga0209565_10098592 243
336 3300025273 Ga0209673_1000001 Ga0209673_10000011449 243
337 3300025291 Ga0209675_1000001 Ga0209675_10000011085 243
338 3300025291 Ga0209675_1010623 Ga0209675_10106232 243
339 3300025292 Ga0209676_1000027 Ga0209676_100002721 243
340 3300025292 Ga0209676_1000117 Ga0209676_100011774 243
341 3300025292 Ga0209676_1001190 Ga0209676_10011903 243
342 3300025294 Ga0209025_1000015 Ga0209025_100001559 243
343 3300025294 Ga0209025_1011451 Ga0209025_10114512 243
344 3300025294 Ga0209025_1032260 Ga0209025_10322602 243
345 3300025295 Ga0209564_1000001 Ga0209564_10000011247 243
346 3300025297 Ga0209758_1042717 Ga0209758_10427172 243
347 3300025298 Ga0209050_1014045 Ga0209050_10140454 243
348 3300025298 Ga0209050_1020065 Ga0209050_10200652 243
349 3300025299 Ga0209256_1000002 Ga0209256_1000002307 243
350 3300025304 Ga0209257_1000148 Ga0209257_100014818 243
351 3300025304 Ga0209257_1000325 Ga0209257_100032524 243
352 3300025304 Ga0209257_1000349 Ga0209257_100034940 243
353 3300025909 Ga0207705_10208443 Ga0207705_102084432 243
354 3300025921 Ga0207652_10451081 Ga0207652_104510812 243
355 3300025931 Ga0207644_10012209 Ga0207644_100122095 243
356 3300025935 Ga0207709_10001757 Ga0207709_100017574 243
357 3300025972 Ga0207668_10040463 Ga0207668_100404633 243
358 3300025972 Ga0207668_10110269 Ga0207668_101102692 243
359 3300026118 Ga0207675_100008659 Ga0207675_1000086593 243
360 3300026121 Ga0207683_10051641 Ga0207683_100516412 243
361 3300027312 Ga0209371_1000007 Ga0209371_1000007473 243
362 3300030500 Ga0268256_1000008 Ga0268256_1000008477 243
363 3300030733 Ga0314311_1026358 Ga0314311_10263583 243
364 3300030736 Ga0316180_1091959 Ga0316180_10919593 243
365 3300031456 Ga0307513_10047554 Ga0307513_100475543 243
366 3300031507 Ga0307509_10000229 Ga0307509_1000022930 243
367 3300031548 Ga0307408_100154098 Ga0307408_1001540982 243
368 3300031616 Ga0307508_10173593 Ga0307508_101735932 243
369 3300031824 Ga0307413_10071699 Ga0307413_100716994 243
370 3300031901 Ga0307406_10001915 Ga0307406_100019155 243
371 3300031911 Ga0307412_10013077 Ga0307412_100130772 243
372 3300032004 Ga0307414_10006562 Ga0307414_100065623 243
373 3300032004 Ga0307414_10020752 Ga0307414_100207523 243
374 3300032004 Ga0307414_10028223 Ga0307414_100282232 243
375 3300032004 Ga0307414_10045905 Ga0307414_100459052 243
376 3300032004 Ga0307414_10087495 Ga0307414_100874952 243
377 3300037312 Ga0395899_0052345 Ga0395899_0052345_307_1083 243
378 3300037418 Ga0395900_0056989 Ga0395900_0056989_2899_3714 243
379 3300037471 Ga0395905_0000630 Ga0395905_0000630_42705_43520 243
380 3300037471 Ga0395905_0133704 Ga0395905_0133704_212_1021 243
381 3300037471 Ga0395905_0415854 Ga0395905_0415854_388_1164 243
382 3300038443 Ga0395901_0087365 Ga0395901_0087365_2181_2996 243
383 3300038443 Ga0395901_0350419 Ga0395901_0350419_391_1200 243
384 3300039145 Ga0237816_00247 Ga0237816_00247_1011_1787 243
385 3300041404 Ga0439436_0008692 Ga0439436_0008692_1140_1964 243
386 3300041404 Ga0439436_0026453 Ga0439436_0026453_654_1430 243
387 3300041413 Ga0439465_0000252 Ga0439465_0000252_7643_8419 243
388 3300041413 Ga0439465_0000583 Ga0439465_0000583_1930_2706 243
389 3300041413 Ga0439465_0017457 Ga0439465_0017457_1029_1805 243
390 3300041441 Ga0451787_842899 Ga0451787_842899_15_812 243
391 3300041451 Ga0451791_1014610 Ga0451791_1014610_545_1321 243
392 3300041451 Ga0451791_1616238 Ga0451791_1616238_420_1196 243
393 3300041453 Ga0451797_0679444 Ga0451797_0679444_726_1502 243
394 3300041486 Ga0451807_1641294 Ga0451807_1641294_1155_1931 243
395 3300041494 Ga0451837_0369857 Ga0451837_0369857_777_1553 243
396 3300041512 Ga0451853_2393446 Ga0451853_2393446_201_977 243
397 3300042007 Ga0439449_0001104 Ga0439449_0001104_1004_1780 243
398 3300042533 Ga0450901_003710 Ga0450901_003710_490_1263 243
399 3300046460 Ga0495638_0001513 Ga0495638_0001513_11485_12258 243
400 3300046501 Ga0495607_0098547 Ga0495607_0098547_718_1497 243
401 3300046525 Ga0495663_0000599 Ga0495663_0000599_723_1499 243
402 3300046525 Ga0495663_0000673 Ga0495663_0000673_7160_7933 243
403 3300046558 Ga0495633_0002463 Ga0495633_0002463_7326_8099 243
404 3300046616 Ga0495668_0002228 Ga0495668_0002228_9364_10176 243
405 3300048903 Ga0496100_0134859 Ga0496100_0134859_753_1568 243
406 3300048911 Ga0496108_0013046 Ga0496108_0013046_4203_5018 243
407 3300048912 Ga0496109_0269575 Ga0496109_0269575_208_990 243
408 3300048916 Ga0496113_0019860 Ga0496113_0019860_424_1233 243
409 3300048917 Ga0496114_0010174 Ga0496114_0010174_122_898 243
410 3300048919 Ga0496116_0003837 Ga0496116_0003837_5307_6092 243
411 3300048920 Ga0496117_0000476 Ga0496117_0000476_51757_52530 243
412 3300048920 Ga0496117_0001999 Ga0496117_0001999_4651_5424 243
413 3300048921 Ga0496118_0000403 Ga0496118_0000403_51754_52527 243
414 3300048921 Ga0496118_0000404 Ga0496118_0000404_15427_16200 243
415 3300048921 Ga0496118_0029335 Ga0496118_0029335_116_889 243
416 3300048921 Ga0496118_0091768 Ga0496118_0091768_1257_2048 243
417 3300048924 Ga0496121_0000678 Ga0496121_0000678_43158_43970 243
418 3300048924 Ga0496121_0001428 Ga0496121_0001428_21715_22488 243
419 3300048924 Ga0496121_0008448 Ga0496121_0008448_10294_11079 243
420 3300048924 Ga0496121_0039788 Ga0496121_0039788_1119_1925 243
421 3300048925 Ga0496122_0004763 Ga0496122_0004763_12266_13039 243
422 3300048925 Ga0496122_0009509 Ga0496122_0009509_9280_10053 243
423 3300048925 Ga0496122_0187804 Ga0496122_0187804_349_1122 243
424 3300048926 Ga0496123_0004320 Ga0496123_0004320_9436_10209 243
425 3300048926 Ga0496123_0021135 Ga0496123_0021135_3873_4655 243
426 3300048926 Ga0496123_0093058 Ga0496123_0093058_836_1609 243
427 3300048927 Ga0496124_0000032 Ga0496124_0000032_188239_189018 243
428 3300048927 Ga0496124_0021941 Ga0496124_0021941_1553_2326 243
429 3300048927 Ga0496124_0275152 Ga0496124_0275152_288_1073 243
430 3300048928 Ga0496125_0001440 Ga0496125_0001440_15843_16616 243
431 3300048929 Ga0496126_0008822 Ga0496126_0008822_4356_5129 243
432 3300049571 Ga0501034_0000272 Ga0501034_0000272_30018_30794 243
433 3300049573 Ga0501037_0173070 Ga0501037_0173070_500_1270 243
434 3300049576 Ga0501040_0011047 Ga0501040_0011047_3645_4463 243
435 3300049577 Ga0501041_0023752 Ga0501041_0023752_2845_3663 243
436 3300049580 Ga0501046_0037626 Ga0501046_0037626_2837_3655 243
437 3300049588 Ga0501072_0002249 Ga0501072_0002249_9368_10186 243
438 3300049591 Ga0501075_0011417 Ga0501075_0011417_1465_2283 243
439 3300050491 nmdc:mga00v17_1411_c1 nmdc:mga00v17_1411_c1_11814_12596 243
440 3300050508 nmdc:mga09592_7895_c1 nmdc:mga09592_7895_c1_3133_3936 243
441 3300050510 nmdc:mga06r32_745_c1 nmdc:mga06r32_745_c1_3140_3943 243
442 3300053134 Ga0500658_0111352 Ga0500658_0111352_29_859 243
443 3300060353 Ga0501082_0020786 Ga0501082_0020786_883_1701 243
444 3300060353 Ga0501082_0058563 Ga0501082_0058563_1352_2164 243
445 3300061734 Ga0530510_0074465 Ga0530510_0074465_339_1157 243
446 iso_pu_bacteria 2547132130 2547500655 243
447 iso_pu_bacteria 2643221593 2643974522 243
448 iso_pu_bacteria 2747842428 2747950010 243
449 iso_pu_bacteria 2765235840 2765579977 243
450 iso_pu_bacteria 2816332141 2816518979 243
451 iso_pu_bacteria 2842391507 2842395609 243
452 iso_pu_bacteria 2842780639 2842783494 243
453 iso_pu_bacteria 2874220319 2874222662 243
454 iso_pu_bacteria 2919089067 2919093149 243
455 iso_pu_bacteria 2919134579 2919137477 243
456 iso_pu_bacteria 2928496128 2928500306 243
457 iso_pu_bacteria 2931380184 2931383878 243
458 iso_pu_bacteria 2937610967 2937614588 243
459 iso_pu_bacteria 2939626828 2939628217 243
460 iso_pu_bacteria 2941489479 2941489721 243
461 iso_pu_bacteria 2961047084 2961049427 243
462 iso_pu_bacteria 2961064222 2961065896 243
463 iso_pu_bacteria 2995948881 2995950749 243
464 iso_pu_bacteria 8002869464 8002871602 243
465 3300047322 Ga0495680_0134905 Ga0495680_0134905_471_1274 244
466 3300048925 Ga0496122_0000209 Ga0496122_0000209_31006_31779 244
467 3300048926 Ga0496123_0000106 Ga0496123_0000106_68360_69133 244
468 2162886007 SwRhRL2b_contig_3067580 SwRhRL2b_0822.00000410 245
469 3300003856 Ga0058692_1000024 Ga0058692_1000024109 245
470 3300005289 Ga0065704_10088993 Ga0065704_100889933 245
471 3300005331 Ga0070670_100039849 Ga0070670_1000398493 245
472 3300009011 Ga0105251_10000373 Ga0105251_1000037314 245
473 3300009148 Ga0105243_10008845 Ga0105243_100088452 245
474 3300011119 Ga0105246_10437480 Ga0105246_104374802 245
475 3300015265 Ga0182005_1001536 Ga0182005_10015362 245
476 3300025735 Ga0207713_1000690 Ga0207713_100069025 245
477 3300025925 Ga0207650_10005213 Ga0207650_100052137 245
478 3300025935 Ga0207709_10005894 Ga0207709_100058943 245
479 3300027312 Ga0209371_1000016 Ga0209371_1000016461 245
480 3300030500 Ga0268256_1000015 Ga0268256_1000015109 245
481 3300041453 Ga0451797_1447564 Ga0451797_1447564_218_991 245
482 3300041459 Ga0451800_0955444 Ga0451800_0955444_1727_2500 245
483 3300041462 Ga0451806_288496 Ga0451806_288496_1482_2255 245
484 3300041486 Ga0451807_0225613 Ga0451807_0225613_1612_2385 245
485 3300048920 Ga0496117_0005376 Ga0496117_0005376_12373_13146 245
486 3300048921 Ga0496118_0113381 Ga0496118_0113381_126_899 245
487 3300048922 Ga0496119_0012167 Ga0496119_0012167_5305_6078 245
488 3300048923 Ga0496120_0000650 Ga0496120_0000650_19341_20114 245
489 3300048927 Ga0496124_0012502 Ga0496124_0012502_5330_6103 245
490 3300048929 Ga0496126_0432311 Ga0496126_0432311_76_849 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

94

267

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5626 15 215
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5363 15 215
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.4886 15 224
6zg3-assembly2.cif.gz_C the structure of ecf pant transporter in a complex with a nanobody 0.4756 9 225
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.4704 15 224
ID Description Score Start End Superfamily
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8034 67 221 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7667 67 221 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.699 62 221 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6885 62 221 1.10.1760.20
5kc4E00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4886 15 224 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A832JPT8-F1-model_v4 Queuosine precursor transporter 0.9038 117 224 GO:0016020
GO:1990397
AF-A0A444WKX9-F1-model_v4 deleted 0.8765 62 232
AF-A0A6G7ZU14-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.8763 5 245 GO:0005886
GO:0022857
GO:1990397
AF-A0A2W5KS47-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.8755 9 245 GO:0005886
GO:0022857
GO:1990397
AF-A0A3N4VE91-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.8715 5 243 GO:0005886
GO:0022857
GO:1990397

Feature Viewer

pLDDT pTM Quality
80.03 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map