F453955

General Info

Members Datasets Scaffolds Average Seq Length
490 282 484 226

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10500185|Ga0207703_105001852
Length 255
Sequence VEWETTGSTGNTRHWGSVCSVASVVEGTEMLLHIPDMLIGEPLQHACERLASAGWVNGRVTAGHQSARVKDNLQLPEDHPAARDLGELIMAALQRHPLFIAAALPLRVFPPLFNRYEEGQAFGSHVDNAVRQVPGTPHRIRTDLSATLFLSDPADYDGGELVVEDTYGVHSVKLPAGHLVLYPSTSLHHVRPVTRGARVASFFWIQSMVRDDATRSLLFDLDLAIQRNIRLGWERGCAQPPPEVAPNLFHAVIDT

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
4 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
5 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
6 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
184 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
185 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
279 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 2.24
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000370 3300003203 Bacteria 20505
2 Ga0065712_10000817 3300005290 Bacteria 8503
3 Ga0065715_10100122 3300005293 Unclassified 3333
4 Ga0065707_10325407 3300005295 Bacteria 959
5 Ga0070658_10019816 3300005327 Bacteria 5387
6 Ga0070658_10049691 3300005327 Bacteria 3398
7 Ga0070658_10176170 3300005327 Bacteria 1798
8 Ga0070658_10200805 3300005327 Bacteria 1682
9 Ga0070676_10099858 3300005328 Bacteria 1791
10 Ga0070683_100015344 3300005329 Bacteria 6725
11 Ga0070683_100030896 3300005329 Bacteria 4867
12 Ga0070683_100164104 3300005329 Bacteria 2108
13 Ga0070683_100257439 3300005329 Bacteria 1660
14 Ga0070670_100446436 3300005331 Bacteria 1146
15 Ga0070670_100653427 3300005331 Bacteria 943
16 Ga0070682_100146674 3300005337 Bacteria 1615
17 Ga0068868_100692333 3300005338 Bacteria 911
18 Ga0070660_100007711 3300005339 Bacteria 7503
19 Ga0070660_100183138 3300005339 Bacteria 1695
20 Ga0070660_100312596 3300005339 Bacteria 1289
21 Ga0070691_10059620 3300005341 Bacteria 1834
22 Ga0070661_100211760 3300005344 Bacteria 1484
23 Ga0070692_10066988 3300005345 Bacteria 1905
24 Ga0070668_100393693 3300005347 Bacteria 1182
25 Ga0070669_100878856 3300005353 Bacteria 765
26 Ga0070674_100115268 3300005356 Bacteria 1980
27 Ga0070674_100132338 3300005356 Bacteria 1861
28 Ga0070674_100860251 3300005356 Bacteria 787
29 Ga0070659_100002292 3300005366 Bacteria 13622
30 Ga0070659_100100150 3300005366 Bacteria 2332
31 Ga0070659_100257640 3300005366 Unclassified 1447
32 Ga0070659_100498607 3300005366 Bacteria 1038
33 Ga0070667_100019647 3300005367 Bacteria 5604
34 Ga0070714_100002000 3300005435 Bacteria 14902
35 Ga0070714_100026411 3300005435 Unclassified 4799
36 Ga0070711_100530610 3300005439 Bacteria 974
37 Ga0070700_100396117 3300005441 Bacteria 1037
38 Ga0070694_100368924 3300005444 Bacteria 1117
39 Ga0070663_100143775 3300005455 Bacteria 1823
40 Ga0070663_100240440 3300005455 Bacteria 1429
41 Ga0070662_100004325 3300005457 Bacteria 8969
42 Ga0070662_100093541 3300005457 Bacteria 2262
43 Ga0070662_100402080 3300005457 Bacteria 1130
44 Ga0070681_10018025 3300005458 Bacteria 7054
45 Ga0068867_100304741 3300005459 Bacteria 1314
46 Ga0070685_10239809 3300005466 Bacteria 1196
47 Ga0070707_100112390 3300005468 Bacteria 2642
48 Ga0070699_100011476 3300005518 Bacteria 7652
49 Ga0070699_100117324 3300005518 Bacteria 2339
50 Ga0070679_100003175 3300005530 Bacteria 15015
51 Ga0070679_100041619 3300005530 Bacteria 4572
52 Ga0070679_100115250 3300005530 Bacteria 2673
53 Ga0070679_100147733 3300005530 Bacteria 2328
54 Ga0070679_100246162 3300005530 Bacteria 1745
55 Ga0070684_100027389 3300005535 Bacteria 4809
56 Ga0068853_100099331 3300005539 Bacteria 2571
57 Ga0068853_100119701 3300005539 Bacteria 2347
58 Ga0070672_100034903 3300005543 Bacteria 3819
59 Ga0070665_100001388 3300005548 Bacteria 28525
60 Ga0070665_100005414 3300005548 Bacteria 13167
61 Ga0070665_100006080 3300005548 Bacteria 12341
62 Ga0070665_100322800 3300005548 Bacteria 1548
63 Ga0070665_100333164 3300005548 Bacteria 1522
64 Ga0070704_100384242 3300005549 Bacteria 1194
65 Ga0068855_100011227 3300005563 Bacteria 10818
66 Ga0068855_100113175 3300005563 Bacteria 3113
67 Ga0068855_100114270 3300005563 Bacteria 3095
68 Ga0070664_100772214 3300005564 Bacteria 898
69 Ga0068857_100010098 3300005577 Bacteria 8201
70 Ga0068857_100120912 3300005577 Bacteria 2358
71 Ga0068857_100501510 3300005577 Bacteria 1139
72 Ga0068856_100013888 3300005614 Bacteria 7788
73 Ga0068859_100599415 3300005617 Bacteria 1195
74 Ga0068859_100653949 3300005617 Bacteria 1143
75 Ga0068864_100306518 3300005618 Bacteria 1488
76 Ga0068864_100328904 3300005618 Bacteria 1437
77 Ga0068864_100857668 3300005618 Bacteria 895
78 Ga0068866_10166563 3300005718 Bacteria 1290
79 Ga0068861_100132896 3300005719 Bacteria 2022
80 Ga0068861_100929682 3300005719 Bacteria 826
81 Ga0068863_100004045 3300005841 Bacteria 14480
82 Ga0068863_100241930 3300005841 Bacteria 1742
83 Ga0068863_100521868 3300005841 Bacteria 1171
84 Ga0068863_100526887 3300005841 Bacteria 1165
85 Ga0068858_100455513 3300005842 Bacteria 1233
86 Ga0068862_101055780 3300005844 Bacteria 806
87 Ga0081455_10556966 3300005937 Bacteria 757
88 Ga0081538_10054215 3300005981 Unclassified 2374
89 Ga0081540_1027667 3300005983 Bacteria 3206
90 Ga0081539_10000248 3300005985 Bacteria 125908
91 Ga0081539_10048003 3300005985 Bacteria 2432
92 Ga0075365_10135965 3300006038 Bacteria 1704
93 Ga0075368_10014653 3300006042 Bacteria 2900
94 Ga0075364_10142944 3300006051 Bacteria 1610
95 Ga0075364_10263522 3300006051 Unclassified 1172
96 Ga0070716_100059874 3300006173 Bacteria 2197
97 Ga0070712_100125355 3300006175 Bacteria 1939
98 Ga0070712_100259631 3300006175 Bacteria 1392
99 Ga0075362_10223774 3300006177 Bacteria 920
100 Ga0075367_10001414 3300006178 Bacteria 10278
101 Ga0075367_10210373 3300006178 Bacteria 1216
102 Ga0075367_10327572 3300006178 Bacteria 965
103 Ga0075366_10052836 3300006195 Bacteria 2414
104 Ga0068871_100127387 3300006358 Bacteria 2156
105 Ga0075428_100012065 3300006844 Bacteria 9613
106 Ga0075428_100076653 3300006844 Bacteria 3650
107 Ga0075430_100023316 3300006846 Bacteria 5267
108 Ga0075430_100163424 3300006846 Bacteria 1853
109 Ga0075430_100177911 3300006846 Unclassified 1769
110 Ga0075431_100015068 3300006847 Bacteria 7829
111 Ga0075431_100098260 3300006847 Bacteria 3023
112 Ga0075431_100251355 3300006847 Bacteria 1796
113 Ga0075431_100337205 3300006847 Bacteria 1518
114 Ga0075434_100007905 3300006871 Bacteria 9855
115 Ga0075429_100040898 3300006880 Bacteria 4036
116 Ga0097620_100523631 3300006931 Bacteria 1280
117 Ga0097620_100599416 3300006931 Bacteria 1195
118 Ga0097620_100653917 3300006931 Bacteria 1143
119 Ga0105251_10000721 3300009011 Bacteria 30477
120 Ga0105251_10002625 3300009011 Bacteria 13873
121 Ga0105240_10254668 3300009093 Unclassified 2028
122 Ga0105240_10479438 3300009093 Bacteria 1387
123 Ga0105240_10563501 3300009093 Bacteria 1259
124 Ga0111539_10197704 3300009094 Unclassified 2345
125 Ga0111539_10289298 3300009094 Bacteria 1907
126 Ga0111539_10532298 3300009094 Unclassified 1369
127 Ga0111539_10536970 3300009094 Bacteria 1362
128 Ga0111539_11142267 3300009094 Unclassified 905
129 Ga0105247_10050234 3300009101 Bacteria 2566
130 Ga0105247_10736958 3300009101 Unclassified 745
131 Ga0114129_10182171 3300009147 Bacteria 2857
132 Ga0105243_10282032 3300009148 Bacteria 1497
133 Ga0105241_10022885 3300009174 Bacteria 4633
134 Ga0105241_10297390 3300009174 Bacteria 1384
135 Ga0105242_10019569 3300009176 Bacteria 5307
136 Ga0105242_11175598 3300009176 Bacteria 785
137 Ga0105248_10050322 3300009177 Bacteria 4672
138 Ga0105248_10220459 3300009177 Bacteria 2136
139 Ga0105248_10475072 3300009177 Bacteria 1409
140 Ga0105248_10919807 3300009177 Bacteria 988
141 Ga0105248_10947532 3300009177 Bacteria 972
142 Ga0105237_10014970 3300009545 Bacteria 8084
143 Ga0105237_10092849 3300009545 Bacteria 3008
144 Ga0105237_10449799 3300009545 Bacteria 1294
145 Ga0105238_10001647 3300009551 Bacteria 22393
146 Ga0105238_10008999 3300009551 Bacteria 9991
147 Ga0105238_10065725 3300009551 Bacteria 3628
148 Ga0105249_10038484 3300009553 Bacteria 4340
149 Ga0105249_10286758 3300009553 Bacteria 1646
150 Ga0105239_10044639 3300010375 Bacteria 4858
151 Ga0105239_10059710 3300010375 Bacteria 4185
152 Ga0105239_10357081 3300010375 Bacteria 1650
153 Ga0105246_10001097 3300011119 Bacteria 15692
154 Ga0157373_10057541 3300013100 Bacteria 2757
155 Ga0157371_10000786 3300013102 Bacteria 36566
156 Ga0157371_10003387 3300013102 Bacteria 14480
157 Ga0157371_10077203 3300013102 Bacteria 2358
158 Ga0157370_10010525 3300013104 Bacteria 9741
159 Ga0157370_10414220 3300013104 Bacteria 1240
160 Ga0157369_10012278 3300013105 Bacteria 9728
161 Ga0157369_10263264 3300013105 Unclassified 1798
162 Ga0157369_10651287 3300013105 Bacteria 1086
163 Ga0157378_10058599 3300013297 Bacteria 3435
164 Ga0163162_10045846 3300013306 Bacteria 4381
165 Ga0163162_10055796 3300013306 Unclassified 3979
166 Ga0163162_10445978 3300013306 Bacteria 1426
167 Ga0157375_10030301 3300013308 Bacteria 5100
168 Ga0157375_10141481 3300013308 Bacteria 2533
169 Ga0157375_10305432 3300013308 Bacteria 1755
170 Ga0157375_10760398 3300013308 Bacteria 1120
171 Ga0163163_10029422 3300014325 Bacteria 5283
172 Ga0157380_10480972 3300014326 Bacteria 1201
173 Ga0157380_10522855 3300014326 Bacteria 1158
174 Ga0157377_10356845 3300014745 Bacteria 983
175 Ga0157379_10007173 3300014968 Bacteria 9643
176 Ga0157376_10023525 3300014969 Bacteria 4823
177 Ga0182006_1008613 3300015261 Bacteria 4621
178 Ga0163161_10015718 3300017792 Bacteria 5277
179 Ga0213875_10017650 3300021388 Bacteria 3443
180 Ga0207713_1001082 3300025735 Bacteria 23417
181 Ga0207713_1014937 3300025735 Bacteria 4006
182 Ga0207642_10223213 3300025899 Bacteria 1054
183 Ga0207680_10000005 3300025903 Bacteria 660983
184 Ga0207645_10079840 3300025907 Bacteria 2097
185 Ga0207705_10059548 3300025909 Bacteria 2756
186 Ga0207705_10159051 3300025909 Bacteria 1696
187 Ga0207705_10165394 3300025909 Bacteria 1663
188 Ga0207654_10062946 3300025911 Bacteria 2175
189 Ga0207707_10077196 3300025912 Bacteria 2907
190 Ga0207707_10380229 3300025912 Bacteria 1214
191 Ga0207695_10053585 3300025913 Bacteria 4218
192 Ga0207695_10055131 3300025913 Bacteria 4145
193 Ga0207695_10304386 3300025913 Unclassified 1485
194 Ga0207695_10319836 3300025913 Bacteria 1441
195 Ga0207671_10062499 3300025914 Bacteria 2765
196 Ga0207671_10097221 3300025914 Bacteria 2226
197 Ga0207693_10062549 3300025915 Bacteria 2916
198 Ga0207693_10240680 3300025915 Bacteria 1420
199 Ga0207663_10054638 3300025916 Bacteria 2502
200 Ga0207663_10427591 3300025916 Bacteria 1018
201 Ga0207660_10049493 3300025917 Bacteria 2979
202 Ga0207662_10634576 3300025918 Bacteria 745
203 Ga0207657_10000130 3300025919 Bacteria 75710
204 Ga0207657_10012811 3300025919 Bacteria 8253
205 Ga0207657_10049350 3300025919 Bacteria 3668
206 Ga0207649_10024448 3300025920 Bacteria 3511
207 Ga0207652_10002475 3300025921 Bacteria 15563
208 Ga0207652_10028031 3300025921 Bacteria 4696
209 Ga0207652_10048532 3300025921 Bacteria 3629
210 Ga0207652_10118512 3300025921 Bacteria 2353
211 Ga0207652_10177634 3300025921 Bacteria 1912
212 Ga0207652_10854619 3300025921 Bacteria 806
213 Ga0207646_10566589 3300025922 Bacteria 1021
214 Ga0207694_10000010 3300025924 Bacteria 439722
215 Ga0207694_10005178 3300025924 Bacteria 10069
216 Ga0207694_10160819 3300025924 Bacteria 1814
217 Ga0207700_10142979 3300025928 Bacteria 1968
218 Ga0207664_10001993 3300025929 Bacteria 13445
219 Ga0207664_10074286 3300025929 Unclassified 2746
220 Ga0207690_10004610 3300025932 Bacteria 8149
221 Ga0207690_10085003 3300025932 Bacteria 2219
222 Ga0207690_10299716 3300025932 Bacteria 1257
223 Ga0207706_10000334 3300025933 Bacteria 51180
224 Ga0207706_10023344 3300025933 Bacteria 5555
225 Ga0207706_10143114 3300025933 Bacteria 2103
226 Ga0207686_10070400 3300025934 Bacteria 2247
227 Ga0207669_10097987 3300025937 Bacteria 1930
228 Ga0207665_10042082 3300025939 Bacteria 3053
229 Ga0207691_10048982 3300025940 Bacteria 3872
230 Ga0207691_10519633 3300025940 Bacteria 1010
231 Ga0207711_10021064 3300025941 Bacteria 5445
232 Ga0207661_10026209 3300025944 Bacteria 4439
233 Ga0207661_10028835 3300025944 Bacteria 4255
234 Ga0207661_10255843 3300025944 Bacteria 1558
235 Ga0207679_10201482 3300025945 Bacteria 1663
236 Ga0207679_10807459 3300025945 Bacteria 855
237 Ga0207667_10001581 3300025949 Bacteria 28630
238 Ga0207667_10004481 3300025949 Bacteria 17103
239 Ga0207667_10014936 3300025949 Bacteria 8831
240 Ga0207667_10245893 3300025949 Bacteria 1830
241 Ga0207712_10206040 3300025961 Bacteria 1563
242 Ga0207668_10163184 3300025972 Bacteria 1739
243 Ga0207640_10056337 3300025981 Bacteria 2580
244 Ga0207658_10090331 3300025986 Bacteria 2373
245 Ga0207703_10409395 3300026035 Bacteria 1260
246 Ga0207703_10410709 3300026035 Bacteria 1258
247 Ga0207703_10500185 3300026035 Bacteria 1141
248 Ga0207639_10017276 3300026041 Bacteria 5113
249 Ga0207639_10093814 3300026041 Bacteria 2408
250 Ga0207678_10024413 3300026067 Bacteria 5278
251 Ga0207678_10175475 3300026067 Bacteria 1830
252 Ga0207702_10048001 3300026078 Bacteria 3600
253 Ga0207641_10000673 3300026088 Bacteria 37086
254 Ga0207641_10921557 3300026088 Bacteria 868
255 Ga0207648_10230336 3300026089 Bacteria 1648
256 Ga0207648_10471026 3300026089 Bacteria 1146
257 Ga0207676_10354073 3300026095 Bacteria 1359
258 Ga0207676_10361665 3300026095 Bacteria 1345
259 Ga0207674_10074272 3300026116 Bacteria 3412
260 Ga0207674_10094377 3300026116 Bacteria 2978
261 Ga0207675_100143862 3300026118 Bacteria 2266
262 Ga0207675_100428321 3300026118 Bacteria 1308
263 Ga0207683_10208752 3300026121 Bacteria 1777
264 Ga0207698_10063680 3300026142 Bacteria 2887
265 Ga0207698_10970042 3300026142 Bacteria 860
266 Ga0209813_10002282 3300027866 Bacteria 4381
267 Ga0207428_10094626 3300027907 Bacteria 2315
268 Ga0268266_10000004 3300028379 Bacteria 1495817
269 Ga0268266_10000416 3300028379 Bacteria 64671
270 Ga0268266_10000546 3300028379 Bacteria 52540
271 Ga0268266_10252796 3300028379 Bacteria 1631
272 Ga0268266_10254034 3300028379 Bacteria 1627
273 Ga0268265_10952793 3300028380 Bacteria 845
274 Ga0265326_10034222 3300028558 Bacteria 1445
275 Ga0265334_10000102 3300028573 Bacteria 57530
276 Ga0265334_10040832 3300028573 Unclassified 1815
277 Ga0265338_10025925 3300028800 Bacteria 5928
278 Ga0265338_10036671 3300028800 Bacteria 4687
279 Ga0265338_10156371 3300028800 Unclassified 1765
280 Ga0265330_10031124 3300031235 Bacteria 2392
281 Ga0265340_10020476 3300031247 Bacteria 3398
282 Ga0265340_10053812 3300031247 Bacteria 1943
283 Ga0265340_10248405 3300031247 Bacteria 793
284 Ga0265331_10000186 3300031250 Bacteria 76149
285 Ga0265331_10101865 3300031250 Bacteria 1321
286 Ga0307513_10014283 3300031456 Bacteria 9707
287 Ga0307513_10048550 3300031456 Bacteria 4606
288 Ga0265313_10000485 3300031595 Bacteria 41821
289 Ga0265313_10010395 3300031595 Bacteria 5889
290 Ga0265314_10047253 3300031711 Bacteria 3031
291 Ga0265342_10141530 3300031712 Bacteria 1342
292 Ga0307413_10000735 3300031824 Bacteria 11303
293 Ga0307413_10066562 3300031824 Bacteria 2249
294 Ga0307410_10004949 3300031852 Bacteria 6981
295 Ga0307410_10254383 3300031852 Bacteria 1367
296 Ga0307407_10306682 3300031903 Bacteria 1109
297 Ga0307412_10441471 3300031911 Bacteria 1070
298 Ga0307409_100045262 3300031995 Bacteria 3321
299 Ga0307409_100356336 3300031995 Bacteria 1382
300 Ga0307414_10421452 3300032004 Bacteria 1164
301 Ga0307411_10011383 3300032005 Bacteria 4799
302 Ga0307415_100942979 3300032126 Bacteria 798
303 Ga0373935_0355197 3300035692 Bacteria 1045
304 Ga0373933_0277984 3300035724 Bacteria 1082
305 Ga0316582_0007757 3300036647 Bacteria 5733
306 Ga0395905_0564076 3300037471 Bacteria 1040
307 Ga0436364_0600159 3300037853 Bacteria 6900
308 Ga0395901_0827048 3300038443 Bacteria 913
309 Ga0436365_0895241 3300039437 Bacteria 2326
310 Ga0436361_0751327 3300039447 Bacteria 9387
311 Ga0436361_1052934 3300039447 Bacteria 13812
312 Ga0451789_0010581 3300041443 Bacteria 1083
313 Ga0451798_0957180 3300041458 Unclassified 901
314 Ga0451802_0149710 3300041460 Bacteria 1213
315 Ga0451837_1147622 3300041494 Bacteria 2679
316 Ga0451853_0229674 3300041512 Bacteria 1239
317 Ga0439448_0065312 3300042005 Bacteria 1207
318 Ga0450894_000769 3300042131 Bacteria 5255
319 Ga0450906_008983 3300042145 Bacteria 1918
320 Ga0450907_035035 3300042146 Bacteria 856
321 Ga0451577_0008283 3300042876 Bacteria 10123
322 Ga0439440_0017369 3300042993 Bacteria 1584
323 Ga0466963_0376245 3300044694 Bacteria 1001
324 Ga0495638_0230260 3300046460 Bacteria 1031
325 Ga0495651_0017042 3300046462 Bacteria 5628
326 Ga0495664_0449437 3300046477 Unclassified 772
327 Ga0495610_0003117 3300046512 Bacteria 13205
328 Ga0495616_0052360 3300046513 Bacteria 2033
329 Ga0495628_0126517 3300046516 Bacteria 1958
330 Ga0495631_0001236 3300046518 Bacteria 15780
331 Ga0495643_0000541 3300046522 Bacteria 46840
332 Ga0495643_0148375 3300046522 Bacteria 1163
333 Ga0495652_0213072 3300046529 Bacteria 1457
334 Ga0495665_0052323 3300046531 Bacteria 2162
335 Ga0495667_0280125 3300046559 Bacteria 1058
336 Ga0495625_0011150 3300046660 Bacteria 7354
337 Ga0495623_0006179 3300046679 Bacteria 7786
338 Ga0495649_0046979 3300046694 Bacteria 2349
339 Ga0495600_0364121 3300046809 Bacteria 904
340 Ga0495681_0096671 3300047470 Bacteria 1297
341 Ga0495686_0002785 3300047472 Bacteria 15937
342 Ga0495686_0035780 3300047472 Bacteria 3190
343 Ga0495686_0231889 3300047472 Bacteria 1045
344 Ga0495602_0241995 3300048088 Bacteria 1349
345 Ga0496102_0544646 3300048905 Bacteria 1083
346 Ga0496104_0280799 3300048907 Bacteria 1578
347 Ga0496105_0019511 3300048908 Bacteria 5469
348 Ga0496106_0068877 3300048909 Bacteria 2700
349 Ga0496106_0371086 3300048909 Bacteria 1150
350 Ga0496110_0026808 3300048913 Bacteria 4935
351 Ga0496114_0390802 3300048917 Bacteria 1232
352 Ga0496116_0018588 3300048919 Bacteria 5349
353 Ga0496116_0040468 3300048919 Bacteria 3210
354 Ga0496116_0110043 3300048919 Bacteria 1622
355 Ga0496117_0003801 3300048920 Bacteria 17210
356 Ga0496118_0000814 3300048921 Bacteria 49769
357 Ga0496118_0026179 3300048921 Bacteria 4976
358 Ga0496119_0000329 3300048922 Bacteria 66425
359 Ga0496120_0000147 3300048923 Bacteria 117881
360 Ga0496121_0027581 3300048924 Bacteria 5311
361 Ga0496121_0053510 3300048924 Bacteria 3381
362 Ga0496122_0010237 3300048925 Bacteria 9714
363 Ga0496122_0182785 3300048925 Bacteria 1248
364 Ga0496123_0017075 3300048926 Bacteria 5859
365 Ga0496124_0002550 3300048927 Bacteria 23634
366 Ga0496124_0004642 3300048927 Bacteria 15908
367 Ga0496124_0005358 3300048927 Bacteria 14482
368 Ga0496124_0018043 3300048927 Bacteria 6625
369 Ga0496125_0005265 3300048928 Bacteria 14483
370 Ga0496125_0008042 3300048928 Bacteria 11132
371 Ga0496125_0010305 3300048928 Bacteria 9465
372 Ga0496125_0016314 3300048928 Bacteria 7137
373 Ga0496125_0019666 3300048928 Bacteria 6359
374 Ga0496126_0001694 3300048929 Bacteria 32787
375 Ga0496126_0009327 3300048929 Bacteria 10443
376 Ga0496126_0010423 3300048929 Bacteria 9742
377 Ga0496126_0016918 3300048929 Bacteria 7276
378 Ga0496126_0343304 3300048929 Bacteria 1223
379 Ga0501032_0009864 3300049569 Bacteria 6903
380 Ga0501032_0011608 3300049569 Bacteria 6319
381 Ga0501033_0013133 3300049570 Bacteria 6309
382 Ga0501033_0299173 3300049570 Bacteria 1133
383 Ga0501034_0027600 3300049571 Bacteria 5773
384 Ga0501034_0096776 3300049571 Bacteria 2947
385 Ga0501034_0467976 3300049571 Bacteria 1177
386 Ga0501036_0020147 3300049572 Bacteria 5600
387 Ga0501036_0039667 3300049572 Bacteria 3984
388 Ga0501036_0192483 3300049572 Bacteria 1716
389 Ga0501037_0010988 3300049573 Bacteria 6657
390 Ga0501037_0028799 3300049573 Bacteria 4104
391 Ga0501037_0063294 3300049573 Bacteria 2696
392 Ga0501037_0129106 3300049573 Bacteria 1813
393 Ga0501038_0006761 3300049574 Bacteria 10593
394 Ga0501038_0011112 3300049574 Bacteria 8222
395 Ga0501039_0038332 3300049575 Bacteria 3701
396 Ga0501039_0144482 3300049575 Bacteria 1869
397 Ga0501040_0128389 3300049576 Unclassified 1782
398 Ga0501042_0402607 3300049578 Bacteria 991
399 Ga0501043_0020406 3300049579 Bacteria 5197
400 Ga0501043_0141816 3300049579 Bacteria 1881
401 Ga0501043_0145470 3300049579 Bacteria 1856
402 Ga0501046_0762359 3300049580 Bacteria 679
403 Ga0501047_0122773 3300049581 Bacteria 2478
404 Ga0501047_0436215 3300049581 Bacteria 1140
405 Ga0501048_0005742 3300049582 Bacteria 9429
406 Ga0501048_0148935 3300049582 Bacteria 1655
407 Ga0501067_0000123 3300049583 Bacteria 42381
408 Ga0501067_0003450 3300049583 Bacteria 8697
409 Ga0501068_0001446 3300049584 Bacteria 12614
410 Ga0501068_0005268 3300049584 Bacteria 7062
411 Ga0501069_0019335 3300049585 Bacteria 3682
412 Ga0501070_0001913 3300049586 Bacteria 18381
413 Ga0501070_0029489 3300049586 Bacteria 4599
414 Ga0501070_0721662 3300049586 Bacteria 787
415 Ga0501071_0216576 3300049587 Bacteria 1441
416 Ga0501072_0128663 3300049588 Bacteria 2018
417 Ga0501072_0440301 3300049588 Bacteria 1032
418 Ga0501073_0000002 3300049589 Bacteria 323865
419 Ga0501073_0084152 3300049589 Bacteria 2213
420 Ga0501074_0118560 3300049590 Bacteria 1893
421 Ga0501075_0121951 3300049591 Unclassified 1984
422 Ga0501075_0185235 3300049591 Bacteria 1588
423 Ga0501076_0195906 3300049592 Bacteria 1649
424 Ga0501076_0280365 3300049592 Bacteria 1365
425 Ga0501077_0000010 3300049593 Bacteria 97557
426 Ga0501235_042596 3300049669 Bacteria 1040
427 Ga0501079_0014476 3300049741 Bacteria 6015
428 Ga0501079_0301055 3300049741 Bacteria 1255
429 Ga0501080_0007209 3300049742 Bacteria 10038
430 Ga0501080_0153241 3300049742 Bacteria 2129
431 Ga0501080_0380565 3300049742 Bacteria 1272
432 Ga0501083_0036451 3300049744 Bacteria 3355
433 Ga0501035_0005615 3300049822 Bacteria 11843
434 Ga0501035_0023417 3300049822 Bacteria 5664
435 Ga0501035_0080581 3300049822 Bacteria 2874
436 Ga0501044_0003354 3300049823 Bacteria 18058
437 Ga0501044_0061784 3300049823 Bacteria 3831
438 Ga0501044_0270351 3300049823 Bacteria 1636
439 Ga0501044_0422850 3300049823 Bacteria 1242
440 Ga0501044_0719578 3300049823 Bacteria 882
441 Ga0501045_0012387 3300049824 Bacteria 6007
442 Ga0501045_0195340 3300049824 Bacteria 1508
443 nmdc:mga03683_232840_c1 3300050489 Bacteria 852
444 nmdc:mga03n38_27407_c1 3300050490 Bacteria 2363
445 nmdc:mga00v17_324618_c1 3300050491 Bacteria 1000
446 nmdc:mga0yw44_127886_c1 3300050492 Bacteria 1642
447 nmdc:mga0k408_218132_c1 3300050493 Bacteria 1139
448 nmdc:mga06z11_10006_c1 3300050494 Bacteria 4021
449 nmdc:mga06z11_187963_c1 3300050494 Bacteria 1194
450 nmdc:mga06z11_257063_c1 3300050494 Bacteria 1030
451 nmdc:mga05p37_12350_c2 3300050507 Bacteria 6762
452 nmdc:mga05p37_52874_c1 3300050507 Bacteria 4995
453 nmdc:mga09592_55714_c1 3300050508 Bacteria 3341
454 nmdc:mga0qj67_115275_c1 3300050509 Bacteria 2171
455 nmdc:mga0qj67_132886_c1 3300050509 Unclassified 2016
456 nmdc:mga0qj67_18774_c1 3300050509 Bacteria 5272
457 nmdc:mga0qj67_209139_c1 3300050509 Bacteria 1585
458 nmdc:mga06r32_100820_c1 3300050510 Bacteria 2833
459 nmdc:mga06r32_174612_c1 3300050510 Bacteria 2133
460 nmdc:mga06r32_369290_c1 3300050510 Bacteria 1418
461 nmdc:mga06r32_67854_c1 3300050510 Bacteria 3444
462 nmdc:mga08y16_325944_c1 3300050511 Unclassified 1580
463 nmdc:mga0n895_179195_c1 3300050512 Unclassified 2150
464 nmdc:mga0rr50_11047_c2 3300050513 Bacteria 4879
465 nmdc:mga0rr50_354968_c1 3300050513 Bacteria 1233
466 nmdc:mga0a205_272753_c1 3300050515 Unclassified 1568
467 nmdc:mga0a205_36189_c1 3300050515 Bacteria 4742
468 nmdc:mga0a205_588926_c1 3300050515 Bacteria 966
469 Ga0495595_0161328 3300053084 Bacteria 1106
470 Ga0500643_000001 3300053087 Bacteria 1440111
471 Ga0500647_0078230 3300053091 Bacteria 1587
472 Ga0500556_0000333 3300053104 Bacteria 35192
473 Ga0500562_050361 3300053108 Bacteria 1113
474 Ga0500595_023233 3300053119 Bacteria 2182
475 Ga0500588_0001472 3300053146 Bacteria 4484
476 Ga0500604_0127863 3300053151 Bacteria 853
477 Ga0500616_0066106 3300053153 Bacteria 1857
478 Ga0500611_029671 3300053727 Unclassified 1121
479 Ga0500565_000056 3300053734 Bacteria 5253
480 Ga0501084_0010614 3300054114 Bacteria 7622
481 Ga0501082_0389044 3300060353 Bacteria 1217
482 Ga0501082_0723165 3300060353 Bacteria 871
483 Ga0530510_0150735 3300061734 Unclassified 1717
484 Ga0530510_0337999 3300061734 Unclassified 1130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100164104 Ga0070683_1001641042 183
2 3300005329 Ga0070683_100257439 Ga0070683_1002574392 204
3 3300005841 Ga0068863_100526887 Ga0068863_1005268872 204
4 3300009177 Ga0105248_10919807 Ga0105248_109198072 204
5 3300010375 Ga0105239_10357081 Ga0105239_103570812 204
6 3300014325 Ga0163163_10029422 Ga0163163_100294225 204
7 3300060353 Ga0501082_0723165 Ga0501082_0723165_244_858 204
8 3300009101 Ga0105247_10736958 Ga0105247_107369581 207
9 3300014969 Ga0157376_10023525 Ga0157376_100235253 207
10 3300048917 Ga0496114_0390802 Ga0496114_0390802_228_851 207
11 3300049580 Ga0501046_0762359 Ga0501046_0762359_32_655 207
12 3300053104 Ga0500556_0000333 Ga0500556_0000333_14479_15120 213
13 3300050513 nmdc:mga0rr50_11047_c2 nmdc:mga0rr50_11047_c2_1589_2272 214
14 3300037853 Ga0436364_0600159 Ga0436364_0600159_5868_6518 216
15 3300049586 Ga0501070_0721662 Ga0501070_0721662_10_666 218
16 3300038443 Ga0395901_0827048 Ga0395901_0827048_241_900 219
17 3300006038 Ga0075365_10135965 Ga0075365_101359652 220
18 3300006042 Ga0075368_10014653 Ga0075368_100146533 220
19 3300006051 Ga0075364_10263522 Ga0075364_102635222 220
20 3300027866 Ga0209813_10002282 Ga0209813_100022825 220
21 3300049588 Ga0501072_0128663 Ga0501072_0128663_20_682 220
22 3300049741 Ga0501079_0301055 Ga0501079_0301055_182_844 220
23 3300050490 nmdc:mga03n38_27407_c1 nmdc:mga03n38_27407_c1_91_753 220
24 3300050491 nmdc:mga00v17_324618_c1 nmdc:mga00v17_324618_c1_228_890 220
25 3300050492 nmdc:mga0yw44_127886_c1 nmdc:mga0yw44_127886_c1_302_964 220
26 3300050494 nmdc:mga06z11_10006_c1 nmdc:mga06z11_10006_c1_12_674 220
27 3300053151 Ga0500604_0127863 Ga0500604_0127863_80_742 220
28 3300061734 Ga0530510_0337999 Ga0530510_0337999_341_1003 220
29 3300053087 Ga0500643_000001 Ga0500643_000001_1186011_1186679 222
30 iso_pu_bacteria 2524023250 2524612536 222
31 iso_pu_bacteria 2786546517 2787435287 222
32 iso_pu_bacteria 2856287931 2856290001 222
33 iso_pu_bacteria 2857357740 2857362958 222
34 iso_pu_bacteria 2857442823 2857442869 222
35 iso_pu_bacteria 2939622612 2939625211 222
36 3300005331 Ga0070670_100446436 Ga0070670_1004464362 223
37 3300005435 Ga0070714_100002000 Ga0070714_10000200015 223
38 3300005435 Ga0070714_100026411 Ga0070714_1000264114 223
39 3300005543 Ga0070672_100034903 Ga0070672_1000349032 223
40 3300013308 Ga0157375_10141481 Ga0157375_101414812 223
41 3300025916 Ga0207663_10054638 Ga0207663_100546384 223
42 3300025918 Ga0207662_10634576 Ga0207662_106345761 223
43 3300025928 Ga0207700_10142979 Ga0207700_101429792 223
44 3300025929 Ga0207664_10001993 Ga0207664_1000199314 223
45 3300025929 Ga0207664_10074286 Ga0207664_100742864 223
46 3300025940 Ga0207691_10048982 Ga0207691_100489823 223
47 3300025945 Ga0207679_10807459 Ga0207679_108074591 223
48 3300028558 Ga0265326_10034222 Ga0265326_100342221 223
49 3300028573 Ga0265334_10000102 Ga0265334_1000010216 223
50 3300028573 Ga0265334_10040832 Ga0265334_100408322 223
51 3300031595 Ga0265313_10000485 Ga0265313_1000048532 223
52 3300031595 Ga0265313_10010395 Ga0265313_100103956 223
53 3300036647 Ga0316582_0007757 Ga0316582_0007757_229_900 223
54 3300050515 nmdc:mga0a205_36189_c1 nmdc:mga0a205_36189_c1_137_808 223
55 3300046516 Ga0495628_0126517 Ga0495628_0126517_319_1008 224
56 3300046522 Ga0495643_0148375 Ga0495643_0148375_293_967 224
57 3300046809 Ga0495600_0364121 Ga0495600_0364121_28_717 224
58 3300053153 Ga0500616_0066106 Ga0500616_0066106_206_880 224
59 3300005290 Ga0065712_10000817 Ga0065712_100008175 226
60 3300005293 Ga0065715_10100122 Ga0065715_101001222 226
61 3300005295 Ga0065707_10325407 Ga0065707_103254072 226
62 3300005328 Ga0070676_10099858 Ga0070676_100998582 226
63 3300005329 Ga0070683_100030896 Ga0070683_1000308962 226
64 3300005331 Ga0070670_100653427 Ga0070670_1006534271 226
65 3300005338 Ga0068868_100692333 Ga0068868_1006923332 226
66 3300005345 Ga0070692_10066988 Ga0070692_100669881 226
67 3300005347 Ga0070668_100393693 Ga0070668_1003936932 226
68 3300005353 Ga0070669_100878856 Ga0070669_1008788561 226
69 3300005356 Ga0070674_100115268 Ga0070674_1001152681 226
70 3300005356 Ga0070674_100132338 Ga0070674_1001323382 226
71 3300005356 Ga0070674_100860251 Ga0070674_1008602511 226
72 3300005439 Ga0070711_100530610 Ga0070711_1005306101 226
73 3300005441 Ga0070700_100396117 Ga0070700_1003961171 226
74 3300005444 Ga0070694_100368924 Ga0070694_1003689242 226
75 3300005458 Ga0070681_10018025 Ga0070681_100180252 226
76 3300005459 Ga0068867_100304741 Ga0068867_1003047412 226
77 3300005466 Ga0070685_10239809 Ga0070685_102398092 226
78 3300005468 Ga0070707_100112390 Ga0070707_1001123902 226
79 3300005518 Ga0070699_100011476 Ga0070699_1000114763 226
80 3300005518 Ga0070699_100117324 Ga0070699_1001173241 226
81 3300005530 Ga0070679_100147733 Ga0070679_1001477332 226
82 3300005548 Ga0070665_100001388 Ga0070665_10000138812 226
83 3300005548 Ga0070665_100005414 Ga0070665_1000054146 226
84 3300005548 Ga0070665_100006080 Ga0070665_10000608015 226
85 3300005548 Ga0070665_100322800 Ga0070665_1003228002 226
86 3300005548 Ga0070665_100333164 Ga0070665_1003331642 226
87 3300005549 Ga0070704_100384242 Ga0070704_1003842422 226
88 3300005563 Ga0068855_100114270 Ga0068855_1001142702 226
89 3300005564 Ga0070664_100772214 Ga0070664_1007722142 226
90 3300005577 Ga0068857_100501510 Ga0068857_1005015102 226
91 3300005617 Ga0068859_100599415 Ga0068859_1005994151 226
92 3300005618 Ga0068864_100306518 Ga0068864_1003065182 226
93 3300005618 Ga0068864_100328904 Ga0068864_1003289041 226
94 3300005618 Ga0068864_100857668 Ga0068864_1008576681 226
95 3300005718 Ga0068866_10166563 Ga0068866_101665631 226
96 3300005719 Ga0068861_100132896 Ga0068861_1001328962 226
97 3300005719 Ga0068861_100929682 Ga0068861_1009296821 226
98 3300005841 Ga0068863_100004045 Ga0068863_1000040458 226
99 3300005841 Ga0068863_100241930 Ga0068863_1002419303 226
100 3300005841 Ga0068863_100521868 Ga0068863_1005218682 226
101 3300005844 Ga0068862_101055780 Ga0068862_1010557801 226
102 3300005937 Ga0081455_10556966 Ga0081455_105569661 226
103 3300005985 Ga0081539_10048003 Ga0081539_100480032 226
104 3300006051 Ga0075364_10142944 Ga0075364_101429442 226
105 3300006173 Ga0070716_100059874 Ga0070716_1000598742 226
106 3300006175 Ga0070712_100125355 Ga0070712_1001253552 226
107 3300006175 Ga0070712_100259631 Ga0070712_1002596312 226
108 3300006178 Ga0075367_10001414 Ga0075367_100014146 226
109 3300006178 Ga0075367_10210373 Ga0075367_102103731 226
110 3300006178 Ga0075367_10327572 Ga0075367_103275722 226
111 3300006195 Ga0075366_10052836 Ga0075366_100528362 226
112 3300006358 Ga0068871_100127387 Ga0068871_1001273872 226
113 3300006846 Ga0075430_100023316 Ga0075430_1000233165 226
114 3300006846 Ga0075430_100163424 Ga0075430_1001634242 226
115 3300006847 Ga0075431_100015068 Ga0075431_1000150685 226
116 3300006847 Ga0075431_100098260 Ga0075431_1000982603 226
117 3300006847 Ga0075431_100337205 Ga0075431_1003372052 226
118 3300006871 Ga0075434_100007905 Ga0075434_1000079053 226
119 3300006931 Ga0097620_100523631 Ga0097620_1005236312 226
120 3300006931 Ga0097620_100599416 Ga0097620_1005994161 226
121 3300009011 Ga0105251_10000721 Ga0105251_1000072116 226
122 3300009011 Ga0105251_10002625 Ga0105251_100026258 226
123 3300009093 Ga0105240_10254668 Ga0105240_102546682 226
124 3300009093 Ga0105240_10479438 Ga0105240_104794381 226
125 3300009093 Ga0105240_10563501 Ga0105240_105635012 226
126 3300009094 Ga0111539_10289298 Ga0111539_102892983 226
127 3300009094 Ga0111539_10536970 Ga0111539_105369702 226
128 3300009101 Ga0105247_10050234 Ga0105247_100502342 226
129 3300009148 Ga0105243_10282032 Ga0105243_102820322 226
130 3300009174 Ga0105241_10297390 Ga0105241_102973901 226
131 3300009176 Ga0105242_10019569 Ga0105242_100195692 226
132 3300009176 Ga0105242_11175598 Ga0105242_111755981 226
133 3300009177 Ga0105248_10050322 Ga0105248_100503223 226
134 3300009177 Ga0105248_10220459 Ga0105248_102204592 226
135 3300009177 Ga0105248_10475072 Ga0105248_104750722 226
136 3300009177 Ga0105248_10947532 Ga0105248_109475321 226
137 3300009545 Ga0105237_10014970 Ga0105237_100149702 226
138 3300009545 Ga0105237_10092849 Ga0105237_100928492 226
139 3300009545 Ga0105237_10449799 Ga0105237_104497992 226
140 3300009551 Ga0105238_10008999 Ga0105238_100089993 226
141 3300009551 Ga0105238_10065725 Ga0105238_100657252 226
142 3300009553 Ga0105249_10286758 Ga0105249_102867582 226
143 3300010375 Ga0105239_10044639 Ga0105239_100446391 226
144 3300010375 Ga0105239_10059710 Ga0105239_100597102 226
145 3300013102 Ga0157371_10000786 Ga0157371_1000078634 226
146 3300013105 Ga0157369_10263264 Ga0157369_102632641 226
147 3300013105 Ga0157369_10651287 Ga0157369_106512873 226
148 3300013297 Ga0157378_10058599 Ga0157378_100585994 226
149 3300013306 Ga0163162_10445978 Ga0163162_104459782 226
150 3300014326 Ga0157380_10480972 Ga0157380_104809722 226
151 3300014326 Ga0157380_10522855 Ga0157380_105228552 226
152 3300014968 Ga0157379_10007173 Ga0157379_100071732 226
153 3300015261 Ga0182006_1008613 Ga0182006_10086132 226
154 3300017792 Ga0163161_10015718 Ga0163161_100157183 226
155 3300021388 Ga0213875_10017650 Ga0213875_100176504 226
156 3300025735 Ga0207713_1001082 Ga0207713_10010821 226
157 3300025735 Ga0207713_1014937 Ga0207713_10149373 226
158 3300025899 Ga0207642_10223213 Ga0207642_102232131 226
159 3300025907 Ga0207645_10079840 Ga0207645_100798402 226
160 3300025912 Ga0207707_10077196 Ga0207707_100771963 226
161 3300025912 Ga0207707_10380229 Ga0207707_103802291 226
162 3300025913 Ga0207695_10053585 Ga0207695_100535852 226
163 3300025913 Ga0207695_10055131 Ga0207695_100551312 226
164 3300025913 Ga0207695_10304386 Ga0207695_103043862 226
165 3300025913 Ga0207695_10319836 Ga0207695_103198361 226
166 3300025914 Ga0207671_10062499 Ga0207671_100624992 226
167 3300025914 Ga0207671_10097221 Ga0207671_100972212 226
168 3300025915 Ga0207693_10062549 Ga0207693_100625492 226
169 3300025916 Ga0207663_10427591 Ga0207663_104275911 226
170 3300025921 Ga0207652_10028031 Ga0207652_100280313 226
171 3300025921 Ga0207652_10854619 Ga0207652_108546191 226
172 3300025922 Ga0207646_10566589 Ga0207646_105665891 226
173 3300025924 Ga0207694_10000010 Ga0207694_10000010341 226
174 3300025924 Ga0207694_10160819 Ga0207694_101608192 226
175 3300025934 Ga0207686_10070400 Ga0207686_100704002 226
176 3300025937 Ga0207669_10097987 Ga0207669_100979872 226
177 3300025939 Ga0207665_10042082 Ga0207665_100420822 226
178 3300025940 Ga0207691_10519633 Ga0207691_105196332 226
179 3300025941 Ga0207711_10021064 Ga0207711_100210643 226
180 3300025944 Ga0207661_10026209 Ga0207661_100262094 226
181 3300025949 Ga0207667_10001581 Ga0207667_1000158119 226
182 3300025972 Ga0207668_10163184 Ga0207668_101631842 226
183 3300026035 Ga0207703_10409395 Ga0207703_104093952 226
184 3300026035 Ga0207703_10500185 Ga0207703_105001852 226
185 3300026088 Ga0207641_10000673 Ga0207641_1000067313 226
186 3300026088 Ga0207641_10921557 Ga0207641_109215572 226
187 3300026089 Ga0207648_10230336 Ga0207648_102303362 226
188 3300026089 Ga0207648_10471026 Ga0207648_104710262 226
189 3300026095 Ga0207676_10354073 Ga0207676_103540731 226
190 3300026095 Ga0207676_10361665 Ga0207676_103616652 226
191 3300026118 Ga0207675_100143862 Ga0207675_1001438622 226
192 3300026118 Ga0207675_100428321 Ga0207675_1004283212 226
193 3300028379 Ga0268266_10000416 Ga0268266_1000041621 226
194 3300028379 Ga0268266_10000546 Ga0268266_1000054633 226
195 3300028379 Ga0268266_10252796 Ga0268266_102527962 226
196 3300028379 Ga0268266_10254034 Ga0268266_102540342 226
197 3300028380 Ga0268265_10952793 Ga0268265_109527931 226
198 3300028800 Ga0265338_10025925 Ga0265338_100259255 226
199 3300028800 Ga0265338_10036671 Ga0265338_100366713 226
200 3300028800 Ga0265338_10156371 Ga0265338_101563712 226
201 3300031235 Ga0265330_10031124 Ga0265330_100311243 226
202 3300031247 Ga0265340_10020476 Ga0265340_100204763 226
203 3300031247 Ga0265340_10053812 Ga0265340_100538122 226
204 3300031247 Ga0265340_10248405 Ga0265340_102484051 226
205 3300031250 Ga0265331_10000186 Ga0265331_1000018617 226
206 3300031250 Ga0265331_10101865 Ga0265331_101018652 226
207 3300031456 Ga0307513_10014283 Ga0307513_100142832 226
208 3300031456 Ga0307513_10048550 Ga0307513_100485501 226
209 3300031711 Ga0265314_10047253 Ga0265314_100472533 226
210 3300031712 Ga0265342_10141530 Ga0265342_101415301 226
211 3300031824 Ga0307413_10000735 Ga0307413_100007356 226
212 3300031824 Ga0307413_10066562 Ga0307413_100665622 226
213 3300031852 Ga0307410_10004949 Ga0307410_100049492 226
214 3300031852 Ga0307410_10254383 Ga0307410_102543832 226
215 3300031903 Ga0307407_10306682 Ga0307407_103066822 226
216 3300031911 Ga0307412_10441471 Ga0307412_104414712 226
217 3300031995 Ga0307409_100045262 Ga0307409_1000452622 226
218 3300032004 Ga0307414_10421452 Ga0307414_104214521 226
219 3300032005 Ga0307411_10011383 Ga0307411_100113833 226
220 3300032126 Ga0307415_100942979 Ga0307415_1009429792 226
221 3300035692 Ga0373935_0355197 Ga0373935_0355197_304_984 226
222 3300035724 Ga0373933_0277984 Ga0373933_0277984_272_952 226
223 3300037471 Ga0395905_0564076 Ga0395905_0564076_309_989 226
224 3300039437 Ga0436365_0895241 Ga0436365_0895241_1601_2281 226
225 3300039447 Ga0436361_0751327 Ga0436361_0751327_585_1265 226
226 3300039447 Ga0436361_1052934 Ga0436361_1052934_9617_10297 226
227 3300041443 Ga0451789_0010581 Ga0451789_0010581_146_826 226
228 3300041458 Ga0451798_0957180 Ga0451798_0957180_46_726 226
229 3300041460 Ga0451802_0149710 Ga0451802_0149710_446_1126 226
230 3300041494 Ga0451837_1147622 Ga0451837_1147622_841_1521 226
231 3300041512 Ga0451853_0229674 Ga0451853_0229674_274_954 226
232 3300042131 Ga0450894_000769 Ga0450894_000769_2653_3333 226
233 3300042145 Ga0450906_008983 Ga0450906_008983_649_1329 226
234 3300042146 Ga0450907_035035 Ga0450907_035035_34_714 226
235 3300042876 Ga0451577_0008283 Ga0451577_0008283_5388_6068 226
236 3300044694 Ga0466963_0376245 Ga0466963_0376245_46_726 226
237 3300046460 Ga0495638_0230260 Ga0495638_0230260_310_990 226
238 3300046462 Ga0495651_0017042 Ga0495651_0017042_450_1130 226
239 3300046512 Ga0495610_0003117 Ga0495610_0003117_10964_11653 226
240 3300046513 Ga0495616_0052360 Ga0495616_0052360_1301_2014 226
241 3300046518 Ga0495631_0001236 Ga0495631_0001236_12913_13602 226
242 3300046522 Ga0495643_0000541 Ga0495643_0000541_27942_28634 226
243 3300046529 Ga0495652_0213072 Ga0495652_0213072_501_1181 226
244 3300046531 Ga0495665_0052323 Ga0495665_0052323_247_927 226
245 3300046559 Ga0495667_0280125 Ga0495667_0280125_46_726 226
246 3300046660 Ga0495625_0011150 Ga0495625_0011150_3463_4152 226
247 3300046679 Ga0495623_0006179 Ga0495623_0006179_3665_4345 226
248 3300046694 Ga0495649_0046979 Ga0495649_0046979_1080_1760 226
249 3300047470 Ga0495681_0096671 Ga0495681_0096671_557_1270 226
250 3300047472 Ga0495686_0002785 Ga0495686_0002785_1544_2233 226
251 3300048088 Ga0495602_0241995 Ga0495602_0241995_125_805 226
252 3300048905 Ga0496102_0544646 Ga0496102_0544646_60_740 226
253 3300048907 Ga0496104_0280799 Ga0496104_0280799_701_1390 226
254 3300048908 Ga0496105_0019511 Ga0496105_0019511_981_1670 226
255 3300048909 Ga0496106_0068877 Ga0496106_0068877_53_733 226
256 3300048909 Ga0496106_0371086 Ga0496106_0371086_436_1125 226
257 3300048913 Ga0496110_0026808 Ga0496110_0026808_1255_1935 226
258 3300048919 Ga0496116_0018588 Ga0496116_0018588_1328_2017 226
259 3300048919 Ga0496116_0040468 Ga0496116_0040468_1660_2349 226
260 3300048919 Ga0496116_0110043 Ga0496116_0110043_248_937 226
261 3300048920 Ga0496117_0003801 Ga0496117_0003801_13618_14307 226
262 3300048921 Ga0496118_0000814 Ga0496118_0000814_31695_32384 226
263 3300048921 Ga0496118_0026179 Ga0496118_0026179_3489_4178 226
264 3300048922 Ga0496119_0000329 Ga0496119_0000329_57305_57994 226
265 3300048923 Ga0496120_0000147 Ga0496120_0000147_8288_8977 226
266 3300048924 Ga0496121_0027581 Ga0496121_0027581_4322_5011 226
267 3300048925 Ga0496122_0010237 Ga0496122_0010237_2529_3218 226
268 3300048925 Ga0496122_0182785 Ga0496122_0182785_427_1107 226
269 3300048926 Ga0496123_0017075 Ga0496123_0017075_3362_4051 226
270 3300048927 Ga0496124_0002550 Ga0496124_0002550_4403_5083 226
271 3300048927 Ga0496124_0004642 Ga0496124_0004642_1791_2480 226
272 3300048927 Ga0496124_0005358 Ga0496124_0005358_5235_5948 226
273 3300048927 Ga0496124_0018043 Ga0496124_0018043_680_1369 226
274 3300048928 Ga0496125_0005265 Ga0496125_0005265_4103_4792 226
275 3300048928 Ga0496125_0008042 Ga0496125_0008042_3961_4650 226
276 3300048928 Ga0496125_0010305 Ga0496125_0010305_3029_3709 226
277 3300048928 Ga0496125_0019666 Ga0496125_0019666_1862_2551 226
278 3300048929 Ga0496126_0001694 Ga0496126_0001694_23789_24478 226
279 3300048929 Ga0496126_0010423 Ga0496126_0010423_1509_2189 226
280 3300048929 Ga0496126_0016918 Ga0496126_0016918_1997_2677 226
281 3300048929 Ga0496126_0343304 Ga0496126_0343304_160_840 226
282 3300049570 Ga0501033_0299173 Ga0501033_0299173_334_1014 226
283 3300049571 Ga0501034_0096776 Ga0501034_0096776_1149_1829 226
284 3300049572 Ga0501036_0039667 Ga0501036_0039667_2360_3040 226
285 3300049573 Ga0501037_0028799 Ga0501037_0028799_2974_3654 226
286 3300049573 Ga0501037_0063294 Ga0501037_0063294_1180_1860 226
287 3300049574 Ga0501038_0006761 Ga0501038_0006761_2153_2833 226
288 3300049575 Ga0501039_0038332 Ga0501039_0038332_1940_2620 226
289 3300049578 Ga0501042_0402607 Ga0501042_0402607_293_973 226
290 3300049579 Ga0501043_0141816 Ga0501043_0141816_726_1406 226
291 3300049581 Ga0501047_0122773 Ga0501047_0122773_940_1620 226
292 3300049581 Ga0501047_0436215 Ga0501047_0436215_129_809 226
293 3300049582 Ga0501048_0005742 Ga0501048_0005742_2124_2804 226
294 3300049583 Ga0501067_0003450 Ga0501067_0003450_6440_7120 226
295 3300049584 Ga0501068_0005268 Ga0501068_0005268_3494_4174 226
296 3300049585 Ga0501069_0019335 Ga0501069_0019335_2058_2738 226
297 3300049586 Ga0501070_0029489 Ga0501070_0029489_3626_4306 226
298 3300049589 Ga0501073_0084152 Ga0501073_0084152_199_879 226
299 3300049590 Ga0501074_0118560 Ga0501074_0118560_1141_1821 226
300 3300049591 Ga0501075_0185235 Ga0501075_0185235_67_747 226
301 3300049592 Ga0501076_0280365 Ga0501076_0280365_535_1215 226
302 3300049741 Ga0501079_0014476 Ga0501079_0014476_2208_2888 226
303 3300049742 Ga0501080_0007209 Ga0501080_0007209_4439_5131 226
304 3300049742 Ga0501080_0153241 Ga0501080_0153241_945_1625 226
305 3300049744 Ga0501083_0036451 Ga0501083_0036451_1745_2425 226
306 3300049822 Ga0501035_0023417 Ga0501035_0023417_3571_4251 226
307 3300049822 Ga0501035_0080581 Ga0501035_0080581_496_1176 226
308 3300049823 Ga0501044_0719578 Ga0501044_0719578_189_869 226
309 3300049824 Ga0501045_0012387 Ga0501045_0012387_3627_4307 226
310 3300050493 nmdc:mga0k408_218132_c1 nmdc:mga0k408_218132_c1_58_738 226
311 3300050494 nmdc:mga06z11_187963_c1 nmdc:mga06z11_187963_c1_62_742 226
312 3300050494 nmdc:mga06z11_257063_c1 nmdc:mga06z11_257063_c1_315_995 226
313 3300050509 nmdc:mga0qj67_115275_c1 nmdc:mga0qj67_115275_c1_1446_2126 226
314 3300050509 nmdc:mga0qj67_18774_c1 nmdc:mga0qj67_18774_c1_719_1399 226
315 3300050510 nmdc:mga06r32_100820_c1 nmdc:mga06r32_100820_c1_596_1276 226
316 3300050510 nmdc:mga06r32_174612_c1 nmdc:mga06r32_174612_c1_902_1582 226
317 3300050513 nmdc:mga0rr50_354968_c1 nmdc:mga0rr50_354968_c1_30_710 226
318 3300053084 Ga0495595_0161328 Ga0495595_0161328_126_806 226
319 3300053091 Ga0500647_0078230 Ga0500647_0078230_729_1442 226
320 3300053119 Ga0500595_023233 Ga0500595_023233_1205_1885 226
321 3300053146 Ga0500588_0001472 Ga0500588_0001472_3624_4304 226
322 3300053727 Ga0500611_029671 Ga0500611_029671_218_910 226
323 3300053734 Ga0500565_000056 Ga0500565_000056_1674_2387 226
324 3300054114 Ga0501084_0010614 Ga0501084_0010614_3129_3809 226
325 3300005327 Ga0070658_10019816 Ga0070658_100198162 227
326 3300005327 Ga0070658_10049691 Ga0070658_100496911 227
327 3300005327 Ga0070658_10176170 Ga0070658_101761701 227
328 3300005327 Ga0070658_10200805 Ga0070658_102008051 227
329 3300005329 Ga0070683_100015344 Ga0070683_1000153442 227
330 3300005337 Ga0070682_100146674 Ga0070682_1001466741 227
331 3300005339 Ga0070660_100007711 Ga0070660_1000077117 227
332 3300005339 Ga0070660_100183138 Ga0070660_1001831381 227
333 3300005339 Ga0070660_100312596 Ga0070660_1003125962 227
334 3300005341 Ga0070691_10059620 Ga0070691_100596201 227
335 3300005344 Ga0070661_100211760 Ga0070661_1002117602 227
336 3300005366 Ga0070659_100002292 Ga0070659_1000022922 227
337 3300005366 Ga0070659_100100150 Ga0070659_1001001502 227
338 3300005366 Ga0070659_100257640 Ga0070659_1002576401 227
339 3300005366 Ga0070659_100498607 Ga0070659_1004986071 227
340 3300005367 Ga0070667_100019647 Ga0070667_1000196473 227
341 3300005455 Ga0070663_100143775 Ga0070663_1001437751 227
342 3300005455 Ga0070663_100240440 Ga0070663_1002404401 227
343 3300005457 Ga0070662_100004325 Ga0070662_1000043251 227
344 3300005457 Ga0070662_100093541 Ga0070662_1000935412 227
345 3300005457 Ga0070662_100402080 Ga0070662_1004020802 227
346 3300005530 Ga0070679_100003175 Ga0070679_10000317513 227
347 3300005530 Ga0070679_100041619 Ga0070679_1000416195 227
348 3300005530 Ga0070679_100115250 Ga0070679_1001152502 227
349 3300005530 Ga0070679_100246162 Ga0070679_1002461622 227
350 3300005535 Ga0070684_100027389 Ga0070684_1000273892 227
351 3300005539 Ga0068853_100099331 Ga0068853_1000993312 227
352 3300005539 Ga0068853_100119701 Ga0068853_1001197011 227
353 3300005563 Ga0068855_100011227 Ga0068855_1000112272 227
354 3300005563 Ga0068855_100113175 Ga0068855_1001131752 227
355 3300005577 Ga0068857_100010098 Ga0068857_1000100986 227
356 3300005577 Ga0068857_100120912 Ga0068857_1001209122 227
357 3300005614 Ga0068856_100013888 Ga0068856_1000138882 227
358 3300005617 Ga0068859_100653949 Ga0068859_1006539492 227
359 3300005842 Ga0068858_100455513 Ga0068858_1004555132 227
360 3300005981 Ga0081538_10054215 Ga0081538_100542152 227
361 3300005983 Ga0081540_1027667 Ga0081540_10276672 227
362 3300006177 Ga0075362_10223774 Ga0075362_102237742 227
363 3300006844 Ga0075428_100012065 Ga0075428_1000120656 227
364 3300006844 Ga0075428_100076653 Ga0075428_1000766534 227
365 3300006846 Ga0075430_100177911 Ga0075430_1001779112 227
366 3300006847 Ga0075431_100251355 Ga0075431_1002513552 227
367 3300006880 Ga0075429_100040898 Ga0075429_1000408982 227
368 3300006931 Ga0097620_100653917 Ga0097620_1006539172 227
369 3300009094 Ga0111539_10197704 Ga0111539_101977042 227
370 3300009094 Ga0111539_10532298 Ga0111539_105322982 227
371 3300009094 Ga0111539_11142267 Ga0111539_111422672 227
372 3300009147 Ga0114129_10182171 Ga0114129_101821713 227
373 3300009174 Ga0105241_10022885 Ga0105241_100228855 227
374 3300009551 Ga0105238_10001647 Ga0105238_1000164719 227
375 3300009553 Ga0105249_10038484 Ga0105249_100384845 227
376 3300011119 Ga0105246_10001097 Ga0105246_100010972 227
377 3300013100 Ga0157373_10057541 Ga0157373_100575412 227
378 3300013102 Ga0157371_10003387 Ga0157371_1000338714 227
379 3300013102 Ga0157371_10077203 Ga0157371_100772032 227
380 3300013104 Ga0157370_10010525 Ga0157370_100105252 227
381 3300013104 Ga0157370_10414220 Ga0157370_104142202 227
382 3300013105 Ga0157369_10012278 Ga0157369_100122788 227
383 3300013306 Ga0163162_10045846 Ga0163162_100458462 227
384 3300013306 Ga0163162_10055796 Ga0163162_100557964 227
385 3300013308 Ga0157375_10030301 Ga0157375_100303011 227
386 3300013308 Ga0157375_10305432 Ga0157375_103054323 227
387 3300013308 Ga0157375_10760398 Ga0157375_107603982 227
388 3300014745 Ga0157377_10356845 Ga0157377_103568451 227
389 3300025903 Ga0207680_10000005 Ga0207680_10000005260 227
390 3300025909 Ga0207705_10059548 Ga0207705_100595481 227
391 3300025909 Ga0207705_10159051 Ga0207705_101590511 227
392 3300025909 Ga0207705_10165394 Ga0207705_101653942 227
393 3300025911 Ga0207654_10062946 Ga0207654_100629462 227
394 3300025915 Ga0207693_10240680 Ga0207693_102406802 227
395 3300025917 Ga0207660_10049493 Ga0207660_100494931 227
396 3300025919 Ga0207657_10000130 Ga0207657_100001302 227
397 3300025919 Ga0207657_10012811 Ga0207657_100128117 227
398 3300025919 Ga0207657_10049350 Ga0207657_100493502 227
399 3300025920 Ga0207649_10024448 Ga0207649_100244482 227
400 3300025921 Ga0207652_10002475 Ga0207652_1000247511 227
401 3300025921 Ga0207652_10048532 Ga0207652_100485321 227
402 3300025921 Ga0207652_10118512 Ga0207652_101185122 227
403 3300025921 Ga0207652_10177634 Ga0207652_101776342 227
404 3300025924 Ga0207694_10005178 Ga0207694_100051785 227
405 3300025932 Ga0207690_10004610 Ga0207690_100046106 227
406 3300025932 Ga0207690_10085003 Ga0207690_100850032 227
407 3300025932 Ga0207690_10299716 Ga0207690_102997162 227
408 3300025933 Ga0207706_10000334 Ga0207706_1000033435 227
409 3300025933 Ga0207706_10023344 Ga0207706_100233446 227
410 3300025933 Ga0207706_10143114 Ga0207706_101431142 227
411 3300025944 Ga0207661_10028835 Ga0207661_100288353 227
412 3300025944 Ga0207661_10255843 Ga0207661_102558431 227
413 3300025945 Ga0207679_10201482 Ga0207679_102014822 227
414 3300025949 Ga0207667_10004481 Ga0207667_1000448114 227
415 3300025949 Ga0207667_10014936 Ga0207667_100149362 227
416 3300025949 Ga0207667_10245893 Ga0207667_102458933 227
417 3300025961 Ga0207712_10206040 Ga0207712_102060402 227
418 3300025981 Ga0207640_10056337 Ga0207640_100563372 227
419 3300025986 Ga0207658_10090331 Ga0207658_100903312 227
420 3300026035 Ga0207703_10410709 Ga0207703_104107092 227
421 3300026041 Ga0207639_10017276 Ga0207639_100172762 227
422 3300026041 Ga0207639_10093814 Ga0207639_100938142 227
423 3300026067 Ga0207678_10024413 Ga0207678_100244132 227
424 3300026067 Ga0207678_10175475 Ga0207678_101754752 227
425 3300026078 Ga0207702_10048001 Ga0207702_100480012 227
426 3300026116 Ga0207674_10074272 Ga0207674_100742721 227
427 3300026116 Ga0207674_10094377 Ga0207674_100943772 227
428 3300026121 Ga0207683_10208752 Ga0207683_102087522 227
429 3300026142 Ga0207698_10063680 Ga0207698_100636802 227
430 3300026142 Ga0207698_10970042 Ga0207698_109700421 227
431 3300027907 Ga0207428_10094626 Ga0207428_100946262 227
432 3300028379 Ga0268266_10000004 Ga0268266_100000041265 227
433 3300031995 Ga0307409_100356336 Ga0307409_1003563362 227
434 3300042005 Ga0439448_0065312 Ga0439448_0065312_314_997 227
435 3300042993 Ga0439440_0017369 Ga0439440_0017369_407_1090 227
436 3300046477 Ga0495664_0449437 Ga0495664_0449437_32_715 227
437 3300047472 Ga0495686_0035780 Ga0495686_0035780_560_1243 227
438 3300047472 Ga0495686_0231889 Ga0495686_0231889_346_1029 227
439 3300048924 Ga0496121_0053510 Ga0496121_0053510_2055_2744 227
440 3300048928 Ga0496125_0016314 Ga0496125_0016314_2044_2733 227
441 3300048929 Ga0496126_0009327 Ga0496126_0009327_915_1604 227
442 3300049569 Ga0501032_0009864 Ga0501032_0009864_1532_2215 227
443 3300049569 Ga0501032_0011608 Ga0501032_0011608_2612_3295 227
444 3300049570 Ga0501033_0013133 Ga0501033_0013133_2161_2844 227
445 3300049571 Ga0501034_0027600 Ga0501034_0027600_1657_2340 227
446 3300049571 Ga0501034_0467976 Ga0501034_0467976_263_946 227
447 3300049572 Ga0501036_0020147 Ga0501036_0020147_2500_3183 227
448 3300049572 Ga0501036_0192483 Ga0501036_0192483_39_722 227
449 3300049573 Ga0501037_0010988 Ga0501037_0010988_4233_4916 227
450 3300049573 Ga0501037_0129106 Ga0501037_0129106_819_1502 227
451 3300049574 Ga0501038_0011112 Ga0501038_0011112_1937_2620 227
452 3300049575 Ga0501039_0144482 Ga0501039_0144482_67_750 227
453 3300049576 Ga0501040_0128389 Ga0501040_0128389_526_1209 227
454 3300049579 Ga0501043_0020406 Ga0501043_0020406_2711_3394 227
455 3300049579 Ga0501043_0145470 Ga0501043_0145470_576_1259 227
456 3300049582 Ga0501048_0148935 Ga0501048_0148935_467_1150 227
457 3300049583 Ga0501067_0000123 Ga0501067_0000123_6804_7487 227
458 3300049584 Ga0501068_0001446 Ga0501068_0001446_6984_7667 227
459 3300049586 Ga0501070_0001913 Ga0501070_0001913_1142_1825 227
460 3300049587 Ga0501071_0216576 Ga0501071_0216576_557_1240 227
461 3300049588 Ga0501072_0440301 Ga0501072_0440301_143_826 227
462 3300049589 Ga0501073_0000002 Ga0501073_0000002_85354_86037 227
463 3300049591 Ga0501075_0121951 Ga0501075_0121951_515_1198 227
464 3300049592 Ga0501076_0195906 Ga0501076_0195906_741_1424 227
465 3300049593 Ga0501077_0000010 Ga0501077_0000010_10928_11611 227
466 3300049669 Ga0501235_042596 Ga0501235_042596_320_1003 227
467 3300049742 Ga0501080_0380565 Ga0501080_0380565_273_956 227
468 3300049822 Ga0501035_0005615 Ga0501035_0005615_5947_6630 227
469 3300049823 Ga0501044_0003354 Ga0501044_0003354_16860_17543 227
470 3300049823 Ga0501044_0061784 Ga0501044_0061784_2700_3383 227
471 3300049823 Ga0501044_0270351 Ga0501044_0270351_219_902 227
472 3300049823 Ga0501044_0422850 Ga0501044_0422850_485_1168 227
473 3300049824 Ga0501045_0195340 Ga0501045_0195340_480_1163 227
474 3300050489 nmdc:mga03683_232840_c1 nmdc:mga03683_232840_c1_63_746 227
475 3300050507 nmdc:mga05p37_12350_c2 nmdc:mga05p37_12350_c2_420_1103 227
476 3300050507 nmdc:mga05p37_52874_c1 nmdc:mga05p37_52874_c1_181_864 227
477 3300050508 nmdc:mga09592_55714_c1 nmdc:mga09592_55714_c1_2470_3153 227
478 3300050509 nmdc:mga0qj67_132886_c1 nmdc:mga0qj67_132886_c1_621_1304 227
479 3300050509 nmdc:mga0qj67_209139_c1 nmdc:mga0qj67_209139_c1_73_756 227
480 3300050510 nmdc:mga06r32_369290_c1 nmdc:mga06r32_369290_c1_397_1080 227
481 3300050510 nmdc:mga06r32_67854_c1 nmdc:mga06r32_67854_c1_2082_2765 227
482 3300050511 nmdc:mga08y16_325944_c1 nmdc:mga08y16_325944_c1_229_912 227
483 3300050512 nmdc:mga0n895_179195_c1 nmdc:mga0n895_179195_c1_1112_1795 227
484 3300050515 nmdc:mga0a205_272753_c1 nmdc:mga0a205_272753_c1_790_1473 227
485 3300050515 nmdc:mga0a205_588926_c1 nmdc:mga0a205_588926_c1_57_740 227
486 3300053108 Ga0500562_050361 Ga0500562_050361_262_945 227
487 3300060353 Ga0501082_0389044 Ga0501082_0389044_65_748 227
488 3300061734 Ga0530510_0150735 Ga0530510_0150735_412_1095 227
489 3300003203 JGI25406J46586_10000370 JGI25406J46586_1000037010 228
490 3300005985 Ga0081539_10000248 Ga0081539_1000024867 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

111

206

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9638 2 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.949 1 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9419 1 226
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9275 2 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9259 1 226
ID Description Score Start End Superfamily
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9514 2 177 2.60.120.620
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9188 2 177 2.60.120.620
2c0sA00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.9032 183 222 4.10.280.10
af_Q58358_1_191_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8248 182 222 1.10.287.1490
af_Q92982_38_139_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8245 182 222 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A377TSW3-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9963 110 190 GO:0006879
GO:0006974
GO:0016706
AF-A0A2X3F8N6-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9935 110 174 GO:0006879
GO:0006974
GO:0016706
AF-A0A6I1IRX1-F1-model_v4 deleted 0.9895 29 184
AF-A0A1H8NHS7-F1-model_v4 PKHD-type hydroxylase 0.9869 1 199 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A399IX52-F1-model_v4 Fe2+-dependent dioxygenase 0.9865 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418

Feature Viewer

pLDDT pTM Quality
95.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map