F453268

General Info

Members Datasets Scaffolds Average Seq Length
486 268 972 200

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10053866|Ga0157372_100538665
Length 236
Sequence LVEGRSASAEVARLRFVEPGARSFHQDGDSMNDSPISRGFRSPRQTDNLGNRIPPGQYLTRDFPVLSAGPTPHRSLDQWSFTLGYDGTLLDSWTWSQFQDLPQTNITADIHCVTKWSKIDTMWQGVTFDDLLRAAGLRAPPAPYLMAHCDGGYTTNLAVDDLVGGKGAVVTRYAGAPIEPVHGGPARLFVPHLYFWKSAKWVRRLSFMETNKPGFWESNGYHIRGDPWKEERYDGD

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
241 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
261 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
262 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
263 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
264 2902330777 Methylobacterium sp. 2A Isolate Unclassified
265 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
266 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
267 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
268 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 1.23
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 5.14
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10053866 3300013307 Bacteria 4485
2 JGI24751J29686_10000142 3300002459 Bacteria 35602
3 rootH1_10186621 3300003323 Bacteria 6161
4 Ga0058862_12877902 3300004803 Bacteria 2561
5 Ga0065715_10251659 3300005293 Bacteria 1165
6 Ga0070658_10000898 3300005327 Bacteria 25477
7 Ga0070658_10025482 3300005327 Bacteria 4741
8 Ga0070676_10661406 3300005328 Bacteria 759
9 Ga0070670_100000401 3300005331 Bacteria 35589
10 Ga0068869_100009753 3300005334 Bacteria 6236
11 Ga0070666_10250434 3300005335 Bacteria 1254
12 Ga0070682_100002868 3300005337 Bacteria 9559
13 Ga0068868_100077450 3300005338 Bacteria 2660
14 Ga0068868_100297953 3300005338 Bacteria 1369
15 Ga0068868_101096951 3300005338 Bacteria 732
16 Ga0070660_100000186 3300005339 Bacteria 41366
17 Ga0070689_100245795 3300005340 Bacteria 1475
18 Ga0070689_100442181 3300005340 Bacteria 1105
19 Ga0070691_10002661 3300005341 Bacteria 7954
20 Ga0070692_10102869 3300005345 Bacteria 1568
21 Ga0070692_10152777 3300005345 Bacteria 1316
22 Ga0070675_100043720 3300005354 Bacteria 3662
23 Ga0070674_100224182 3300005356 Bacteria 1464
24 Ga0070673_100020457 3300005364 Bacteria 4775
25 Ga0070659_100264995 3300005366 Bacteria 1426
26 Ga0070709_10057354 3300005434 Bacteria 2466
27 Ga0070709_10347043 3300005434 Bacteria 1096
28 Ga0070714_100026360 3300005435 Bacteria 4804
29 Ga0070714_100056265 3300005435 Bacteria 3364
30 Ga0070714_100296567 3300005435 Bacteria 1506
31 Ga0070713_100361546 3300005436 Bacteria 1349
32 Ga0070710_10018109 3300005437 Bacteria 3618
33 Ga0070711_100007362 3300005439 Bacteria 6696
34 Ga0070711_100183173 3300005439 Bacteria 1604
35 Ga0070711_100731144 3300005439 Bacteria 835
36 Ga0070711_100765807 3300005439 Bacteria 817
37 Ga0070700_100037675 3300005441 Bacteria 2942
38 Ga0070694_100012332 3300005444 Bacteria 5309
39 Ga0070694_100664227 3300005444 Bacteria 845
40 Ga0070694_101056926 3300005444 Bacteria 676
41 Ga0070708_100000001 3300005445 Bacteria 245117
42 Ga0070708_100004671 3300005445 Bacteria 10794
43 Ga0070708_100012235 3300005445 Bacteria 6997
44 Ga0070708_100940358 3300005445 Unclassified 811
45 Ga0070708_101460395 3300005445 Bacteria 637
46 Ga0070681_10082637 3300005458 Bacteria 3167
47 Ga0068867_100094626 3300005459 Bacteria 2272
48 Ga0068867_100183354 3300005459 Bacteria 1665
49 Ga0070685_10159787 3300005466 Bacteria 1435
50 Ga0070706_100000004 3300005467 Bacteria 281790
51 Ga0070706_100000018 3300005467 Bacteria 166663
52 Ga0070706_100000036 3300005467 Bacteria 151766
53 Ga0070706_100104397 3300005467 Bacteria 2636
54 Ga0070706_100139591 3300005467 Bacteria 2262
55 Ga0070706_100158892 3300005467 Bacteria 2110
56 Ga0070706_100308658 3300005467 Bacteria 1476
57 Ga0070706_100586692 3300005467 Bacteria 1036
58 Ga0070706_100700880 3300005467 Bacteria 939
59 Ga0070706_100920347 3300005467 Bacteria 807
60 Ga0070707_100000002 3300005468 Bacteria 291540
61 Ga0070707_100003234 3300005468 Bacteria 15431
62 Ga0070707_100004491 3300005468 Bacteria 13071
63 Ga0070707_100008223 3300005468 Bacteria 9677
64 Ga0070707_100021397 3300005468 Bacteria 6113
65 Ga0070707_100097249 3300005468 Bacteria 2851
66 Ga0070707_100153184 3300005468 Bacteria 2245
67 Ga0070698_100000893 3300005471 Bacteria 32792
68 Ga0070698_100004158 3300005471 Bacteria 15917
69 Ga0070698_100012922 3300005471 Bacteria 8840
70 Ga0070698_100025427 3300005471 Bacteria 6172
71 Ga0070698_100123895 3300005471 Bacteria 2542
72 Ga0070698_100161876 3300005471 Bacteria 2181
73 Ga0070699_100000082 3300005518 Bacteria 91288
74 Ga0070699_100032481 3300005518 Bacteria 4507
75 Ga0070699_100043424 3300005518 Bacteria 3891
76 Ga0070699_100155784 3300005518 Bacteria 2022
77 Ga0070699_100217278 3300005518 Bacteria 1703
78 Ga0070699_100455991 3300005518 Bacteria 1159
79 Ga0070699_100511833 3300005518 Bacteria 1091
80 Ga0070679_100032257 3300005530 Bacteria 5180
81 Ga0070684_100062663 3300005535 Bacteria 3258
82 Ga0070697_100002492 3300005536 Bacteria 14161
83 Ga0070697_100002537 3300005536 Bacteria 14046
84 Ga0070697_100017059 3300005536 Bacteria 5711
85 Ga0070697_100029594 3300005536 Bacteria 4392
86 Ga0070697_100045984 3300005536 Bacteria 3538
87 Ga0070697_100227536 3300005536 Bacteria 1590
88 Ga0070697_100518182 3300005536 Bacteria 1044
89 Ga0070686_100401999 3300005544 Bacteria 1042
90 Ga0070704_100010789 3300005549 Bacteria 5571
91 Ga0068855_100027712 3300005563 Bacteria 6779
92 Ga0068855_100917909 3300005563 Bacteria 924
93 Ga0070664_100084277 3300005564 Bacteria 2743
94 Ga0070664_100956839 3300005564 Bacteria 804
95 Ga0068857_100000011 3300005577 Bacteria 106771
96 Ga0068857_100104209 3300005577 Bacteria 2547
97 Ga0068857_100106791 3300005577 Bacteria 2514
98 Ga0068856_100003314 3300005614 Bacteria 16364
99 Ga0068856_100091617 3300005614 Bacteria 3024
100 Ga0070702_100084394 3300005615 Bacteria 1910
101 Ga0070702_100782011 3300005615 Bacteria 736
102 Ga0068859_100006120 3300005617 Bacteria 12223
103 Ga0068864_100263099 3300005618 Bacteria 1605
104 Ga0068864_100511738 3300005618 Bacteria 1156
105 Ga0068861_100077610 3300005719 Bacteria 2591
106 Ga0068861_100239725 3300005719 Bacteria 1542
107 Ga0068870_10073892 3300005840 Bacteria 1866
108 Ga0068863_100072732 3300005841 Bacteria 3253
109 Ga0068863_100078802 3300005841 Bacteria 3120
110 Ga0068858_100016592 3300005842 Bacteria 6918
111 Ga0068860_100534039 3300005843 Bacteria 1174
112 Ga0081455_10010817 3300005937 Bacteria 9219
113 Ga0081455_10384193 3300005937 Bacteria 980
114 Ga0070717_10000491 3300006028 Bacteria 25106
115 Ga0075365_10002196 3300006038 Bacteria 9411
116 Ga0075364_10000317 3300006051 Bacteria 23718
117 Ga0075364_10089609 3300006051 Bacteria 2040
118 Ga0075432_10039915 3300006058 Bacteria 1637
119 Ga0070716_100625156 3300006173 Bacteria 813
120 Ga0070712_100433566 3300006175 Bacteria 1091
121 Ga0075369_10000008 3300006186 Bacteria 97558
122 Ga0075366_10000012 3300006195 Bacteria 75739
123 Ga0097621_100006633 3300006237 Bacteria 8226
124 Ga0097621_100123620 3300006237 Bacteria 2197
125 Ga0075428_100089043 3300006844 Bacteria 3366
126 Ga0075428_100129376 3300006844 Bacteria 2747
127 Ga0075431_100039632 3300006847 Bacteria 4853
128 Ga0075431_100061823 3300006847 Bacteria 3864
129 Ga0075433_10031265 3300006852 Bacteria 4550
130 Ga0075433_10049999 3300006852 Bacteria 3638
131 Ga0075433_10326417 3300006852 Bacteria 1357
132 Ga0075433_10630518 3300006852 Bacteria 940
133 Ga0075434_100066401 3300006871 Bacteria 3593
134 Ga0075434_100146198 3300006871 Bacteria 2384
135 Ga0075434_100329248 3300006871 Bacteria 1548
136 Ga0075429_100046521 3300006880 Bacteria 3775
137 Ga0075436_100004016 3300006914 Bacteria 10095
138 Ga0075436_100006323 3300006914 Bacteria 8117
139 Ga0075436_100030489 3300006914 Bacteria 3712
140 Ga0075436_100061020 3300006914 Bacteria 2605
141 Ga0075436_100498688 3300006914 Bacteria 890
142 Ga0097620_100006120 3300006931 Bacteria 12223
143 Ga0075435_100014835 3300007076 Bacteria 5841
144 Ga0075435_100026267 3300007076 Bacteria 4540
145 Ga0075435_100342421 3300007076 Bacteria 1281
146 Ga0099794_10000225 3300007265 Bacteria 20295
147 Ga0099795_10153965 3300007788 Bacteria 944
148 Ga0111539_10356726 3300009094 Bacteria 1702
149 Ga0105245_10035262 3300009098 Bacteria 4439
150 Ga0105245_10058008 3300009098 Bacteria 3484
151 Ga0105245_10084611 3300009098 Bacteria 2906
152 Ga0114129_10081078 3300009147 Bacteria 4510
153 Ga0114129_10105818 3300009147 Bacteria 3887
154 Ga0114129_10155260 3300009147 Bacteria 3130
155 Ga0114129_10711143 3300009147 Bacteria 1290
156 Ga0114129_11210797 3300009147 Bacteria 940
157 Ga0105243_11460747 3300009148 Unclassified 706
158 Ga0105242_10021162 3300009176 Bacteria 5105
159 Ga0105242_10067294 3300009176 Bacteria 2961
160 Ga0105242_10887277 3300009176 Bacteria 890
161 Ga0105248_10008221 3300009177 Bacteria 11464
162 Ga0105248_10121896 3300009177 Bacteria 2941
163 Ga0105248_11835506 3300009177 Bacteria 688
164 Ga0105249_11446316 3300009553 Unclassified 759
165 Ga0105249_12175782 3300009553 Bacteria 627
166 Ga0105239_10040073 3300010375 Bacteria 5132
167 Ga0105239_10894696 3300010375 Bacteria 1019
168 Ga0105239_11131207 3300010375 Bacteria 902
169 Ga0105246_10011090 3300011119 Bacteria 5583
170 Ga0157369_10799360 3300013105 Bacteria 969
171 Ga0157374_10018641 3300013296 Bacteria 6130
172 Ga0157374_10074138 3300013296 Bacteria 3213
173 Ga0157374_10111425 3300013296 Bacteria 2633
174 Ga0157374_10167855 3300013296 Bacteria 2140
175 Ga0157378_10489026 3300013297 Bacteria 1227
176 Ga0157378_10496449 3300013297 Bacteria 1218
177 Ga0163162_10208249 3300013306 Bacteria 2085
178 Ga0163162_10321732 3300013306 Bacteria 1679
179 Ga0157372_10639990 3300013307 Bacteria 1238
180 Ga0157372_11146340 3300013307 Unclassified 899
181 Ga0157375_10032175 3300013308 Bacteria 4972
182 Ga0163163_10002035 3300014325 Bacteria 17089
183 Ga0163163_10335152 3300014325 Bacteria 1568
184 Ga0182008_10172538 3300014497 Bacteria 1092
185 Ga0157377_10094629 3300014745 Bacteria 1770
186 Ga0157379_10646947 3300014968 Unclassified 990
187 Ga0157379_11143703 3300014968 Bacteria 747
188 Ga0157376_10024756 3300014969 Bacteria 4719
189 Ga0157376_10272236 3300014969 Bacteria 1591
190 Ga0157376_11309847 3300014969 Bacteria 754
191 Ga0197907_11513979 3300020069 Bacteria 1002
192 Ga0206356_11297949 3300020070 Bacteria 657
193 Ga0206351_10194374 3300020077 Bacteria 915
194 Ga0213874_10005623 3300021377 Bacteria 2931
195 Ga0213876_10018393 3300021384 Bacteria 3690
196 Ga0213876_10179168 3300021384 Bacteria 1127
197 Ga0213875_10009772 3300021388 Bacteria 4843
198 Ga0207692_10158837 3300025898 Bacteria 1301
199 Ga0207642_10024863 3300025899 Bacteria 2414
200 Ga0207680_10235902 3300025903 Bacteria 1259
201 Ga0207699_10049457 3300025906 Bacteria 2475
202 Ga0207643_10104555 3300025908 Bacteria 1663
203 Ga0207705_10011897 3300025909 Bacteria 6286
204 Ga0207705_10042720 3300025909 Bacteria 3255
205 Ga0207684_10000008 3300025910 Bacteria 601602
206 Ga0207684_10000020 3300025910 Bacteria 342787
207 Ga0207684_10000033 3300025910 Bacteria 291567
208 Ga0207684_10020284 3300025910 Bacteria 5679
209 Ga0207684_10056328 3300025910 Bacteria 3334
210 Ga0207684_10337881 3300025910 Bacteria 1297
211 Ga0207684_10531371 3300025910 Bacteria 1007
212 Ga0207707_10015035 3300025912 Bacteria 6738
213 Ga0207707_10037883 3300025912 Bacteria 4213
214 Ga0207693_10042175 3300025915 Bacteria 3592
215 Ga0207693_10068466 3300025915 Bacteria 2778
216 Ga0207663_10014809 3300025916 Bacteria 4284
217 Ga0207663_10414410 3300025916 Bacteria 1033
218 Ga0207657_10001996 3300025919 Bacteria 22060
219 Ga0207652_10022551 3300025921 Bacteria 5210
220 Ga0207646_10000007 3300025922 Bacteria 478285
221 Ga0207646_10000021 3300025922 Bacteria 272003
222 Ga0207646_10000333 3300025922 Bacteria 63824
223 Ga0207646_10000814 3300025922 Bacteria 40565
224 Ga0207646_10001866 3300025922 Bacteria 25406
225 Ga0207646_10029784 3300025922 Bacteria 4956
226 Ga0207650_10000005 3300025925 Bacteria 663190
227 Ga0207687_10044953 3300025927 Bacteria 3051
228 Ga0207687_10194980 3300025927 Bacteria 1579
229 Ga0207687_10237071 3300025927 Bacteria 1444
230 Ga0207687_10290306 3300025927 Bacteria 1314
231 Ga0207700_10006849 3300025928 Bacteria 6927
232 Ga0207664_10007698 3300025929 Bacteria 7476
233 Ga0207664_10210179 3300025929 Bacteria 1683
234 Ga0207664_10366073 3300025929 Bacteria 1278
235 Ga0207644_10166901 3300025931 Bacteria 1716
236 Ga0207690_10221514 3300025932 Bacteria 1448
237 Ga0207690_10689899 3300025932 Bacteria 839
238 Ga0207686_10220445 3300025934 Bacteria 1369
239 Ga0207670_10195877 3300025936 Bacteria 1532
240 Ga0207669_10110018 3300025937 Bacteria 1844
241 Ga0207665_10024610 3300025939 Bacteria 3971
242 Ga0207665_10883591 3300025939 Bacteria 708
243 Ga0207691_10212632 3300025940 Bacteria 1679
244 Ga0207711_10013758 3300025941 Bacteria 6718
245 Ga0207711_10053452 3300025941 Bacteria 3464
246 Ga0207689_10001266 3300025942 Bacteria 24364
247 Ga0207661_10720548 3300025944 Bacteria 918
248 Ga0207661_10846197 3300025944 Bacteria 842
249 Ga0207679_11304764 3300025945 Unclassified 666
250 Ga0207667_10018860 3300025949 Bacteria 7720
251 Ga0207667_10337124 3300025949 Bacteria 1539
252 Ga0207651_10132538 3300025960 Bacteria 1910
253 Ga0207668_10515648 3300025972 Bacteria 1031
254 Ga0207640_10145161 3300025981 Bacteria 1735
255 Ga0207677_10008061 3300026023 Bacteria 5867
256 Ga0207677_10261201 3300026023 Bacteria 1412
257 Ga0207703_10027970 3300026035 Bacteria 4439
258 Ga0207678_10450004 3300026067 Bacteria 1119
259 Ga0207708_10060527 3300026075 Bacteria 2890
260 Ga0207702_10002739 3300026078 Bacteria 16505
261 Ga0207702_10059851 3300026078 Bacteria 3246
262 Ga0207641_10020403 3300026088 Bacteria 5443
263 Ga0207641_10796181 3300026088 Unclassified 935
264 Ga0207648_10073950 3300026089 Bacteria 2970
265 Ga0207676_10720524 3300026095 Bacteria 968
266 Ga0207674_10000001 3300026116 Bacteria 616581
267 Ga0207674_10149532 3300026116 Bacteria 2293
268 Ga0207674_10157624 3300026116 Bacteria 2225
269 Ga0207675_100957266 3300026118 Bacteria 874
270 Ga0207675_101162361 3300026118 Bacteria 792
271 Ga0207698_10772673 3300026142 Bacteria 961
272 Ga0209588_1000160 3300027671 Bacteria 19302
273 Ga0207428_10010992 3300027907 Bacteria 8051
274 Ga0268265_11433205 3300028380 Unclassified 693
275 Ga0265319_1008192 3300028563 Bacteria 4607
276 Ga0265334_10039307 3300028573 Bacteria 1857
277 Ga0265318_10017544 3300028577 Bacteria 2937
278 Ga0265336_10043422 3300028666 Bacteria 1371
279 Ga0265324_10025775 3300029957 Bacteria 2083
280 Ga0265332_10025080 3300031238 Bacteria 2621
281 Ga0265325_10043235 3300031241 Bacteria 2351
282 Ga0265340_10012791 3300031247 Bacteria 4428
283 Ga0265339_10082400 3300031249 Bacteria 1698
284 Ga0265331_10053073 3300031250 Bacteria 1935
285 Ga0265316_10088302 3300031344 Bacteria 2367
286 Ga0307508_10247127 3300031616 Bacteria 1381
287 Ga0265314_10036450 3300031711 Bacteria 3574
288 Ga0265342_10036359 3300031712 Bacteria 3009
289 Ga0307405_10447364 3300031731 Bacteria 1023
290 Ga0307410_10130982 3300031852 Bacteria 1842
291 Ga0307410_10259690 3300031852 Bacteria 1354
292 Ga0307406_10019029 3300031901 Bacteria 4024
293 Ga0307407_10279043 3300031903 Bacteria 1156
294 Ga0307412_10051738 3300031911 Bacteria 2716
295 Ga0307409_100039300 3300031995 Bacteria 3509
296 Ga0307409_100086139 3300031995 Bacteria 2556
297 Ga0307416_100155485 3300032002 Bacteria 2104
298 Ga0307416_100698304 3300032002 Bacteria 1103
299 Ga0307411_10038202 3300032005 Bacteria 3026
300 Ga0307415_100035914 3300032126 Bacteria 3241
301 Ga0307507_10033470 3300033179 Bacteria 5336
302 Ga0373931_0059750 3300035691 Bacteria 2051
303 Ga0373935_0953758 3300035692 Bacteria 636
304 Ga0373947_0067760 3300035725 Bacteria 2181
305 Ga0310109_026574 3300036534 Bacteria 773
306 Ga0395899_0001435 3300037312 Bacteria 20383
307 Ga0395899_0013628 3300037312 Bacteria 6216
308 Ga0395899_0015700 3300037312 Bacteria 5775
309 Ga0395899_0121815 3300037312 Bacteria 1867
310 Ga0395899_0168745 3300037312 Bacteria 1542
311 Ga0395899_0393967 3300037312 Bacteria 918
312 Ga0395900_0007284 3300037418 Bacteria 11448
313 Ga0395900_0022182 3300037418 Bacteria 6495
314 Ga0395900_0023755 3300037418 Bacteria 6271
315 Ga0395900_0122012 3300037418 Unclassified 2673
316 Ga0395900_0205042 3300037418 Bacteria 1993
317 Ga0395900_0785956 3300037418 Bacteria 880
318 Ga0395900_1132517 3300037418 Bacteria 699
319 Ga0395898_0002041 3300037466 Bacteria 25284
320 Ga0395898_0040460 3300037466 Unclassified 4609
321 Ga0395898_0099597 3300037466 Bacteria 2791
322 Ga0395898_0154531 3300037466 Bacteria 2195
323 Ga0395898_0188187 3300037466 Bacteria 1972
324 Ga0395898_0217111 3300037466 Bacteria 1824
325 Ga0395898_0259037 3300037466 Bacteria 1659
326 Ga0395898_0416017 3300037466 Bacteria 1281
327 Ga0395898_1170634 3300037466 Bacteria 701
328 Ga0395905_0005828 3300037471 Bacteria 12519
329 Ga0395905_0005830 3300037471 Bacteria 12516
330 Ga0395905_0051977 3300037471 Bacteria 3837
331 Ga0395905_0110916 3300037471 Bacteria 2576
332 Ga0395905_0129533 3300037471 Bacteria 2373
333 Ga0395905_0156166 3300037471 Bacteria 2146
334 Ga0395905_0218311 3300037471 Bacteria 1785
335 Ga0395905_0500643 3300037471 Bacteria 1115
336 Ga0436364_0129420 3300037853 Bacteria 5124
337 Ga0436364_0246675 3300037853 Bacteria 22744
338 Ga0436364_0440241 3300037853 Bacteria 3104
339 Ga0395901_0001145 3300038443 Bacteria 28114
340 Ga0395901_0001186 3300038443 Bacteria 27723
341 Ga0395901_0011408 3300038443 Bacteria 9005
342 Ga0395901_0011878 3300038443 Bacteria 8832
343 Ga0395901_0013689 3300038443 Bacteria 8245
344 Ga0395901_0071680 3300038443 Bacteria 3611
345 Ga0395901_0097033 3300038443 Bacteria 3089
346 Ga0395901_0127420 3300038443 Bacteria 2675
347 Ga0395901_0155010 3300038443 Bacteria 2406
348 Ga0395901_0178485 3300038443 Bacteria 2227
349 Ga0395901_0202380 3300038443 Bacteria 2081
350 Ga0395901_0951289 3300038443 Bacteria 838
351 Ga0436365_0064108 3300039437 Bacteria 865
352 Ga0436365_1010438 3300039437 Bacteria 2300
353 Ga0436365_1148399 3300039437 Bacteria 1116
354 Ga0436360_0305894 3300039438 Bacteria 1004
355 Ga0436360_0856232 3300039438 Bacteria 5525
356 Ga0436361_0995516 3300039447 Bacteria 775
357 Ga0436363_0231248 3300039450 Bacteria 3130
358 Ga0436362_0774608 3300039453 Bacteria 1358
359 Ga0451845_0039976 3300041501 Bacteria 1700
360 Ga0439448_0098421 3300042005 Bacteria 992
361 Ga0439458_0006372 3300042157 Bacteria 2633
362 Ga0439459_0036016 3300042438 Bacteria 1031
363 Ga0466963_0061883 3300044694 Bacteria 2503
364 Ga0453684_0260806 3300044712 Bacteria 1985
365 Ga0466971_0052508 3300044719 Bacteria 1836
366 Ga0466971_0106145 3300044719 Bacteria 1294
367 Ga0466968_0017993 3300044735 Bacteria 2831
368 Ga0466968_0046769 3300044735 Bacteria 1839
369 Ga0466968_0175963 3300044735 Bacteria 993
370 Ga0466970_0019411 3300044765 Bacteria 3524
371 Ga0466970_0153646 3300044765 Bacteria 1271
372 Ga0466957_0009201 3300044842 Bacteria 5635
373 Ga0466957_0126343 3300044842 Bacteria 1634
374 Ga0466957_0224528 3300044842 Bacteria 1241
375 Ga0466960_0020401 3300044901 Bacteria 2935
376 Ga0466959_0734303 3300045049 Bacteria 661
377 Ga0451576_0025632 3300045051 Bacteria 6352
378 Ga0466958_0149287 3300045836 Bacteria 1474
379 Ga0466967_0153008 3300045976 Bacteria 2158
380 Ga0495629_0030107 3300046459 Bacteria 3849
381 Ga0495641_0046602 3300046461 Bacteria 1993
382 Ga0495582_0127058 3300046473 Bacteria 1439
383 Ga0495605_0012361 3300046474 Bacteria 4739
384 Ga0495639_0304868 3300046475 Bacteria 795
385 Ga0495628_0321172 3300046516 Bacteria 1142
386 Ga0495630_0530283 3300046517 Bacteria 903
387 Ga0495644_0006090 3300046523 Bacteria 4688
388 Ga0495642_0017532 3300046528 Bacteria 2798
389 Ga0495622_0000091 3300046557 Bacteria 80761
390 Ga0495667_0059117 3300046559 Bacteria 2516
391 Ga0495635_0393093 3300046663 Bacteria 922
392 Ga0495599_0239613 3300046678 Bacteria 1106
393 Ga0495658_0054854 3300046683 Bacteria 2268
394 Ga0495600_0011588 3300046809 Bacteria 5499
395 Ga0495676_0339582 3300047321 Bacteria 1006
396 Ga0495683_0072553 3300047323 Bacteria 1689
397 Ga0495679_040896 3300047446 Bacteria 1439
398 Ga0495593_0045670 3300047673 Bacteria 2337
399 Ga0496101_0236283 3300048904 Bacteria 1421
400 Ga0496102_0113288 3300048905 Bacteria 2530
401 Ga0496102_0213248 3300048905 Bacteria 1820
402 Ga0496103_0063706 3300048906 Bacteria 2297
403 Ga0496104_0071500 3300048907 Bacteria 3299
404 Ga0496105_0048898 3300048908 Bacteria 3491
405 Ga0496105_0210672 3300048908 Bacteria 1584
406 Ga0496105_0438838 3300048908 Bacteria 1032
407 Ga0496106_0312848 3300048909 Bacteria 1260
408 Ga0496108_0013187 3300048911 Bacteria 6737
409 Ga0496108_0282011 3300048911 Bacteria 1446
410 Ga0496109_0028768 3300048912 Bacteria 4975
411 Ga0496109_0351261 3300048912 Bacteria 1393
412 Ga0496110_0367211 3300048913 Bacteria 1311
413 Ga0496111_0136566 3300048914 Bacteria 1816
414 Ga0496112_0030333 3300048915 Bacteria 5232
415 Ga0496112_0366121 3300048915 Bacteria 1383
416 Ga0496112_0386901 3300048915 Bacteria 1339
417 Ga0496112_1138904 3300048915 Unclassified 698
418 Ga0496113_0018492 3300048916 Bacteria 4855
419 Ga0496113_0717895 3300048916 Bacteria 797
420 Ga0496114_0064148 3300048917 Bacteria 3076
421 Ga0496114_0391632 3300048917 Bacteria 1230
422 Ga0496115_0301761 3300048918 Bacteria 1312
423 Ga0496115_0358008 3300048918 Bacteria 1189
424 Ga0496118_0059640 3300048921 Bacteria 2839
425 Ga0496119_0211217 3300048922 Bacteria 998
426 Ga0496126_0022510 3300048929 Bacteria 6130
427 Ga0496126_0024772 3300048929 Bacteria 5787
428 Ga0496126_0035000 3300048929 Bacteria 4710
429 Ga0501048_0090088 3300049582 Bacteria 2164
430 Ga0501067_0003317 3300049583 Bacteria 8855
431 Ga0501069_0001852 3300049585 Bacteria 10555
432 Ga0501070_0110684 3300049586 Bacteria 2270
433 Ga0501072_0629161 3300049588 Bacteria 845
434 Ga0501075_0065106 3300049591 Bacteria 2750
435 Ga0501256_016306 3300049685 Bacteria 751
436 Ga0501212_039020 3300049851 Bacteria 781
437 nmdc:mga00v17_62_c1 3300050491 Bacteria 66736
438 nmdc:mga00v17_79885_c1 3300050491 Bacteria 2040
439 nmdc:mga0yw44_162_c1 3300050492 Bacteria 23073
440 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
441 nmdc:mga05p37_120889_c1 3300050507 Bacteria 1575
442 nmdc:mga05p37_31830_c1 3300050507 Bacteria 2929
443 nmdc:mga05p37_76014_c1 3300050507 Bacteria 4135
444 nmdc:mga05p37_91966_c1 3300050507 Bacteria 3738
445 nmdc:mga05p37_920111_c1 3300050507 Bacteria 940
446 nmdc:mga09592_316811_c1 3300050508 Bacteria 1351
447 nmdc:mga06r32_296659_c1 3300050510 Bacteria 1603
448 nmdc:mga06r32_379571_c1 3300050510 Bacteria 1396
449 nmdc:mga08y16_120460_c1 3300050511 Bacteria 2731
450 nmdc:mga0n895_206177_c1 3300050512 Bacteria 1996
451 nmdc:mga0n895_289048_c1 3300050512 Bacteria 1662
452 nmdc:mga0n895_599931_c1 3300050512 Bacteria 1104
453 nmdc:mga0n895_604765_c1 3300050512 Bacteria 1098
454 nmdc:mga0rr50_287170_c1 3300050513 Bacteria 1374
455 nmdc:mga0rr50_31052_c1 3300050513 Bacteria 3789
456 nmdc:mga0rr50_40942_c1 3300050513 Bacteria 3372
457 nmdc:mga0rr50_862520_c1 3300050513 Bacteria 772
458 nmdc:mga08x19_132336_c1 3300050514 Bacteria 1678
459 nmdc:mga08x19_140316_c1 3300050514 Bacteria 1632
460 nmdc:mga08x19_20626_c1 3300050514 Bacteria 4058
461 nmdc:mga08x19_23052_c1 3300050514 Bacteria 3861
462 nmdc:mga08x19_6234_c1 3300050514 Bacteria 7058
463 nmdc:mga08x19_86827_c1 3300050514 Bacteria 2060
464 nmdc:mga08x19_9798_c1 3300050514 Bacteria 5739
465 nmdc:mga0a205_139401_c1 3300050515 Bacteria 1809
466 nmdc:mga0a205_208854_c1 3300050515 Bacteria 1841
467 nmdc:mga0a205_29518_c1 3300050515 Bacteria 5248
468 nmdc:mga0a205_348635_c1 3300050515 Bacteria 1348
469 nmdc:mga0a205_444700_c1 3300050515 Bacteria 1157
470 nmdc:mga0a205_76017_c1 3300050515 Bacteria 3245
471 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
472 Ga0500566_0000001 3300053094 Bacteria 1101031
473 Ga0501084_0406817 3300054114 Bacteria 1150
474 Ga0587128_002872 3300059630 Bacteria 1844
475 Ga0501082_0231032 3300060353 Bacteria 1610
476 Ga0466962_0072431 3300061719 Bacteria 1646
477 Ga0530510_0051784 3300061734 Bacteria 2967
478 2596375748 2595698237 Bacteria 6712432
479 2739355300 2738543032 Bacteria 5115625
480 2842703050 2842698319 Bacteria 5190321
481 2889310620 2889306138 Bacteria 6358934
482 2902334769 2902330777 Bacteria 6395352
483 2902405234 2902405164 Bacteria 6784948
484 2912758148 2912757875 Bacteria 7940295
485 2928129293 2928125067 Bacteria 5937560
486 8025537225 8025530807 Bacteria 8495698
487 Ga0157372_10053866
488 JGI24751J29686_10000142
489 rootH1_10186621
490 Ga0058862_12877902
491 Ga0065715_10251659
492 Ga0070658_10000898
493 Ga0070658_10025482
494 Ga0070676_10661406
495 Ga0070670_100000401
496 Ga0068869_100009753
497 Ga0070666_10250434
498 Ga0070682_100002868
499 Ga0068868_100077450
500 Ga0068868_100297953
501 Ga0068868_101096951
502 Ga0070660_100000186
503 Ga0070689_100245795
504 Ga0070689_100442181
505 Ga0070691_10002661
506 Ga0070692_10102869
507 Ga0070692_10152777
508 Ga0070675_100043720
509 Ga0070674_100224182
510 Ga0070673_100020457
511 Ga0070659_100264995
512 Ga0070709_10057354
513 Ga0070709_10347043
514 Ga0070714_100026360
515 Ga0070714_100056265
516 Ga0070714_100296567
517 Ga0070713_100361546
518 Ga0070710_10018109
519 Ga0070711_100007362
520 Ga0070711_100183173
521 Ga0070711_100731144
522 Ga0070711_100765807
523 Ga0070700_100037675
524 Ga0070694_100012332
525 Ga0070694_100664227
526 Ga0070694_101056926
527 Ga0070708_100000001
528 Ga0070708_100004671
529 Ga0070708_100012235
530 Ga0070708_100940358
531 Ga0070708_101460395
532 Ga0070681_10082637
533 Ga0068867_100094626
534 Ga0068867_100183354
535 Ga0070685_10159787
536 Ga0070706_100000004
537 Ga0070706_100000018
538 Ga0070706_100000036
539 Ga0070706_100104397
540 Ga0070706_100139591
541 Ga0070706_100158892
542 Ga0070706_100308658
543 Ga0070706_100586692
544 Ga0070706_100700880
545 Ga0070706_100920347
546 Ga0070707_100000002
547 Ga0070707_100003234
548 Ga0070707_100004491
549 Ga0070707_100008223
550 Ga0070707_100021397
551 Ga0070707_100097249
552 Ga0070707_100153184
553 Ga0070698_100000893
554 Ga0070698_100004158
555 Ga0070698_100012922
556 Ga0070698_100025427
557 Ga0070698_100123895
558 Ga0070698_100161876
559 Ga0070699_100000082
560 Ga0070699_100032481
561 Ga0070699_100043424
562 Ga0070699_100155784
563 Ga0070699_100217278
564 Ga0070699_100455991
565 Ga0070699_100511833
566 Ga0070679_100032257
567 Ga0070684_100062663
568 Ga0070697_100002492
569 Ga0070697_100002537
570 Ga0070697_100017059
571 Ga0070697_100029594
572 Ga0070697_100045984
573 Ga0070697_100227536
574 Ga0070697_100518182
575 Ga0070686_100401999
576 Ga0070704_100010789
577 Ga0068855_100027712
578 Ga0068855_100917909
579 Ga0070664_100084277
580 Ga0070664_100956839
581 Ga0068857_100000011
582 Ga0068857_100104209
583 Ga0068857_100106791
584 Ga0068856_100003314
585 Ga0068856_100091617
586 Ga0070702_100084394
587 Ga0070702_100782011
588 Ga0068859_100006120
589 Ga0068864_100263099
590 Ga0068864_100511738
591 Ga0068861_100077610
592 Ga0068861_100239725
593 Ga0068870_10073892
594 Ga0068863_100072732
595 Ga0068863_100078802
596 Ga0068858_100016592
597 Ga0068860_100534039
598 Ga0081455_10010817
599 Ga0081455_10384193
600 Ga0070717_10000491
601 Ga0075365_10002196
602 Ga0075364_10000317
603 Ga0075364_10089609
604 Ga0075432_10039915
605 Ga0070716_100625156
606 Ga0070712_100433566
607 Ga0075369_10000008
608 Ga0075366_10000012
609 Ga0097621_100006633
610 Ga0097621_100123620
611 Ga0075428_100089043
612 Ga0075428_100129376
613 Ga0075431_100039632
614 Ga0075431_100061823
615 Ga0075433_10031265
616 Ga0075433_10049999
617 Ga0075433_10326417
618 Ga0075433_10630518
619 Ga0075434_100066401
620 Ga0075434_100146198
621 Ga0075434_100329248
622 Ga0075429_100046521
623 Ga0075436_100004016
624 Ga0075436_100006323
625 Ga0075436_100030489
626 Ga0075436_100061020
627 Ga0075436_100498688
628 Ga0097620_100006120
629 Ga0075435_100014835
630 Ga0075435_100026267
631 Ga0075435_100342421
632 Ga0099794_10000225
633 Ga0099795_10153965
634 Ga0111539_10356726
635 Ga0105245_10035262
636 Ga0105245_10058008
637 Ga0105245_10084611
638 Ga0114129_10081078
639 Ga0114129_10105818
640 Ga0114129_10155260
641 Ga0114129_10711143
642 Ga0114129_11210797
643 Ga0105243_11460747
644 Ga0105242_10021162
645 Ga0105242_10067294
646 Ga0105242_10887277
647 Ga0105248_10008221
648 Ga0105248_10121896
649 Ga0105248_11835506
650 Ga0105249_11446316
651 Ga0105249_12175782
652 Ga0105239_10040073
653 Ga0105239_10894696
654 Ga0105239_11131207
655 Ga0105246_10011090
656 Ga0157369_10799360
657 Ga0157374_10018641
658 Ga0157374_10074138
659 Ga0157374_10111425
660 Ga0157374_10167855
661 Ga0157378_10489026
662 Ga0157378_10496449
663 Ga0163162_10208249
664 Ga0163162_10321732
665 Ga0157372_10639990
666 Ga0157372_11146340
667 Ga0157375_10032175
668 Ga0163163_10002035
669 Ga0163163_10335152
670 Ga0182008_10172538
671 Ga0157377_10094629
672 Ga0157379_10646947
673 Ga0157379_11143703
674 Ga0157376_10024756
675 Ga0157376_10272236
676 Ga0157376_11309847
677 Ga0197907_11513979
678 Ga0206356_11297949
679 Ga0206351_10194374
680 Ga0213874_10005623
681 Ga0213876_10018393
682 Ga0213876_10179168
683 Ga0213875_10009772
684 Ga0207692_10158837
685 Ga0207642_10024863
686 Ga0207680_10235902
687 Ga0207699_10049457
688 Ga0207643_10104555
689 Ga0207705_10011897
690 Ga0207705_10042720
691 Ga0207684_10000008
692 Ga0207684_10000020
693 Ga0207684_10000033
694 Ga0207684_10020284
695 Ga0207684_10056328
696 Ga0207684_10337881
697 Ga0207684_10531371
698 Ga0207707_10015035
699 Ga0207707_10037883
700 Ga0207693_10042175
701 Ga0207693_10068466
702 Ga0207663_10014809
703 Ga0207663_10414410
704 Ga0207657_10001996
705 Ga0207652_10022551
706 Ga0207646_10000007
707 Ga0207646_10000021
708 Ga0207646_10000333
709 Ga0207646_10000814
710 Ga0207646_10001866
711 Ga0207646_10029784
712 Ga0207650_10000005
713 Ga0207687_10044953
714 Ga0207687_10194980
715 Ga0207687_10237071
716 Ga0207687_10290306
717 Ga0207700_10006849
718 Ga0207664_10007698
719 Ga0207664_10210179
720 Ga0207664_10366073
721 Ga0207644_10166901
722 Ga0207690_10221514
723 Ga0207690_10689899
724 Ga0207686_10220445
725 Ga0207670_10195877
726 Ga0207669_10110018
727 Ga0207665_10024610
728 Ga0207665_10883591
729 Ga0207691_10212632
730 Ga0207711_10013758
731 Ga0207711_10053452
732 Ga0207689_10001266
733 Ga0207661_10720548
734 Ga0207661_10846197
735 Ga0207679_11304764
736 Ga0207667_10018860
737 Ga0207667_10337124
738 Ga0207651_10132538
739 Ga0207668_10515648
740 Ga0207640_10145161
741 Ga0207677_10008061
742 Ga0207677_10261201
743 Ga0207703_10027970
744 Ga0207678_10450004
745 Ga0207708_10060527
746 Ga0207702_10002739
747 Ga0207702_10059851
748 Ga0207641_10020403
749 Ga0207641_10796181
750 Ga0207648_10073950
751 Ga0207676_10720524
752 Ga0207674_10000001
753 Ga0207674_10149532
754 Ga0207674_10157624
755 Ga0207675_100957266
756 Ga0207675_101162361
757 Ga0207698_10772673
758 Ga0209588_1000160
759 Ga0207428_10010992
760 Ga0268265_11433205
761 Ga0265319_1008192
762 Ga0265334_10039307
763 Ga0265318_10017544
764 Ga0265336_10043422
765 Ga0265324_10025775
766 Ga0265332_10025080
767 Ga0265325_10043235
768 Ga0265340_10012791
769 Ga0265339_10082400
770 Ga0265331_10053073
771 Ga0265316_10088302
772 Ga0307508_10247127
773 Ga0265314_10036450
774 Ga0265342_10036359
775 Ga0307405_10447364
776 Ga0307410_10130982
777 Ga0307410_10259690
778 Ga0307406_10019029
779 Ga0307407_10279043
780 Ga0307412_10051738
781 Ga0307409_100039300
782 Ga0307409_100086139
783 Ga0307416_100155485
784 Ga0307416_100698304
785 Ga0307411_10038202
786 Ga0307415_100035914
787 Ga0307507_10033470
788 Ga0373931_0059750
789 Ga0373935_0953758
790 Ga0373947_0067760
791 Ga0310109_026574
792 Ga0395899_0001435
793 Ga0395899_0013628
794 Ga0395899_0015700
795 Ga0395899_0121815
796 Ga0395899_0168745
797 Ga0395899_0393967
798 Ga0395900_0007284
799 Ga0395900_0022182
800 Ga0395900_0023755
801 Ga0395900_0122012
802 Ga0395900_0205042
803 Ga0395900_0785956
804 Ga0395900_1132517
805 Ga0395898_0002041
806 Ga0395898_0040460
807 Ga0395898_0099597
808 Ga0395898_0154531
809 Ga0395898_0188187
810 Ga0395898_0217111
811 Ga0395898_0259037
812 Ga0395898_0416017
813 Ga0395898_1170634
814 Ga0395905_0005828
815 Ga0395905_0005830
816 Ga0395905_0051977
817 Ga0395905_0110916
818 Ga0395905_0129533
819 Ga0395905_0156166
820 Ga0395905_0218311
821 Ga0395905_0500643
822 Ga0436364_0129420
823 Ga0436364_0246675
824 Ga0436364_0440241
825 Ga0395901_0001145
826 Ga0395901_0001186
827 Ga0395901_0011408
828 Ga0395901_0011878
829 Ga0395901_0013689
830 Ga0395901_0071680
831 Ga0395901_0097033
832 Ga0395901_0127420
833 Ga0395901_0155010
834 Ga0395901_0178485
835 Ga0395901_0202380
836 Ga0395901_0951289
837 Ga0436365_0064108
838 Ga0436365_1010438
839 Ga0436365_1148399
840 Ga0436360_0305894
841 Ga0436360_0856232
842 Ga0436361_0995516
843 Ga0436363_0231248
844 Ga0436362_0774608
845 Ga0451845_0039976
846 Ga0439448_0098421
847 Ga0439458_0006372
848 Ga0439459_0036016
849 Ga0466963_0061883
850 Ga0453684_0260806
851 Ga0466971_0052508
852 Ga0466971_0106145
853 Ga0466968_0017993
854 Ga0466968_0046769
855 Ga0466968_0175963
856 Ga0466970_0019411
857 Ga0466970_0153646
858 Ga0466957_0009201
859 Ga0466957_0126343
860 Ga0466957_0224528
861 Ga0466960_0020401
862 Ga0466959_0734303
863 Ga0451576_0025632
864 Ga0466958_0149287
865 Ga0466967_0153008
866 Ga0495629_0030107
867 Ga0495641_0046602
868 Ga0495582_0127058
869 Ga0495605_0012361
870 Ga0495639_0304868
871 Ga0495628_0321172
872 Ga0495630_0530283
873 Ga0495644_0006090
874 Ga0495642_0017532
875 Ga0495622_0000091
876 Ga0495667_0059117
877 Ga0495635_0393093
878 Ga0495599_0239613
879 Ga0495658_0054854
880 Ga0495600_0011588
881 Ga0495676_0339582
882 Ga0495683_0072553
883 Ga0495679_040896
884 Ga0495593_0045670
885 Ga0496101_0236283
886 Ga0496102_0113288
887 Ga0496102_0213248
888 Ga0496103_0063706
889 Ga0496104_0071500
890 Ga0496105_0048898
891 Ga0496105_0210672
892 Ga0496105_0438838
893 Ga0496106_0312848
894 Ga0496108_0013187
895 Ga0496108_0282011
896 Ga0496109_0028768
897 Ga0496109_0351261
898 Ga0496110_0367211
899 Ga0496111_0136566
900 Ga0496112_0030333
901 Ga0496112_0366121
902 Ga0496112_0386901
903 Ga0496112_1138904
904 Ga0496113_0018492
905 Ga0496113_0717895
906 Ga0496114_0064148
907 Ga0496114_0391632
908 Ga0496115_0301761
909 Ga0496115_0358008
910 Ga0496118_0059640
911 Ga0496119_0211217
912 Ga0496126_0022510
913 Ga0496126_0024772
914 Ga0496126_0035000
915 Ga0501048_0090088
916 Ga0501067_0003317
917 Ga0501069_0001852
918 Ga0501070_0110684
919 Ga0501072_0629161
920 Ga0501075_0065106
921 Ga0501256_016306
922 Ga0501212_039020
923 nmdc:mga00v17_62_c1
924 nmdc:mga00v17_79885_c1
925 nmdc:mga0yw44_162_c1
926 nmdc:mga0k408_1_c1
927 nmdc:mga05p37_120889_c1
928 nmdc:mga05p37_31830_c1
929 nmdc:mga05p37_76014_c1
930 nmdc:mga05p37_91966_c1
931 nmdc:mga05p37_920111_c1
932 nmdc:mga09592_316811_c1
933 nmdc:mga06r32_296659_c1
934 nmdc:mga06r32_379571_c1
935 nmdc:mga08y16_120460_c1
936 nmdc:mga0n895_206177_c1
937 nmdc:mga0n895_289048_c1
938 nmdc:mga0n895_599931_c1
939 nmdc:mga0n895_604765_c1
940 nmdc:mga0rr50_287170_c1
941 nmdc:mga0rr50_31052_c1
942 nmdc:mga0rr50_40942_c1
943 nmdc:mga0rr50_862520_c1
944 nmdc:mga08x19_132336_c1
945 nmdc:mga08x19_140316_c1
946 nmdc:mga08x19_20626_c1
947 nmdc:mga08x19_23052_c1
948 nmdc:mga08x19_6234_c1
949 nmdc:mga08x19_86827_c1
950 nmdc:mga08x19_9798_c1
951 nmdc:mga0a205_139401_c1
952 nmdc:mga0a205_208854_c1
953 nmdc:mga0a205_29518_c1
954 nmdc:mga0a205_348635_c1
955 nmdc:mga0a205_444700_c1
956 nmdc:mga0a205_76017_c1
957 nmdc:mga0sz30_3_c8
958 Ga0500566_0000001
959 Ga0501084_0406817
960 Ga0587128_002872
961 Ga0501082_0231032
962 Ga0466962_0072431
963 Ga0530510_0051784
964 2596375748
965 2739355300
966 2842703050
967 2889310620
968 2902334769
969 2902405234
970 2912758148
971 2928129293
972 8025537225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

68

216

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8731 40 189
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8687 31 185
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8671 39 185
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.8646 39 185
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.8642 39 185
ID Description Score Start End Superfamily
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8688 31 185 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8671 39 185 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8627 40 189 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8605 31 185 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8546 31 185 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A2V6AJT6-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9758 54 199
AF-A0A537VYY2-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9702 72 199
AF-A0A519UX78-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9663 70 196
AF-A0A014NXG6-F1-model_v4 Molybdopterin-binding protein 0.9655 40 196
AF-A0A1Q7ATV3-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9647 21 199

Map