F453618

General Info

Members Datasets Scaffolds Average Seq Length
488 267 976 195

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10154706|Ga0207658_101547062
Length 221
Sequence VGLGGCTGSCWRSWNVRNRLEGQSGPVTPLFPLNTVLFPGGPLPLRIFEPRYVDMVRHCMRAHCPFGVLLIRAGSEVGAAGAGQLSVVGTTARIVDFNALPDGLLGITCIGERKFSVSKHWQQDDGLHVGDIELAAPEEPTDLPGEYHHLGELLRKVLPELGDLYCNVPKHFSDAAWVGCRLAEILPIALSEKQYCLELDDPIARLARLNPLIRKSDDERD

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
60 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
157 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
158 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
161 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
162 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
163 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
164 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
257 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
267 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.2
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 2.25
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10154706 3300025986 Bacteria 1872
2 JGI25406J46586_10001949 3300003203 Bacteria 9755
3 rootL2_10299225 3300003322 Bacteria 2695
4 Ga0070683_100008496 3300005329 Bacteria 8723
5 Ga0070670_100172253 3300005331 Bacteria 1878
6 Ga0068869_100440159 3300005334 Bacteria 1079
7 Ga0070680_100009183 3300005336 Bacteria 7583
8 Ga0070680_100140862 3300005336 Bacteria 2022
9 Ga0070680_100284412 3300005336 Bacteria 1401
10 Ga0070682_100014880 3300005337 Bacteria 4503
11 Ga0070682_100106962 3300005337 Bacteria 1857
12 Ga0070689_100119760 3300005340 Bacteria 2101
13 Ga0070691_10100663 3300005341 Bacteria 1435
14 Ga0070691_10462415 3300005341 Bacteria 727
15 Ga0070692_10010086 3300005345 Bacteria 4285
16 Ga0070668_100492760 3300005347 Bacteria 1060
17 Ga0070669_100276316 3300005353 Bacteria 1345
18 Ga0070669_100416470 3300005353 Bacteria 1102
19 Ga0070675_100013217 3300005354 Bacteria 6486
20 Ga0070675_100105152 3300005354 Bacteria 2382
21 Ga0070675_100195204 3300005354 Bacteria 1756
22 Ga0070671_100337208 3300005355 Bacteria 1286
23 Ga0070674_100093548 3300005356 Bacteria 2175
24 Ga0070673_100356770 3300005364 Bacteria 1299
25 Ga0070667_100249622 3300005367 Bacteria 1586
26 Ga0070713_100106500 3300005436 Bacteria 2437
27 Ga0070681_10049161 3300005458 Bacteria 4213
28 Ga0068867_100310945 3300005459 Bacteria 1302
29 Ga0068867_100674970 3300005459 Bacteria 909
30 Ga0068853_100111763 3300005539 Bacteria 2427
31 Ga0070696_100145552 3300005546 Unclassified 1735
32 Ga0070696_100831591 3300005546 Bacteria 762
33 Ga0070665_100001413 3300005548 Bacteria 28206
34 Ga0070665_100002995 3300005548 Bacteria 18235
35 Ga0070665_100025812 3300005548 Bacteria 5917
36 Ga0070665_100033145 3300005548 Bacteria 5197
37 Ga0070665_100224829 3300005548 Bacteria 1877
38 Ga0070704_100035304 3300005549 Bacteria 3398
39 Ga0070704_100092595 3300005549 Bacteria 2257
40 Ga0068855_100846050 3300005563 Bacteria 970
41 Ga0068857_100938961 3300005577 Bacteria 831
42 Ga0068856_100368411 3300005614 Bacteria 1455
43 Ga0068856_100716322 3300005614 Bacteria 1021
44 Ga0068859_100014733 3300005617 Bacteria 7858
45 Ga0068859_100194935 3300005617 Bacteria 2110
46 Ga0068859_100420336 3300005617 Bacteria 1433
47 Ga0068859_100437107 3300005617 Unclassified 1405
48 Ga0068864_100795094 3300005618 Bacteria 929
49 Ga0068861_100017836 3300005719 Bacteria 5044
50 Ga0068863_100000710 3300005841 Bacteria 33475
51 Ga0068858_100005704 3300005842 Bacteria 12167
52 Ga0068858_100334657 3300005842 Bacteria 1448
53 Ga0068858_100713375 3300005842 Bacteria 976
54 Ga0068860_100003226 3300005843 Bacteria 16817
55 Ga0068862_100014951 3300005844 Bacteria 6446
56 Ga0068862_100066678 3300005844 Bacteria 3102
57 Ga0081455_10000098 3300005937 Bacteria 95177
58 Ga0081539_10000006 3300005985 Bacteria 534555
59 Ga0097621_100205564 3300006237 Bacteria 1711
60 Ga0097621_100305608 3300006237 Bacteria 1406
61 Ga0097621_100712617 3300006237 Bacteria 925
62 Ga0068871_100665274 3300006358 Bacteria 952
63 Ga0075428_100001452 3300006844 Bacteria 25354
64 Ga0075428_100034339 3300006844 Bacteria 5595
65 Ga0075430_100104001 3300006846 Bacteria 2370
66 Ga0075433_10020947 3300006852 Bacteria 5476
67 Ga0075434_100004854 3300006871 Bacteria 12183
68 Ga0068865_100060667 3300006881 Bacteria 2649
69 Ga0068865_100077034 3300006881 Bacteria 2382
70 Ga0097620_100014733 3300006931 Bacteria 7858
71 Ga0097620_100194925 3300006931 Bacteria 2110
72 Ga0097620_100420346 3300006931 Bacteria 1433
73 Ga0097620_100437115 3300006931 Unclassified 1405
74 Ga0075435_100038815 3300007076 Bacteria 3798
75 Ga0099795_10000209 3300007788 Bacteria 10049
76 Ga0105250_10005106 3300009092 Bacteria 5929
77 Ga0105240_10021123 3300009093 Bacteria 8665
78 Ga0105240_10028297 3300009093 Bacteria 7322
79 Ga0105240_10121966 3300009093 Bacteria 3138
80 Ga0105240_10944084 3300009093 Unclassified 925
81 Ga0111539_10003177 3300009094 Bacteria 21748
82 Ga0111539_10012453 3300009094 Bacteria 10661
83 Ga0111539_10033169 3300009094 Bacteria 6270
84 Ga0105247_10001109 3300009101 Bacteria 20061
85 Ga0105247_10012626 3300009101 Bacteria 5072
86 Ga0114129_10319605 3300009147 Bacteria 2064
87 Ga0114129_11680228 3300009147 Bacteria 775
88 Ga0105243_10582259 3300009148 Bacteria 1074
89 Ga0105241_10327053 3300009174 Bacteria 1324
90 Ga0105248_10034899 3300009177 Bacteria 5628
91 Ga0105248_10168637 3300009177 Bacteria 2467
92 Ga0105237_10290489 3300009545 Bacteria 1638
93 Ga0105237_10747241 3300009545 Bacteria 985
94 Ga0105237_11163655 3300009545 Bacteria 778
95 Ga0105238_10028904 3300009551 Bacteria 5648
96 Ga0105238_10211708 3300009551 Bacteria 1914
97 Ga0105238_10538531 3300009551 Bacteria 1171
98 Ga0105238_10778787 3300009551 Unclassified 971
99 Ga0105249_10018720 3300009553 Bacteria 6167
100 Ga0105249_10226180 3300009553 Bacteria 1843
101 Ga0105030_100645 3300009987 Bacteria 3087
102 Ga0105028_111189 3300009993 Bacteria 944
103 Ga0099796_10000016 3300010159 Bacteria 50556
104 Ga0105239_11110055 3300010375 Bacteria 911
105 Ga0105246_10248883 3300011119 Bacteria 1409
106 Ga0157369_10155011 3300013105 Bacteria 2420
107 Ga0157378_10587923 3300013297 Bacteria 1123
108 Ga0163162_10031073 3300013306 Bacteria 5295
109 Ga0163162_10080531 3300013306 Bacteria 3325
110 Ga0157372_11088874 3300013307 Unclassified 924
111 Ga0163163_10369102 3300014325 Bacteria 1492
112 Ga0163163_10812956 3300014325 Unclassified 998
113 Ga0163163_10994931 3300014325 Bacteria 902
114 Ga0157380_10003771 3300014326 Bacteria 10421
115 Ga0157380_10024508 3300014326 Bacteria 4567
116 Ga0157380_11172816 3300014326 Bacteria 810
117 Ga0157377_10116058 3300014745 Bacteria 1616
118 Ga0157379_10016416 3300014968 Bacteria 6514
119 Ga0157379_10166210 3300014968 Bacteria 1991
120 Ga0157379_10483817 3300014968 Bacteria 1146
121 Ga0213874_10021863 3300021377 Bacteria 1769
122 Ga0207656_10034529 3300025321 Bacteria 2112
123 Ga0207710_10014801 3300025900 Bacteria 3294
124 Ga0207680_10299206 3300025903 Bacteria 1121
125 Ga0207645_10492162 3300025907 Bacteria 830
126 Ga0207643_10057772 3300025908 Bacteria 2209
127 Ga0207707_10061810 3300025912 Bacteria 3259
128 Ga0207707_10087289 3300025912 Bacteria 2726
129 Ga0207695_10043937 3300025913 Bacteria 4757
130 Ga0207695_10115251 3300025913 Bacteria 2662
131 Ga0207695_10187408 3300025913 Bacteria 1987
132 Ga0207695_10573401 3300025913 Bacteria 1010
133 Ga0207671_10120550 3300025914 Bacteria 2005
134 Ga0207671_10725993 3300025914 Bacteria 790
135 Ga0207660_10022266 3300025917 Bacteria 4269
136 Ga0207681_10278512 3300025923 Bacteria 1316
137 Ga0207694_10156930 3300025924 Bacteria 1836
138 Ga0207694_10578469 3300025924 Bacteria 944
139 Ga0207650_10302986 3300025925 Bacteria 1305
140 Ga0207659_10012006 3300025926 Bacteria 5488
141 Ga0207659_10362965 3300025926 Bacteria 1204
142 Ga0207700_10445909 3300025928 Unclassified 1140
143 Ga0207644_10013213 3300025931 Bacteria 5500
144 Ga0207709_10312782 3300025935 Bacteria 1172
145 Ga0207670_10083107 3300025936 Bacteria 2245
146 Ga0207704_10074300 3300025938 Bacteria 2169
147 Ga0207691_10299223 3300025940 Bacteria 1382
148 Ga0207711_10209074 3300025941 Bacteria 1782
149 Ga0207711_10313948 3300025941 Bacteria 1447
150 Ga0207689_10158618 3300025942 Bacteria 1865
151 Ga0207689_10405378 3300025942 Bacteria 1137
152 Ga0207667_10489265 3300025949 Bacteria 1248
153 Ga0207667_10598965 3300025949 Bacteria 1112
154 Ga0207651_10062120 3300025960 Bacteria 2602
155 Ga0207712_10017878 3300025961 Bacteria 4612
156 Ga0207712_10031255 3300025961 Bacteria 3584
157 Ga0207668_10325987 3300025972 Bacteria 1276
158 Ga0207658_10213190 3300025986 Bacteria 1620
159 Ga0207703_10000722 3300026035 Bacteria 32472
160 Ga0207703_10001413 3300026035 Bacteria 21871
161 Ga0207703_10540229 3300026035 Bacteria 1098
162 Ga0207678_10016811 3300026067 Bacteria 6425
163 Ga0207708_10025607 3300026075 Bacteria 4465
164 Ga0207708_10277817 3300026075 Bacteria 1356
165 Ga0207641_10005051 3300026088 Bacteria 11305
166 Ga0207641_10106399 3300026088 Bacteria 2479
167 Ga0207648_10074389 3300026089 Bacteria 2961
168 Ga0207648_10346276 3300026089 Bacteria 1339
169 Ga0207676_10936363 3300026095 Bacteria 851
170 Ga0207674_10686842 3300026116 Unclassified 988
171 Ga0207675_100008456 3300026118 Bacteria 9698
172 Ga0207675_100486638 3300026118 Unclassified 1227
173 Ga0207675_100526750 3300026118 Bacteria 1179
174 Ga0207698_10074091 3300026142 Bacteria 2714
175 Ga0209179_1000101 3300027512 Bacteria 11479
176 Ga0209971_1008567 3300027682 Bacteria 2427
177 Ga0207428_10011229 3300027907 Bacteria 7941
178 Ga0207428_10327238 3300027907 Bacteria 1131
179 Ga0268266_10000228 3300028379 Bacteria 97214
180 Ga0268266_10001374 3300028379 Bacteria 29323
181 Ga0268266_10023480 3300028379 Bacteria 5252
182 Ga0268266_10062277 3300028379 Bacteria 3219
183 Ga0268266_10080761 3300028379 Bacteria 2833
184 Ga0268265_10088591 3300028380 Bacteria 2466
185 Ga0268265_10873887 3300028380 Bacteria 881
186 Ga0268264_10000415 3300028381 Bacteria 60291
187 Ga0265334_10091630 3300028573 Bacteria 1108
188 Ga0307515_10024827 3300028794 Bacteria 10410
189 Ga0307511_10000105 3300030521 Bacteria 75047
190 Ga0307511_10015359 3300030521 Bacteria 7419
191 Ga0265328_10003323 3300031239 Bacteria 7110
192 Ga0265328_10111467 3300031239 Bacteria 1017
193 Ga0265340_10048531 3300031247 Bacteria 2064
194 Ga0265331_10011291 3300031250 Bacteria 4897
195 Ga0265331_10014059 3300031250 Bacteria 4277
196 Ga0265327_10000310 3300031251 Bacteria 94368
197 Ga0307513_10108939 3300031456 Bacteria 2768
198 Ga0307509_10000554 3300031507 Bacteria 63868
199 Ga0307408_100117760 3300031548 Bacteria 2052
200 Ga0307408_100300640 3300031548 Bacteria 1344
201 Ga0307408_101024004 3300031548 Bacteria 762
202 Ga0307508_10057205 3300031616 Bacteria 3451
203 Ga0316579_10048311 3300031691 Bacteria 1988
204 Ga0316579_10076424 3300031691 Bacteria 1591
205 Ga0316576_10122006 3300031727 Unclassified 1957
206 Ga0316576_10303207 3300031727 Bacteria 1193
207 Ga0316578_10178988 3300031728 Unclassified 1278
208 Ga0307405_10076263 3300031731 Bacteria 2174
209 Ga0316577_10006857 3300031733 Bacteria 6048
210 Ga0307413_10427726 3300031824 Bacteria 1045
211 Ga0307413_10921824 3300031824 Bacteria 743
212 Ga0307518_10249440 3300031838 Bacteria 1130
213 Ga0307406_10010470 3300031901 Bacteria 5232
214 Ga0307406_10095324 3300031901 Bacteria 2013
215 Ga0307407_10031051 3300031903 Bacteria 2889
216 Ga0307416_100183560 3300032002 Bacteria 1963
217 Ga0307411_10071828 3300032005 Bacteria 2348
218 Ga0307415_100589332 3300032126 Bacteria 987
219 Ga0307415_100946852 3300032126 Bacteria 797
220 Ga0316583_10047093 3300032133 Bacteria 1521
221 Ga0316585_10007541 3300032137 Bacteria 3141
222 Ga0316593_10011815 3300032168 Bacteria 2549
223 Ga0307510_10000002 3300033180 Bacteria 801565
224 Ga0307510_10031669 3300033180 Bacteria 5969
225 Ga0373936_0046541 3300035113 Bacteria 1749
226 Ga0316574_0001470 3300035398 Bacteria 11205
227 Ga0316574_0133249 3300035398 Bacteria 1599
228 Ga0373927_0220500 3300035695 Bacteria 1246
229 Ga0316582_0000587 3300036647 Bacteria 14069
230 Ga0316582_0017099 3300036647 Bacteria 4187
231 Ga0316582_0168140 3300036647 Unclassified 1488
232 Ga0316584_0016326 3300036712 Bacteria 5322
233 Ga0316584_0036256 3300036712 Bacteria 3659
234 Ga0395900_0880042 3300037418 Bacteria 820
235 Ga0316581_0008190 3300037588 Bacteria 2834
236 Ga0316581_0051716 3300037588 Bacteria 1259
237 Ga0436365_0162689 3300039437 Bacteria 2952
238 Ga0436363_1174194 3300039450 Bacteria 2053
239 Ga0439453_0078269 3300041408 Bacteria 709
240 Ga0439461_0057697 3300041410 Bacteria 875
241 Ga0451802_1852771 3300041460 Unclassified 571
242 Ga0451839_0511961 3300041496 Bacteria 945
243 Ga0439431_0013358 3300041997 Bacteria 1894
244 Ga0439433_0016687 3300041999 Bacteria 1628
245 Ga0439448_0124094 3300042005 Bacteria 887
246 Ga0450912_016585 3300042116 Unclassified 683
247 Ga0450914_047261 3300042118 Bacteria 559
248 Ga0450920_002309 3300042122 Bacteria 3231
249 Ga0450920_021494 3300042122 Bacteria 1248
250 Ga0450923_004533 3300042125 Bacteria 2184
251 Ga0450891_003104 3300042129 Bacteria 1627
252 Ga0450895_006648 3300042132 Bacteria 950
253 Ga0450896_000004 3300042133 Bacteria 16869
254 Ga0450898_006104 3300042134 Bacteria 1842
255 Ga0450910_004570 3300042147 Bacteria 1870
256 Ga0439446_0005615 3300042156 Bacteria 3231
257 Ga0439446_0011377 3300042156 Bacteria 2415
258 Ga0450908_003792 3300042184 Bacteria 2925
259 Ga0450908_008236 3300042184 Bacteria 1954
260 Ga0439434_0010188 3300042435 Bacteria 2770
261 Ga0439434_0052160 3300042435 Bacteria 1269
262 Ga0439435_0003948 3300042436 Bacteria 3146
263 Ga0439444_0010990 3300042437 Bacteria 1457
264 Ga0439460_0111633 3300042461 Bacteria 887
265 Ga0450916_003473 3300042530 Bacteria 1730
266 Ga0451577_0044399 3300042876 Bacteria 3979
267 Ga0451577_0345774 3300042876 Bacteria 1349
268 Ga0466969_0001454 3300044656 Bacteria 12735
269 Ga0466969_0016507 3300044656 Bacteria 3863
270 Ga0466965_0249439 3300044683 Bacteria 952
271 Ga0466966_0010169 3300044684 Bacteria 6242
272 Ga0466966_0024936 3300044684 Bacteria 3910
273 Ga0466961_0022135 3300044693 Bacteria 4089
274 Ga0466964_0040360 3300044706 Bacteria 1884
275 Ga0453684_1194104 3300044712 Bacteria 799
276 Ga0466971_0002114 3300044719 Bacteria 8416
277 Ga0466968_0004722 3300044735 Bacteria 5104
278 Ga0466970_0006542 3300044765 Bacteria 5825
279 Ga0466957_0003810 3300044842 Bacteria 8333
280 Ga0466960_0033716 3300044901 Bacteria 2381
281 Ga0466959_0145378 3300045049 Bacteria 1673
282 Ga0451576_1093977 3300045051 Bacteria 834
283 Ga0466958_0111649 3300045836 Bacteria 1707
284 Ga0495580_0095582 3300046472 Bacteria 2067
285 Ga0495606_0024586 3300046507 Bacteria 4336
286 Ga0495606_0086497 3300046507 Bacteria 1937
287 Ga0495628_0098781 3300046516 Bacteria 2255
288 Ga0495632_0238827 3300046519 Bacteria 818
289 Ga0495611_0035321 3300046648 Bacteria 2214
290 Ga0495649_0076655 3300046694 Bacteria 1790
291 Ga0496102_0003825 3300048905 Bacteria 12732
292 Ga0496102_0063280 3300048905 Bacteria 3387
293 Ga0496103_0317839 3300048906 Bacteria 1001
294 Ga0496107_0281538 3300048910 Bacteria 1238
295 Ga0496108_1109727 3300048911 Unclassified 672
296 Ga0496112_0017663 3300048915 Bacteria 6710
297 Ga0496112_0343975 3300048915 Bacteria 1434
298 Ga0496113_0483785 3300048916 Bacteria 994
299 Ga0496115_0104060 3300048918 Bacteria 2330
300 Ga0496115_0254234 3300048918 Bacteria 1446
301 Ga0496116_0011012 3300048919 Bacteria 7526
302 Ga0496117_0000135 3300048920 Bacteria 160708
303 Ga0496117_0216780 3300048920 Bacteria 1068
304 Ga0496118_0000098 3300048921 Bacteria 160610
305 Ga0496119_0011363 3300048922 Bacteria 7386
306 Ga0496119_0018850 3300048922 Bacteria 5112
307 Ga0496120_0005202 3300048923 Bacteria 10487
308 Ga0496121_0001196 3300048924 Bacteria 45454
309 Ga0496121_0050720 3300048924 Bacteria 3502
310 Ga0496124_0003009 3300048927 Bacteria 21084
311 Ga0496124_0039806 3300048927 Bacteria 4070
312 Ga0496125_0000653 3300048928 Bacteria 57890
313 Ga0496125_0008812 3300048928 Bacteria 10492
314 Ga0496125_0056846 3300048928 Bacteria 3173
315 Ga0496125_0263805 3300048928 Bacteria 1078
316 Ga0496126_0003322 3300048929 Bacteria 20463
317 Ga0496126_0080196 3300048929 Bacteria 2888
318 Ga0496126_0109859 3300048929 Bacteria 2403
319 Ga0495682_0159029 3300049460 Unclassified 805
320 Ga0501031_0019000 3300049568 Bacteria 4474
321 Ga0501032_0022201 3300049569 Bacteria 4403
322 Ga0501032_0069558 3300049569 Bacteria 2349
323 Ga0501033_0048830 3300049570 Bacteria 3143
324 Ga0501033_0235013 3300049570 Bacteria 1301
325 Ga0501036_0006670 3300049572 Bacteria 9386
326 Ga0501036_0008919 3300049572 Bacteria 8242
327 Ga0501036_0149364 3300049572 Bacteria 1971
328 Ga0501037_0026856 3300049573 Bacteria 4252
329 Ga0501037_0104921 3300049573 Bacteria 2037
330 Ga0501037_0411657 3300049573 Bacteria 926
331 Ga0501038_0005001 3300049574 Bacteria 12310
332 Ga0501038_0027213 3300049574 Bacteria 5090
333 Ga0501038_0060972 3300049574 Bacteria 3227
334 Ga0501038_0611284 3300049574 Bacteria 824
335 Ga0501039_0009395 3300049575 Bacteria 7453
336 Ga0501039_0017302 3300049575 Bacteria 5530
337 Ga0501039_0017863 3300049575 Bacteria 5441
338 Ga0501039_0062444 3300049575 Bacteria 2886
339 Ga0501039_0064235 3300049575 Bacteria 2845
340 Ga0501039_0104641 3300049575 Bacteria 2210
341 Ga0501039_0144575 3300049575 Bacteria 1869
342 Ga0501040_0003295 3300049576 Bacteria 10434
343 Ga0501040_0016219 3300049576 Bacteria 4926
344 Ga0501040_0049710 3300049576 Bacteria 2867
345 Ga0501040_0101089 3300049576 Bacteria 2011
346 Ga0501040_0158308 3300049576 Bacteria 1600
347 Ga0501040_0248943 3300049576 Bacteria 1267
348 Ga0501040_0544989 3300049576 Bacteria 837
349 Ga0501041_0002841 3300049577 Bacteria 9908
350 Ga0501041_0004231 3300049577 Bacteria 8310
351 Ga0501041_0005550 3300049577 Bacteria 7377
352 Ga0501041_0010802 3300049577 Bacteria 5386
353 Ga0501041_0028145 3300049577 Bacteria 3389
354 Ga0501041_0170029 3300049577 Bacteria 1364
355 Ga0501042_0008617 3300049578 Bacteria 6748
356 Ga0501042_0180248 3300049578 Bacteria 1524
357 Ga0501042_0212331 3300049578 Bacteria 1396
358 Ga0501043_0066030 3300049579 Bacteria 2841
359 Ga0501043_0739456 3300049579 Bacteria 716
360 Ga0501046_0017633 3300049580 Bacteria 5954
361 Ga0501046_0042005 3300049580 Bacteria 3646
362 Ga0501046_0043471 3300049580 Bacteria 3577
363 Ga0501046_0203474 3300049580 Bacteria 1472
364 Ga0501046_0222696 3300049580 Bacteria 1396
365 Ga0501046_0272683 3300049580 Bacteria 1241
366 Ga0501046_0707717 3300049580 Bacteria 709
367 Ga0501048_0003031 3300049582 Bacteria 12824
368 Ga0501048_0014956 3300049582 Bacteria 5740
369 Ga0501048_0021937 3300049582 Bacteria 4674
370 Ga0501048_0075879 3300049582 Bacteria 2372
371 Ga0501067_0027377 3300049583 Bacteria 3158
372 Ga0501068_0012853 3300049584 Bacteria 4756
373 Ga0501068_0139115 3300049584 Bacteria 1521
374 Ga0501069_0023105 3300049585 Bacteria 3388
375 Ga0501071_0003312 3300049587 Bacteria 10059
376 Ga0501071_0004183 3300049587 Bacteria 9134
377 Ga0501071_0010710 3300049587 Bacteria 6150
378 Ga0501071_0016760 3300049587 Bacteria 5040
379 Ga0501071_0073317 3300049587 Bacteria 2497
380 Ga0501071_0289594 3300049587 Bacteria 1240
381 Ga0501071_0419886 3300049587 Bacteria 1022
382 Ga0501072_0000996 3300049588 Bacteria 20934
383 Ga0501072_0016993 3300049588 Bacteria 5591
384 Ga0501072_0017890 3300049588 Bacteria 5450
385 Ga0501072_0057328 3300049588 Bacteria 3069
386 Ga0501072_0270308 3300049588 Bacteria 1353
387 Ga0501072_0321270 3300049588 Bacteria 1230
388 Ga0501072_0372147 3300049588 Bacteria 1134
389 Ga0501073_0001609 3300049589 Bacteria 16719
390 Ga0501073_0159911 3300049589 Bacteria 1561
391 Ga0501074_0018246 3300049590 Bacteria 5098
392 Ga0501074_0046297 3300049590 Bacteria 3145
393 Ga0501074_0142224 3300049590 Bacteria 1716
394 Ga0501074_0643902 3300049590 Bacteria 749
395 Ga0501074_0708269 3300049590 Bacteria 710
396 Ga0501075_0004317 3300049591 Bacteria 9618
397 Ga0501075_0015644 3300049591 Bacteria 5447
398 Ga0501075_0095196 3300049591 Bacteria 2260
399 Ga0501075_0105842 3300049591 Bacteria 2138
400 Ga0501075_0109552 3300049591 Bacteria 2099
401 Ga0501075_0205313 3300049591 Bacteria 1503
402 Ga0501076_0005514 3300049592 Bacteria 9116
403 Ga0501076_0008194 3300049592 Bacteria 7653
404 Ga0501076_0035611 3300049592 Bacteria 3894
405 Ga0501076_0091364 3300049592 Bacteria 2449
406 Ga0501076_0157539 3300049592 Bacteria 1849
407 Ga0501076_0206030 3300049592 Bacteria 1606
408 Ga0501076_0743801 3300049592 Bacteria 809
409 Ga0501077_0005147 3300049593 Bacteria 7944
410 Ga0501077_0026796 3300049593 Bacteria 3659
411 Ga0501077_0039540 3300049593 Bacteria 3005
412 Ga0501077_0061927 3300049593 Bacteria 2374
413 Ga0501079_0005368 3300049741 Bacteria 9546
414 Ga0501079_0041900 3300049741 Bacteria 3535
415 Ga0501079_0044584 3300049741 Bacteria 3422
416 Ga0501079_0071602 3300049741 Bacteria 2679
417 Ga0501079_0164367 3300049741 Bacteria 1731
418 Ga0501079_0165847 3300049741 Bacteria 1723
419 Ga0501079_0692724 3300049741 Bacteria 802
420 Ga0501080_0003570 3300049742 Bacteria 13691
421 Ga0501080_0015979 3300049742 Bacteria 6925
422 Ga0501080_0018508 3300049742 Bacteria 6443
423 Ga0501080_0032228 3300049742 Bacteria 4886
424 Ga0501081_0013333 3300049743 Bacteria 5406
425 Ga0501081_0013526 3300049743 Bacteria 5364
426 Ga0501081_0018680 3300049743 Bacteria 4607
427 Ga0501081_0028332 3300049743 Bacteria 3779
428 Ga0501081_0145693 3300049743 Bacteria 1699
429 Ga0501081_0484209 3300049743 Bacteria 921
430 Ga0501081_0619801 3300049743 Bacteria 810
431 Ga0501083_0023184 3300049744 Bacteria 4306
432 Ga0501083_0240525 3300049744 Bacteria 1178
433 Ga0501035_0011674 3300049822 Bacteria 8142
434 Ga0501035_0016594 3300049822 Bacteria 6790
435 Ga0501035_0068370 3300049822 Bacteria 3150
436 Ga0501035_0435984 3300049822 Bacteria 1086
437 Ga0501044_0304445 3300049823 Bacteria 1522
438 Ga0501045_0000433 3300049824 Bacteria 25593
439 Ga0501045_0004522 3300049824 Bacteria 9612
440 Ga0501045_0009000 3300049824 Bacteria 6975
441 Ga0501045_0186450 3300049824 Bacteria 1546
442 Ga0501045_0205181 3300049824 Bacteria 1468
443 nmdc:mga05p37_292338_c1 3300050507 Bacteria 1939
444 nmdc:mga09592_136965_c1 3300050508 Bacteria 2109
445 nmdc:mga0qj67_57977_c1 3300050509 Bacteria 3070
446 nmdc:mga08y16_1011369_c1 3300050511 Unclassified 811
447 nmdc:mga08y16_30812_c1 3300050511 Bacteria 5642
448 nmdc:mga08y16_315564_c1 3300050511 Bacteria 1610
449 nmdc:mga0n895_3786_c1 3300050512 Bacteria 12248
450 nmdc:mga0rr50_58902_c1 3300050513 Bacteria 2881
451 nmdc:mga0rr50_839594_c1 3300050513 Bacteria 784
452 nmdc:mga0a205_300_c1 3300050515 Bacteria 32739
453 Ga0500583_0069252 3300053092 Bacteria 1684
454 Ga0500583_0190814 3300053092 Bacteria 1019
455 Ga0500641_0033988 3300053096 Bacteria 2027
456 Ga0500650_0000047 3300053098 Bacteria 40133
457 Ga0500660_079256 3300053100 Bacteria 1510
458 Ga0500594_0126232 3300053118 Bacteria 807
459 Ga0500595_005478 3300053119 Bacteria 5539
460 Ga0500595_093113 3300053119 Bacteria 870
461 Ga0500617_097920 3300053124 Bacteria 1244
462 Ga0500642_0168908 3300053130 Bacteria 1024
463 Ga0500658_0013860 3300053134 Bacteria 2981
464 Ga0500564_008348 3300053138 Bacteria 4449
465 Ga0500588_0003125 3300053146 Bacteria 3461
466 Ga0500616_0000064 3300053153 Bacteria 243072
467 Ga0500622_0006740 3300053156 Bacteria 6616
468 Ga0500637_0089500 3300053178 Bacteria 1782
469 Ga0500596_018385 3300053735 Bacteria 1049
470 Ga0501084_0006611 3300054114 Bacteria 9532
471 Ga0501084_0027347 3300054114 Bacteria 4766
472 Ga0501084_1240140 3300054114 Bacteria 625
473 Ga0501082_0002844 3300060353 Bacteria 15080
474 Ga0501082_0004184 3300060353 Bacteria 12607
475 Ga0501082_0039976 3300060353 Bacteria 4046
476 Ga0501082_0070252 3300060353 Bacteria 3015
477 Ga0501082_0160379 3300060353 Bacteria 1954
478 Ga0501082_0200334 3300060353 Bacteria 1737
479 Ga0501082_0297398 3300060353 Bacteria 1406
480 Ga0501082_0522662 3300060353 Bacteria 1037
481 Ga0501082_0773841 3300060353 Bacteria 840
482 Ga0501082_0807851 3300060353 Bacteria 820
483 Ga0466962_0013298 3300061719 Bacteria 3959
484 Ga0530510_0006701 3300061734 Bacteria 8029
485 Ga0530510_0015792 3300061734 Bacteria 5338
486 Ga0530510_0183298 3300061734 Bacteria 1553
487 2538833241 2537561836 Bacteria 3910579
488 2643832023 2643221562 Bacteria 4048635
489 Ga0207658_10154706
490 JGI25406J46586_10001949
491 rootL2_10299225
492 Ga0070683_100008496
493 Ga0070670_100172253
494 Ga0068869_100440159
495 Ga0070680_100009183
496 Ga0070680_100140862
497 Ga0070680_100284412
498 Ga0070682_100014880
499 Ga0070682_100106962
500 Ga0070689_100119760
501 Ga0070691_10100663
502 Ga0070691_10462415
503 Ga0070692_10010086
504 Ga0070668_100492760
505 Ga0070669_100276316
506 Ga0070669_100416470
507 Ga0070675_100013217
508 Ga0070675_100105152
509 Ga0070675_100195204
510 Ga0070671_100337208
511 Ga0070674_100093548
512 Ga0070673_100356770
513 Ga0070667_100249622
514 Ga0070713_100106500
515 Ga0070681_10049161
516 Ga0068867_100310945
517 Ga0068867_100674970
518 Ga0068853_100111763
519 Ga0070696_100145552
520 Ga0070696_100831591
521 Ga0070665_100001413
522 Ga0070665_100002995
523 Ga0070665_100025812
524 Ga0070665_100033145
525 Ga0070665_100224829
526 Ga0070704_100035304
527 Ga0070704_100092595
528 Ga0068855_100846050
529 Ga0068857_100938961
530 Ga0068856_100368411
531 Ga0068856_100716322
532 Ga0068859_100014733
533 Ga0068859_100194935
534 Ga0068859_100420336
535 Ga0068859_100437107
536 Ga0068864_100795094
537 Ga0068861_100017836
538 Ga0068863_100000710
539 Ga0068858_100005704
540 Ga0068858_100334657
541 Ga0068858_100713375
542 Ga0068860_100003226
543 Ga0068862_100014951
544 Ga0068862_100066678
545 Ga0081455_10000098
546 Ga0081539_10000006
547 Ga0097621_100205564
548 Ga0097621_100305608
549 Ga0097621_100712617
550 Ga0068871_100665274
551 Ga0075428_100001452
552 Ga0075428_100034339
553 Ga0075430_100104001
554 Ga0075433_10020947
555 Ga0075434_100004854
556 Ga0068865_100060667
557 Ga0068865_100077034
558 Ga0097620_100014733
559 Ga0097620_100194925
560 Ga0097620_100420346
561 Ga0097620_100437115
562 Ga0075435_100038815
563 Ga0099795_10000209
564 Ga0105250_10005106
565 Ga0105240_10021123
566 Ga0105240_10028297
567 Ga0105240_10121966
568 Ga0105240_10944084
569 Ga0111539_10003177
570 Ga0111539_10012453
571 Ga0111539_10033169
572 Ga0105247_10001109
573 Ga0105247_10012626
574 Ga0114129_10319605
575 Ga0114129_11680228
576 Ga0105243_10582259
577 Ga0105241_10327053
578 Ga0105248_10034899
579 Ga0105248_10168637
580 Ga0105237_10290489
581 Ga0105237_10747241
582 Ga0105237_11163655
583 Ga0105238_10028904
584 Ga0105238_10211708
585 Ga0105238_10538531
586 Ga0105238_10778787
587 Ga0105249_10018720
588 Ga0105249_10226180
589 Ga0105030_100645
590 Ga0105028_111189
591 Ga0099796_10000016
592 Ga0105239_11110055
593 Ga0105246_10248883
594 Ga0157369_10155011
595 Ga0157378_10587923
596 Ga0163162_10031073
597 Ga0163162_10080531
598 Ga0157372_11088874
599 Ga0163163_10369102
600 Ga0163163_10812956
601 Ga0163163_10994931
602 Ga0157380_10003771
603 Ga0157380_10024508
604 Ga0157380_11172816
605 Ga0157377_10116058
606 Ga0157379_10016416
607 Ga0157379_10166210
608 Ga0157379_10483817
609 Ga0213874_10021863
610 Ga0207656_10034529
611 Ga0207710_10014801
612 Ga0207680_10299206
613 Ga0207645_10492162
614 Ga0207643_10057772
615 Ga0207707_10061810
616 Ga0207707_10087289
617 Ga0207695_10043937
618 Ga0207695_10115251
619 Ga0207695_10187408
620 Ga0207695_10573401
621 Ga0207671_10120550
622 Ga0207671_10725993
623 Ga0207660_10022266
624 Ga0207681_10278512
625 Ga0207694_10156930
626 Ga0207694_10578469
627 Ga0207650_10302986
628 Ga0207659_10012006
629 Ga0207659_10362965
630 Ga0207700_10445909
631 Ga0207644_10013213
632 Ga0207709_10312782
633 Ga0207670_10083107
634 Ga0207704_10074300
635 Ga0207691_10299223
636 Ga0207711_10209074
637 Ga0207711_10313948
638 Ga0207689_10158618
639 Ga0207689_10405378
640 Ga0207667_10489265
641 Ga0207667_10598965
642 Ga0207651_10062120
643 Ga0207712_10017878
644 Ga0207712_10031255
645 Ga0207668_10325987
646 Ga0207658_10213190
647 Ga0207703_10000722
648 Ga0207703_10001413
649 Ga0207703_10540229
650 Ga0207678_10016811
651 Ga0207708_10025607
652 Ga0207708_10277817
653 Ga0207641_10005051
654 Ga0207641_10106399
655 Ga0207648_10074389
656 Ga0207648_10346276
657 Ga0207676_10936363
658 Ga0207674_10686842
659 Ga0207675_100008456
660 Ga0207675_100486638
661 Ga0207675_100526750
662 Ga0207698_10074091
663 Ga0209179_1000101
664 Ga0209971_1008567
665 Ga0207428_10011229
666 Ga0207428_10327238
667 Ga0268266_10000228
668 Ga0268266_10001374
669 Ga0268266_10023480
670 Ga0268266_10062277
671 Ga0268266_10080761
672 Ga0268265_10088591
673 Ga0268265_10873887
674 Ga0268264_10000415
675 Ga0265334_10091630
676 Ga0307515_10024827
677 Ga0307511_10000105
678 Ga0307511_10015359
679 Ga0265328_10003323
680 Ga0265328_10111467
681 Ga0265340_10048531
682 Ga0265331_10011291
683 Ga0265331_10014059
684 Ga0265327_10000310
685 Ga0307513_10108939
686 Ga0307509_10000554
687 Ga0307408_100117760
688 Ga0307408_100300640
689 Ga0307408_101024004
690 Ga0307508_10057205
691 Ga0316579_10048311
692 Ga0316579_10076424
693 Ga0316576_10122006
694 Ga0316576_10303207
695 Ga0316578_10178988
696 Ga0307405_10076263
697 Ga0316577_10006857
698 Ga0307413_10427726
699 Ga0307413_10921824
700 Ga0307518_10249440
701 Ga0307406_10010470
702 Ga0307406_10095324
703 Ga0307407_10031051
704 Ga0307416_100183560
705 Ga0307411_10071828
706 Ga0307415_100589332
707 Ga0307415_100946852
708 Ga0316583_10047093
709 Ga0316585_10007541
710 Ga0316593_10011815
711 Ga0307510_10000002
712 Ga0307510_10031669
713 Ga0373936_0046541
714 Ga0316574_0001470
715 Ga0316574_0133249
716 Ga0373927_0220500
717 Ga0316582_0000587
718 Ga0316582_0017099
719 Ga0316582_0168140
720 Ga0316584_0016326
721 Ga0316584_0036256
722 Ga0395900_0880042
723 Ga0316581_0008190
724 Ga0316581_0051716
725 Ga0436365_0162689
726 Ga0436363_1174194
727 Ga0439453_0078269
728 Ga0439461_0057697
729 Ga0451802_1852771
730 Ga0451839_0511961
731 Ga0439431_0013358
732 Ga0439433_0016687
733 Ga0439448_0124094
734 Ga0450912_016585
735 Ga0450914_047261
736 Ga0450920_002309
737 Ga0450920_021494
738 Ga0450923_004533
739 Ga0450891_003104
740 Ga0450895_006648
741 Ga0450896_000004
742 Ga0450898_006104
743 Ga0450910_004570
744 Ga0439446_0005615
745 Ga0439446_0011377
746 Ga0450908_003792
747 Ga0450908_008236
748 Ga0439434_0010188
749 Ga0439434_0052160
750 Ga0439435_0003948
751 Ga0439444_0010990
752 Ga0439460_0111633
753 Ga0450916_003473
754 Ga0451577_0044399
755 Ga0451577_0345774
756 Ga0466969_0001454
757 Ga0466969_0016507
758 Ga0466965_0249439
759 Ga0466966_0010169
760 Ga0466966_0024936
761 Ga0466961_0022135
762 Ga0466964_0040360
763 Ga0453684_1194104
764 Ga0466971_0002114
765 Ga0466968_0004722
766 Ga0466970_0006542
767 Ga0466957_0003810
768 Ga0466960_0033716
769 Ga0466959_0145378
770 Ga0451576_1093977
771 Ga0466958_0111649
772 Ga0495580_0095582
773 Ga0495606_0024586
774 Ga0495606_0086497
775 Ga0495628_0098781
776 Ga0495632_0238827
777 Ga0495611_0035321
778 Ga0495649_0076655
779 Ga0496102_0003825
780 Ga0496102_0063280
781 Ga0496103_0317839
782 Ga0496107_0281538
783 Ga0496108_1109727
784 Ga0496112_0017663
785 Ga0496112_0343975
786 Ga0496113_0483785
787 Ga0496115_0104060
788 Ga0496115_0254234
789 Ga0496116_0011012
790 Ga0496117_0000135
791 Ga0496117_0216780
792 Ga0496118_0000098
793 Ga0496119_0011363
794 Ga0496119_0018850
795 Ga0496120_0005202
796 Ga0496121_0001196
797 Ga0496121_0050720
798 Ga0496124_0003009
799 Ga0496124_0039806
800 Ga0496125_0000653
801 Ga0496125_0008812
802 Ga0496125_0056846
803 Ga0496125_0263805
804 Ga0496126_0003322
805 Ga0496126_0080196
806 Ga0496126_0109859
807 Ga0495682_0159029
808 Ga0501031_0019000
809 Ga0501032_0022201
810 Ga0501032_0069558
811 Ga0501033_0048830
812 Ga0501033_0235013
813 Ga0501036_0006670
814 Ga0501036_0008919
815 Ga0501036_0149364
816 Ga0501037_0026856
817 Ga0501037_0104921
818 Ga0501037_0411657
819 Ga0501038_0005001
820 Ga0501038_0027213
821 Ga0501038_0060972
822 Ga0501038_0611284
823 Ga0501039_0009395
824 Ga0501039_0017302
825 Ga0501039_0017863
826 Ga0501039_0062444
827 Ga0501039_0064235
828 Ga0501039_0104641
829 Ga0501039_0144575
830 Ga0501040_0003295
831 Ga0501040_0016219
832 Ga0501040_0049710
833 Ga0501040_0101089
834 Ga0501040_0158308
835 Ga0501040_0248943
836 Ga0501040_0544989
837 Ga0501041_0002841
838 Ga0501041_0004231
839 Ga0501041_0005550
840 Ga0501041_0010802
841 Ga0501041_0028145
842 Ga0501041_0170029
843 Ga0501042_0008617
844 Ga0501042_0180248
845 Ga0501042_0212331
846 Ga0501043_0066030
847 Ga0501043_0739456
848 Ga0501046_0017633
849 Ga0501046_0042005
850 Ga0501046_0043471
851 Ga0501046_0203474
852 Ga0501046_0222696
853 Ga0501046_0272683
854 Ga0501046_0707717
855 Ga0501048_0003031
856 Ga0501048_0014956
857 Ga0501048_0021937
858 Ga0501048_0075879
859 Ga0501067_0027377
860 Ga0501068_0012853
861 Ga0501068_0139115
862 Ga0501069_0023105
863 Ga0501071_0003312
864 Ga0501071_0004183
865 Ga0501071_0010710
866 Ga0501071_0016760
867 Ga0501071_0073317
868 Ga0501071_0289594
869 Ga0501071_0419886
870 Ga0501072_0000996
871 Ga0501072_0016993
872 Ga0501072_0017890
873 Ga0501072_0057328
874 Ga0501072_0270308
875 Ga0501072_0321270
876 Ga0501072_0372147
877 Ga0501073_0001609
878 Ga0501073_0159911
879 Ga0501074_0018246
880 Ga0501074_0046297
881 Ga0501074_0142224
882 Ga0501074_0643902
883 Ga0501074_0708269
884 Ga0501075_0004317
885 Ga0501075_0015644
886 Ga0501075_0095196
887 Ga0501075_0105842
888 Ga0501075_0109552
889 Ga0501075_0205313
890 Ga0501076_0005514
891 Ga0501076_0008194
892 Ga0501076_0035611
893 Ga0501076_0091364
894 Ga0501076_0157539
895 Ga0501076_0206030
896 Ga0501076_0743801
897 Ga0501077_0005147
898 Ga0501077_0026796
899 Ga0501077_0039540
900 Ga0501077_0061927
901 Ga0501079_0005368
902 Ga0501079_0041900
903 Ga0501079_0044584
904 Ga0501079_0071602
905 Ga0501079_0164367
906 Ga0501079_0165847
907 Ga0501079_0692724
908 Ga0501080_0003570
909 Ga0501080_0015979
910 Ga0501080_0018508
911 Ga0501080_0032228
912 Ga0501081_0013333
913 Ga0501081_0013526
914 Ga0501081_0018680
915 Ga0501081_0028332
916 Ga0501081_0145693
917 Ga0501081_0484209
918 Ga0501081_0619801
919 Ga0501083_0023184
920 Ga0501083_0240525
921 Ga0501035_0011674
922 Ga0501035_0016594
923 Ga0501035_0068370
924 Ga0501035_0435984
925 Ga0501044_0304445
926 Ga0501045_0000433
927 Ga0501045_0004522
928 Ga0501045_0009000
929 Ga0501045_0186450
930 Ga0501045_0205181
931 nmdc:mga05p37_292338_c1
932 nmdc:mga09592_136965_c1
933 nmdc:mga0qj67_57977_c1
934 nmdc:mga08y16_1011369_c1
935 nmdc:mga08y16_30812_c1
936 nmdc:mga08y16_315564_c1
937 nmdc:mga0n895_3786_c1
938 nmdc:mga0rr50_58902_c1
939 nmdc:mga0rr50_839594_c1
940 nmdc:mga0a205_300_c1
941 Ga0500583_0069252
942 Ga0500583_0190814
943 Ga0500641_0033988
944 Ga0500650_0000047
945 Ga0500660_079256
946 Ga0500594_0126232
947 Ga0500595_005478
948 Ga0500595_093113
949 Ga0500617_097920
950 Ga0500642_0168908
951 Ga0500658_0013860
952 Ga0500564_008348
953 Ga0500588_0003125
954 Ga0500616_0000064
955 Ga0500622_0006740
956 Ga0500637_0089500
957 Ga0500596_018385
958 Ga0501084_0006611
959 Ga0501084_0027347
960 Ga0501084_1240140
961 Ga0501082_0002844
962 Ga0501082_0004184
963 Ga0501082_0039976
964 Ga0501082_0070252
965 Ga0501082_0160379
966 Ga0501082_0200334
967 Ga0501082_0297398
968 Ga0501082_0522662
969 Ga0501082_0773841
970 Ga0501082_0807851
971 Ga0466962_0013298
972 Ga0530510_0006701
973 Ga0530510_0015792
974 Ga0530510_0183298
975 2538833241
976 2643832023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

27

215

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.9183 21 208
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.908 21 208
1zbo-assembly1.cif.gz_A x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27. 0.8695 21 205
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8535 21 129
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8398 21 129
ID Description Score Start End Superfamily
af_P96280_7_116_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8988 21 131 2.30.130.40
af_A0A2R8PXH8_356_472_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8945 22 129 2.30.130.40
af_A0A0G2K313_628_728_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8932 23 131 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8913 21 131 2.30.130.40
af_P96280_7_116_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8911 21 131 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A534B1T4-F1-model_v4 Peptidase S16 0.9931 61 210
AF-A0A534GLW5-F1-model_v4 Lon N-terminal domain-containing protein 0.9806 20 133
AF-A0A534B1T4-F1-model_v4 Peptidase S16 0.98 61 210
AF-A0A3B0ZBB0-F1-model_v4 Uncharacterized protein, similar to the N-terminal domain of Lon protease 0.9775 20 205 GO:0006508
GO:0008233
AF-A0A524KCY6-F1-model_v4 Peptidase S16 0.9608 23 192

Map