F453115

General Info

Members Datasets Scaffolds Average Seq Length
485 292 970 176

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10369561|Ga0207663_103695612
Length 212
Sequence MPFTIAIIGRPNVGKSTLFNRLVGQKLALVDDEPGVTRDRREGEARLGDLEFTIIDTAGLDEGAKGSLTLAIKSGIKVVQQDKHLEVQASSTAEGLNAIAGATRAHLANMVTGVTKGYEKKLELVGVGYRAAVQAKSLTLTLGFSHLINFAIPDGITIEAPSQTEIIVKGIDRQRVGQTAAEIRGFRPPEPYKGKGVKYSDEKISLKEAKKK

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
133 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
134 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
283 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.3
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 7.63
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10369561 3300025916 Bacteria 1090
2 LJNas_1003798 3300000546 Bacteria 1712
3 LJNas_1018000 3300000546 Bacteria 752
4 Ga0058863_11971832 3300004799 Bacteria 3216
5 Ga0065707_10173760 3300005295 Bacteria 1466
6 Ga0070670_100042316 3300005331 Bacteria 3915
7 Ga0068869_101163005 3300005334 Bacteria 677
8 Ga0070666_10001446 3300005335 Bacteria 14396
9 Ga0070680_100262924 3300005336 Bacteria 1460
10 Ga0068868_100008294 3300005338 Bacteria 7438
11 Ga0070675_100227307 3300005354 Bacteria 1627
12 Ga0070671_100003161 3300005355 Bacteria 12839
13 Ga0070671_100005400 3300005355 Bacteria 10190
14 Ga0070667_100012347 3300005367 Bacteria 7064
15 Ga0070667_100055472 3300005367 Bacteria 3346
16 Ga0070709_10009928 3300005434 Bacteria 5262
17 Ga0070709_10015515 3300005434 Bacteria 4337
18 Ga0070709_10121175 3300005434 Bacteria 1773
19 Ga0070714_100009500 3300005435 Bacteria 7649
20 Ga0070714_100032759 3300005435 Bacteria 4340
21 Ga0070713_100001795 3300005436 Bacteria 13831
22 Ga0070713_100006105 3300005436 Bacteria 8311
23 Ga0070713_100409524 3300005436 Bacteria 1268
24 Ga0070710_10254165 3300005437 Bacteria 1131
25 Ga0070711_100001465 3300005439 Bacteria 12963
26 Ga0070711_100025752 3300005439 Bacteria 3851
27 Ga0070711_100054156 3300005439 Bacteria 2768
28 Ga0070711_100152918 3300005439 Bacteria 1742
29 Ga0070705_100281745 3300005440 Bacteria 1182
30 Ga0070663_100042078 3300005455 Bacteria 3208
31 Ga0070663_101024477 3300005455 Bacteria 719
32 Ga0070678_100002594 3300005456 Bacteria 9934
33 Ga0070681_10035786 3300005458 Bacteria 4988
34 Ga0070681_10281253 3300005458 Bacteria 1574
35 Ga0068867_100034823 3300005459 Bacteria 3651
36 Ga0070699_100038586 3300005518 Bacteria 4136
37 Ga0070679_100017288 3300005530 Bacteria 6978
38 Ga0068853_100093611 3300005539 Bacteria 2646
39 Ga0068853_100303829 3300005539 Bacteria 1475
40 Ga0070672_100123866 3300005543 Bacteria 2119
41 Ga0070686_100067091 3300005544 Bacteria 2336
42 Ga0070695_100002554 3300005545 Bacteria 10512
43 Ga0070696_100001443 3300005546 Bacteria 15552
44 Ga0070665_100005442 3300005548 Bacteria 13132
45 Ga0070665_100014481 3300005548 Bacteria 7909
46 Ga0070665_100045273 3300005548 Bacteria 4419
47 Ga0070665_100047121 3300005548 Bacteria 4327
48 Ga0068855_100032357 3300005563 Bacteria 6245
49 Ga0068855_100114994 3300005563 Bacteria 3084
50 Ga0068855_100285468 3300005563 Bacteria 1831
51 Ga0070664_100082104 3300005564 Bacteria 2779
52 Ga0068854_100104735 3300005578 Bacteria 2126
53 Ga0068856_100006458 3300005614 Bacteria 11500
54 Ga0068856_100042931 3300005614 Bacteria 4449
55 Ga0068856_100161497 3300005614 Bacteria 2251
56 Ga0070702_100447944 3300005615 Bacteria 936
57 Ga0068852_100874579 3300005616 Bacteria 915
58 Ga0068859_100000641 3300005617 Bacteria 34946
59 Ga0068859_100056515 3300005617 Bacteria 3950
60 Ga0068866_10002031 3300005718 Bacteria 8429
61 Ga0068863_100008761 3300005841 Bacteria 9878
62 Ga0068858_100000125 3300005842 Bacteria 79795
63 Ga0068858_100004270 3300005842 Bacteria 14053
64 Ga0068858_100054829 3300005842 Bacteria 3686
65 Ga0068858_100364805 3300005842 Bacteria 1385
66 Ga0068860_100006244 3300005843 Bacteria 11972
67 Ga0068860_100009263 3300005843 Bacteria 9789
68 Ga0068860_100010872 3300005843 Bacteria 8977
69 Ga0068862_100117477 3300005844 Bacteria 2341
70 Ga0081455_10000719 3300005937 Bacteria 42956
71 Ga0081455_10423156 3300005937 Bacteria 918
72 Ga0070717_10213898 3300006028 Bacteria 1693
73 Ga0070715_10000668 3300006163 Bacteria 9167
74 Ga0070715_10032786 3300006163 Bacteria 2118
75 Ga0070716_100034519 3300006173 Bacteria 2774
76 Ga0070716_100069198 3300006173 Bacteria 2068
77 Ga0070712_100001456 3300006175 Bacteria 14428
78 Ga0070712_100057768 3300006175 Bacteria 2727
79 Ga0070712_100250139 3300006175 Bacteria 1416
80 Ga0097621_100003525 3300006237 Bacteria 10812
81 Ga0068871_100044280 3300006358 Bacteria 3578
82 Ga0075428_100792515 3300006844 Bacteria 1007
83 Ga0075428_101643673 3300006844 Bacteria 671
84 Ga0075430_100302524 3300006846 Bacteria 1323
85 Ga0075429_100025759 3300006880 Bacteria 5107
86 Ga0068865_100001214 3300006881 Bacteria 15025
87 Ga0075436_100243591 3300006914 Bacteria 1279
88 Ga0097620_100000641 3300006931 Bacteria 34946
89 Ga0097620_100056514 3300006931 Bacteria 3950
90 Ga0099794_10054040 3300007265 Bacteria 1938
91 Ga0099794_10137971 3300007265 Bacteria 1234
92 Ga0099795_10000254 3300007788 Bacteria 9508
93 Ga0099795_10046176 3300007788 Bacteria 1569
94 Ga0105250_10072284 3300009092 Bacteria 1394
95 Ga0105240_10065094 3300009093 Bacteria 4526
96 Ga0105240_10086135 3300009093 Bacteria 3848
97 Ga0105240_10459695 3300009093 Bacteria 1423
98 Ga0105240_10496035 3300009093 Bacteria 1358
99 Ga0111539_10575152 3300009094 Bacteria 1312
100 Ga0105245_10099675 3300009098 Bacteria 2686
101 Ga0105247_10002466 3300009101 Bacteria 12578
102 Ga0105247_10015909 3300009101 Bacteria 4504
103 Ga0105241_10011879 3300009174 Bacteria 6399
104 Ga0105242_10003628 3300009176 Bacteria 12013
105 Ga0105248_10003146 3300009177 Bacteria 18265
106 Ga0105248_10005842 3300009177 Bacteria 13527
107 Ga0105248_10260281 3300009177 Bacteria 1953
108 Ga0105237_10096005 3300009545 Bacteria 2955
109 Ga0105237_10099219 3300009545 Bacteria 2904
110 Ga0105238_10022279 3300009551 Bacteria 6457
111 Ga0105238_10248804 3300009551 Bacteria 1755
112 Ga0105238_10337205 3300009551 Bacteria 1495
113 Ga0105249_10014582 3300009553 Bacteria 6947
114 Ga0105249_10115367 3300009553 Bacteria 2545
115 Ga0105249_10690590 3300009553 Bacteria 1080
116 Ga0099796_10005277 3300010159 Bacteria 3211
117 Ga0099796_10161632 3300010159 Bacteria 888
118 Ga0105246_10036204 3300011119 Bacteria 3305
119 Ga0157373_10448086 3300013100 Bacteria 929
120 Ga0157370_10253845 3300013104 Bacteria 1626
121 Ga0157370_10343782 3300013104 Bacteria 1375
122 Ga0157369_10015323 3300013105 Bacteria 8645
123 Ga0157369_10051835 3300013105 Bacteria 4441
124 Ga0157369_10988423 3300013105 Bacteria 862
125 Ga0157374_10002813 3300013296 Bacteria 14598
126 Ga0157374_10361226 3300013296 Bacteria 1444
127 Ga0157378_10006374 3300013297 Bacteria 10319
128 Ga0163162_10006236 3300013306 Bacteria 11558
129 Ga0163162_10026596 3300013306 Bacteria 5720
130 Ga0163162_10096841 3300013306 Bacteria 3039
131 Ga0157372_10049576 3300013307 Bacteria 4669
132 Ga0157375_10006856 3300013308 Bacteria 9930
133 Ga0163163_10007457 3300014325 Bacteria 9652
134 Ga0163163_10171101 3300014325 Bacteria 2219
135 Ga0157379_10006918 3300014968 Bacteria 9807
136 Ga0157379_10055138 3300014968 Bacteria 3552
137 Ga0157379_10082681 3300014968 Bacteria 2877
138 Ga0157379_10104840 3300014968 Bacteria 2537
139 Ga0157376_10131141 3300014969 Bacteria 2236
140 Ga0206351_10700694 3300020077 Bacteria 1521
141 Ga0206354_10785729 3300020081 Bacteria 1051
142 Ga0206353_11779741 3300020082 Bacteria 1147
143 Ga0213874_10021138 3300021377 Bacteria 1791
144 Ga0213874_10153789 3300021377 Bacteria 804
145 Ga0213871_10014920 3300021441 Bacteria 1850
146 Ga0207692_10065245 3300025898 Bacteria 1898
147 Ga0207642_10016853 3300025899 Bacteria 2764
148 Ga0207710_10000332 3300025900 Bacteria 35424
149 Ga0207710_10009562 3300025900 Bacteria 4077
150 Ga0207710_10010376 3300025900 Bacteria 3923
151 Ga0207710_10056714 3300025900 Bacteria 1768
152 Ga0207680_10009301 3300025903 Bacteria 4869
153 Ga0207680_10063035 3300025903 Bacteria 2267
154 Ga0207680_10264563 3300025903 Bacteria 1191
155 Ga0207685_10000121 3300025905 Bacteria 11820
156 Ga0207685_10032092 3300025905 Bacteria 1887
157 Ga0207699_10051184 3300025906 Bacteria 2439
158 Ga0207654_10034349 3300025911 Bacteria 2817
159 Ga0207707_10000276 3300025912 Bacteria 55321
160 Ga0207707_10000410 3300025912 Bacteria 44977
161 Ga0207707_10025066 3300025912 Bacteria 5218
162 Ga0207707_10181062 3300025912 Bacteria 1840
163 Ga0207695_10052562 3300025913 Bacteria 4267
164 Ga0207695_10072121 3300025913 Bacteria 3525
165 Ga0207695_10234878 3300025913 Bacteria 1736
166 Ga0207671_10010563 3300025914 Bacteria 7600
167 Ga0207671_10073947 3300025914 Bacteria 2546
168 Ga0207671_10340351 3300025914 Bacteria 1189
169 Ga0207671_10466977 3300025914 Bacteria 1006
170 Ga0207693_10000448 3300025915 Bacteria 37696
171 Ga0207693_10096881 3300025915 Bacteria 2313
172 Ga0207693_10172430 3300025915 Bacteria 1703
173 Ga0207663_10046147 3300025916 Bacteria 2683
174 Ga0207660_10002217 3300025917 Bacteria 12862
175 Ga0207657_10063277 3300025919 Bacteria 3164
176 Ga0207649_11013164 3300025920 Bacteria 654
177 Ga0207652_10003383 3300025921 Bacteria 13178
178 Ga0207694_10003326 3300025924 Bacteria 12785
179 Ga0207650_10025940 3300025925 Bacteria 4177
180 Ga0207687_10076669 3300025927 Bacteria 2402
181 Ga0207700_10003609 3300025928 Bacteria 9016
182 Ga0207700_10030554 3300025928 Bacteria 3817
183 Ga0207700_10098071 3300025928 Bacteria 2330
184 Ga0207664_10007010 3300025929 Bacteria 7803
185 Ga0207664_10040627 3300025929 Bacteria 3619
186 Ga0207644_10000428 3300025931 Bacteria 27319
187 Ga0207644_10004012 3300025931 Bacteria 9557
188 Ga0207686_10007583 3300025934 Bacteria 5844
189 Ga0207709_10529278 3300025935 Bacteria 924
190 Ga0207704_10002424 3300025938 Bacteria 8388
191 Ga0207665_10122982 3300025939 Bacteria 1835
192 Ga0207691_10122749 3300025940 Bacteria 2300
193 Ga0207711_10004185 3300025941 Bacteria 12357
194 Ga0207711_10078295 3300025941 Bacteria 2884
195 Ga0207711_10147675 3300025941 Bacteria 2119
196 Ga0207679_10093035 3300025945 Bacteria 2337
197 Ga0207667_10008242 3300025949 Bacteria 12403
198 Ga0207667_10034654 3300025949 Bacteria 5419
199 Ga0207667_10048865 3300025949 Bacteria 4472
200 Ga0207667_11412403 3300025949 Bacteria 669
201 Ga0207651_10007788 3300025960 Bacteria 5729
202 Ga0207712_10093330 3300025961 Bacteria 2221
203 Ga0207712_10293331 3300025961 Bacteria 1332
204 Ga0207712_10968991 3300025961 Bacteria 754
205 Ga0207640_11644916 3300025981 Bacteria 579
206 Ga0207658_10004751 3300025986 Bacteria 9405
207 Ga0207677_10017062 3300026023 Bacteria 4318
208 Ga0207703_10001524 3300026035 Bacteria 21042
209 Ga0207703_10019203 3300026035 Bacteria 5338
210 Ga0207703_10024678 3300026035 Bacteria 4730
211 Ga0207678_10005556 3300026067 Bacteria 11267
212 Ga0207702_10043700 3300026078 Bacteria 3764
213 Ga0207641_10002325 3300026088 Bacteria 17632
214 Ga0207641_10010988 3300026088 Bacteria 7422
215 Ga0207648_10052141 3300026089 Bacteria 3577
216 Ga0207676_10141379 3300026095 Bacteria 2061
217 Ga0207675_100447158 3300026118 Bacteria 1280
218 Ga0207675_101157852 3300026118 Bacteria 793
219 Ga0207683_10002499 3300026121 Bacteria 16042
220 Ga0207698_10869311 3300026142 Bacteria 907
221 Ga0210000_1009803 3300027462 Bacteria 1413
222 Ga0207428_10117654 3300027907 Bacteria 2040
223 Ga0265354_1003002 3300028016 Bacteria 1956
224 Ga0265356_1000652 3300028017 Bacteria 6018
225 Ga0265355_1001301 3300028036 Bacteria 1594
226 Ga0268266_10000943 3300028379 Bacteria 37110
227 Ga0268266_10010307 3300028379 Bacteria 8174
228 Ga0268266_10018044 3300028379 Bacteria 6013
229 Ga0268266_10078059 3300028379 Bacteria 2880
230 Ga0268266_11518098 3300028379 Bacteria 645
231 Ga0268265_10131702 3300028380 Bacteria 2079
232 Ga0268265_11267149 3300028380 Bacteria 736
233 Ga0268264_10000102 3300028381 Bacteria 222526
234 Ga0268264_10011424 3300028381 Bacteria 7332
235 Ga0268264_10013393 3300028381 Bacteria 6749
236 Ga0307515_10194780 3300028794 Bacteria 1923
237 Ga0265338_10005919 3300028800 Bacteria 15752
238 Ga0265338_10049050 3300028800 Bacteria 3832
239 Ga0265338_10095180 3300028800 Bacteria 2448
240 Ga0265338_10200568 3300028800 Bacteria 1505
241 Ga0265763_1001367 3300030763 Bacteria 1730
242 Ga0265770_1000452 3300030878 Bacteria 5652
243 Ga0265768_101041 3300030963 Bacteria 1237
244 Ga0265760_10001436 3300031090 Bacteria 7017
245 Ga0265760_10016486 3300031090 Bacteria 2120
246 Ga0265320_10230536 3300031240 Bacteria 824
247 Ga0265340_10140260 3300031247 Bacteria 1106
248 Ga0265316_10470706 3300031344 Bacteria 900
249 Ga0307509_10186885 3300031507 Bacteria 1929
250 Ga0307509_10280952 3300031507 Bacteria 1426
251 Ga0316575_10009147 3300031665 Bacteria 3624
252 Ga0316575_10016662 3300031665 Bacteria 2784
253 Ga0316579_10031893 3300031691 Bacteria 2415
254 Ga0265342_10501765 3300031712 Bacteria 619
255 Ga0316576_10011141 3300031727 Bacteria 5876
256 Ga0316576_10118356 3300031727 Bacteria 1988
257 Ga0316578_10026381 3300031728 Bacteria 3277
258 Ga0316578_10078056 3300031728 Bacteria 1967
259 Ga0307516_10001316 3300031730 Bacteria 34466
260 Ga0307416_100101875 3300032002 Bacteria 2502
261 Ga0307416_100612891 3300032002 Bacteria 1170
262 Ga0316593_10005115 3300032168 Bacteria 3430
263 Ga0316593_10115806 3300032168 Bacteria 960
264 Ga0307510_10000006 3300033180 Bacteria 566474
265 Ga0307510_10029950 3300033180 Bacteria 6180
266 Ga0307510_10083840 3300033180 Bacteria 3074
267 Ga0316596_1004126 3300033541 Bacteria 3230
268 Ga0316596_1023684 3300033541 Bacteria 1574
269 Ga0373926_0022611 3300035083 Bacteria 2181
270 Ga0373923_0030963 3300035111 Bacteria 2154
271 Ga0373923_0108715 3300035111 Bacteria 1229
272 Ga0373954_0076921 3300035118 Bacteria 1591
273 Ga0373956_0089228 3300035119 Bacteria 1421
274 Ga0373957_0089402 3300035120 Bacteria 1223
275 Ga0373946_0049639 3300035171 Bacteria 1750
276 Ga0373955_0018691 3300035172 Bacteria 3452
277 Ga0373955_0046500 3300035172 Bacteria 2346
278 Ga0316574_0024069 3300035398 Bacteria 3640
279 Ga0316574_0037387 3300035398 Bacteria 2977
280 Ga0316574_0038892 3300035398 Bacteria 2922
281 Ga0316574_0260206 3300035398 Bacteria 1108
282 Ga0373924_0068613 3300035410 Bacteria 1493
283 Ga0373935_0124420 3300035692 Bacteria 1726
284 Ga0373935_0382277 3300035692 Bacteria 1008
285 Ga0373927_0009161 3300035695 Bacteria 6644
286 Ga0373933_0019812 3300035724 Bacteria 3807
287 Ga0373933_0121455 3300035724 Bacteria 1636
288 Ga0373937_0069392 3300036401 Bacteria 3250
289 Ga0373937_0086972 3300036401 Bacteria 2892
290 Ga0373937_0114140 3300036401 Bacteria 2514
291 Ga0316584_0248223 3300036712 Unclassified 1301
292 Ga0316584_0293643 3300036712 Bacteria 1179
293 Ga0373925_0026649 3300037068 Bacteria 4230
294 Ga0373925_0492416 3300037068 Bacteria 1006
295 Ga0373925_0714458 3300037068 Bacteria 826
296 Ga0395900_0328446 3300037418 Bacteria 1508
297 Ga0395898_0014841 3300037466 Bacteria 7998
298 Ga0395898_0266406 3300037466 Bacteria 1634
299 Ga0395898_0740577 3300037466 Bacteria 924
300 Ga0436364_1319238 3300037853 Bacteria 2301
301 Ga0436364_1434626 3300037853 Bacteria 789
302 Ga0395901_0563062 3300038443 Bacteria 1154
303 Ga0436365_0032067 3300039437 Bacteria 3787
304 Ga0436365_0123496 3300039437 Bacteria 3393
305 Ga0436360_0007268 3300039438 Bacteria 1005
306 Ga0436360_0226775 3300039438 Bacteria 2277
307 Ga0436360_0858685 3300039438 Bacteria 1021
308 Ga0436360_1071583 3300039438 Bacteria 1472
309 Ga0436361_0054611 3300039447 Bacteria 2385
310 Ga0436361_0201021 3300039447 Bacteria 2204
311 Ga0436361_0725603 3300039447 Bacteria 876
312 Ga0436363_0251444 3300039450 Bacteria 1083
313 Ga0436363_0498253 3300039450 Bacteria 9613
314 Ga0436363_0854207 3300039450 Bacteria 3337
315 Ga0436363_1530821 3300039450 Bacteria 2990
316 Ga0436362_0226664 3300039453 Bacteria 2693
317 Ga0436362_0485101 3300039453 Bacteria 1888
318 Ga0436362_0693496 3300039453 Bacteria 3146
319 Ga0436362_0892755 3300039453 Bacteria 928
320 Ga0451807_0310094 3300041486 Bacteria 1035
321 Ga0466966_0002570 3300044684 Bacteria 11886
322 Ga0466964_0000625 3300044706 Bacteria 11251
323 Ga0466971_0001102 3300044719 Bacteria 11213
324 Ga0466968_0018375 3300044735 Bacteria 2804
325 Ga0466970_0013525 3300044765 Bacteria 4185
326 Ga0466957_0529047 3300044842 Bacteria 820
327 Ga0466960_0071463 3300044901 Bacteria 1728
328 Ga0466959_0103445 3300045049 Bacteria 2037
329 Ga0466959_0473198 3300045049 Bacteria 848
330 Ga0451576_0079035 3300045051 Bacteria 3422
331 Ga0451576_1572370 3300045051 Bacteria 682
332 Ga0495591_012181 3300046458 Bacteria 3213
333 Ga0495580_0110709 3300046472 Bacteria 1907
334 Ga0495580_0256741 3300046472 Bacteria 1195
335 Ga0495580_0262299 3300046472 Bacteria 1181
336 Ga0495582_0021138 3300046473 Bacteria 3564
337 Ga0495639_0038324 3300046475 Bacteria 2152
338 Ga0495606_0121762 3300046507 Bacteria 1561
339 Ga0495606_0178577 3300046507 Bacteria 1226
340 Ga0495606_0302734 3300046507 Bacteria 866
341 Ga0495618_0218792 3300046514 Bacteria 1202
342 Ga0495628_0371882 3300046516 Bacteria 1048
343 Ga0495630_0140489 3300046517 Bacteria 1836
344 Ga0495630_0553636 3300046517 Bacteria 882
345 Ga0495643_0036660 3300046522 Bacteria 2693
346 Ga0495644_0042747 3300046523 Bacteria 1706
347 Ga0495663_0172354 3300046525 Bacteria 746
348 Ga0495666_0151868 3300046526 Bacteria 1077
349 Ga0495642_0041099 3300046528 Bacteria 1880
350 Ga0495640_0102492 3300046533 Bacteria 1878
351 Ga0495598_0000303 3300046537 Bacteria 8829
352 Ga0495609_0106656 3300046538 Bacteria 1211
353 Ga0495645_0126845 3300046543 Bacteria 1793
354 Ga0495645_0396572 3300046543 Bacteria 880
355 Ga0495633_0031438 3300046558 Bacteria 2573
356 Ga0495656_0017671 3300046615 Bacteria 2724
357 Ga0495611_0045842 3300046648 Bacteria 1959
358 Ga0495625_0070385 3300046660 Bacteria 2456
359 Ga0495647_0006386 3300046681 Bacteria 3900
360 Ga0495647_0032589 3300046681 Bacteria 1943
361 Ga0495658_0027808 3300046683 Bacteria 3046
362 Ga0495658_0027894 3300046683 Bacteria 3043
363 Ga0495658_0184027 3300046683 Bacteria 1297
364 Ga0495671_0133944 3300046692 Bacteria 1208
365 Ga0495649_0078294 3300046694 Bacteria 1769
366 Ga0495660_0135192 3300046810 Bacteria 1232
367 Ga0495604_0208301 3300047317 Bacteria 1352
368 Ga0495680_0151453 3300047322 Bacteria 1691
369 Ga0495683_0162856 3300047323 Bacteria 1030
370 Ga0495681_0005696 3300047470 Bacteria 8291
371 Ga0495686_0195418 3300047472 Bacteria 1164
372 Ga0496100_0003550 3300048903 Bacteria 8145
373 Ga0496100_0035274 3300048903 Bacteria 3145
374 Ga0496100_0271449 3300048903 Bacteria 1261
375 Ga0496101_0018936 3300048904 Bacteria 4690
376 Ga0496101_0048517 3300048904 Bacteria 3052
377 Ga0496101_0088368 3300048904 Bacteria 2302
378 Ga0496101_0329075 3300048904 Bacteria 1199
379 Ga0496102_0003295 3300048905 Bacteria 13691
380 Ga0496102_0006276 3300048905 Bacteria 10133
381 Ga0496102_0091759 3300048905 Bacteria 2812
382 Ga0496102_0120316 3300048905 Bacteria 2452
383 Ga0496102_0162163 3300048905 Bacteria 2103
384 Ga0496103_0004906 3300048906 Bacteria 8077
385 Ga0496104_0016622 3300048907 Bacteria 6686
386 Ga0496104_0043605 3300048907 Bacteria 4212
387 Ga0496105_0003469 3300048908 Bacteria 11665
388 Ga0496105_0010900 3300048908 Bacteria 7160
389 Ga0496105_0078997 3300048908 Bacteria 2717
390 Ga0496106_0004678 3300048909 Bacteria 10148
391 Ga0496106_0066543 3300048909 Bacteria 2745
392 Ga0496107_0001576 3300048910 Bacteria 14181
393 Ga0496107_0039998 3300048910 Bacteria 3365
394 Ga0496107_0095607 3300048910 Bacteria 2174
395 Ga0496107_0179047 3300048910 Bacteria 1574
396 Ga0496108_0002086 3300048911 Bacteria 15999
397 Ga0496109_0006030 3300048912 Bacteria 10183
398 Ga0496110_0005639 3300048913 Bacteria 9824
399 Ga0496111_0003878 3300048914 Bacteria 9354
400 Ga0496112_0009054 3300048915 Bacteria 8943
401 Ga0496113_0106557 3300048916 Bacteria 2177
402 Ga0496114_0002220 3300048917 Bacteria 14800
403 Ga0496114_0017246 3300048917 Bacteria 5825
404 Ga0496115_0005471 3300048918 Bacteria 9241
405 Ga0496115_0126283 3300048918 Bacteria 2107
406 Ga0496115_0137279 3300048918 Bacteria 2016
407 Ga0496115_0885551 3300048918 Bacteria 689
408 Ga0496116_0024881 3300048919 Bacteria 4415
409 Ga0496117_0000787 3300048920 Bacteria 49745
410 Ga0496117_0073497 3300048920 Bacteria 2281
411 Ga0496118_0000032 3300048921 Bacteria 330072
412 Ga0496118_0013267 3300048921 Bacteria 7811
413 Ga0496119_0052426 3300048922 Bacteria 2498
414 Ga0496120_0020312 3300048923 Bacteria 4225
415 Ga0496120_0175802 3300048923 Bacteria 1055
416 Ga0496121_0000704 3300048924 Bacteria 62218
417 Ga0496121_0192815 3300048924 Bacteria 1459
418 Ga0496124_0006228 3300048927 Bacteria 13069
419 Ga0496125_0001378 3300048928 Bacteria 35674
420 Ga0496125_0005100 3300048928 Bacteria 14779
421 Ga0496125_0081233 3300048928 Bacteria 2477
422 Ga0496125_0279403 3300048928 Bacteria 1035
423 Ga0496126_0011396 3300048929 Bacteria 9209
424 Ga0496126_0404154 3300048929 Bacteria 1107
425 Ga0496126_0999333 3300048929 Bacteria 628
426 Ga0495682_0111199 3300049460 Bacteria 982
427 Ga0501031_0121777 3300049568 Bacteria 1704
428 Ga0501032_0186579 3300049569 Bacteria 1356
429 Ga0501033_0106171 3300049570 Bacteria 2046
430 Ga0501036_0048255 3300049572 Bacteria 3605
431 Ga0501037_0024581 3300049573 Bacteria 4455
432 Ga0501038_0090870 3300049574 Bacteria 2558
433 Ga0501040_0008066 3300049576 Bacteria 6839
434 Ga0501041_0119305 3300049577 Bacteria 1638
435 Ga0501042_0158721 3300049578 Bacteria 1631
436 Ga0501043_0255676 3300049579 Bacteria 1348
437 Ga0501046_0105554 3300049580 Bacteria 2157
438 Ga0501048_0067468 3300049582 Bacteria 2528
439 Ga0501068_0026867 3300049584 Bacteria 3395
440 Ga0501070_0044235 3300049586 Bacteria 3706
441 Ga0501070_0311987 3300049586 Bacteria 1280
442 Ga0501070_0808365 3300049586 Bacteria 736
443 Ga0501071_0003527 3300049587 Bacteria 9786
444 Ga0501071_0046738 3300049587 Bacteria 3109
445 Ga0501072_0025385 3300049588 Bacteria 4617
446 Ga0501072_0284010 3300049588 Bacteria 1316
447 Ga0501073_0089829 3300049589 Bacteria 2136
448 Ga0501075_0055471 3300049591 Bacteria 2981
449 Ga0501075_0277299 3300049591 Bacteria 1278
450 Ga0501076_0022764 3300049592 Bacteria 4818
451 Ga0501077_0029086 3300049593 Bacteria 3512
452 Ga0501077_0059648 3300049593 Bacteria 2422
453 Ga0501077_0121296 3300049593 Bacteria 1657
454 Ga0501080_0037660 3300049742 Bacteria 4517
455 Ga0501081_0018126 3300049743 Bacteria 4672
456 Ga0501083_0067453 3300049744 Bacteria 2382
457 Ga0501083_0079781 3300049744 Bacteria 2170
458 Ga0501035_0180906 3300049822 Bacteria 1816
459 Ga0501044_0260398 3300049823 Bacteria 1673
460 Ga0501045_0084307 3300049824 Bacteria 2344
461 Ga0501045_0649723 3300049824 Bacteria 780
462 nmdc:mga09592_8260_c1 3300050508 Bacteria 8468
463 nmdc:mga08y16_15367_c1 3300050511 Bacteria 8050
464 nmdc:mga08x19_29504_c1 3300050514 Bacteria 3440
465 Ga0495601_0083233 3300053077 Bacteria 2055
466 Ga0495612_0085153 3300053078 Bacteria 1332
467 Ga0495612_0109745 3300053078 Bacteria 1180
468 Ga0495612_0302336 3300053078 Bacteria 718
469 Ga0495619_0091313 3300053085 Bacteria 2062
470 Ga0500583_0052059 3300053092 Bacteria 1904
471 Ga0500558_173529 3300053106 Bacteria 777
472 Ga0500591_078333 3300053115 Bacteria 1477
473 Ga0500616_0007626 3300053153 Bacteria 6839
474 Ga0501084_0144399 3300054114 Bacteria 2004
475 Ga0501084_0997132 3300054114 Bacteria 704
476 Ga0587082_085789 3300059504 Bacteria 664
477 Ga0587067_027451 3300059640 Bacteria 1027
478 Ga0587076_086292 3300059645 Bacteria 678
479 Ga0501082_0087089 3300060353 Bacteria 2694
480 Ga0501082_0679045 3300060353 Bacteria 901
481 Ga0466962_0001207 3300061719 Bacteria 11873
482 Ga0530510_0078825 3300061734 Bacteria 2396
483 Ga0530510_0119058 3300061734 Bacteria 1938
484 Ga0530510_0170978 3300061734 Bacteria 1609
485 2600813797 2600255067 Bacteria 6795583
486 Ga0207663_10369561
487 LJNas_1003798
488 LJNas_1018000
489 Ga0058863_11971832
490 Ga0065707_10173760
491 Ga0070670_100042316
492 Ga0068869_101163005
493 Ga0070666_10001446
494 Ga0070680_100262924
495 Ga0068868_100008294
496 Ga0070675_100227307
497 Ga0070671_100003161
498 Ga0070671_100005400
499 Ga0070667_100012347
500 Ga0070667_100055472
501 Ga0070709_10009928
502 Ga0070709_10015515
503 Ga0070709_10121175
504 Ga0070714_100009500
505 Ga0070714_100032759
506 Ga0070713_100001795
507 Ga0070713_100006105
508 Ga0070713_100409524
509 Ga0070710_10254165
510 Ga0070711_100001465
511 Ga0070711_100025752
512 Ga0070711_100054156
513 Ga0070711_100152918
514 Ga0070705_100281745
515 Ga0070663_100042078
516 Ga0070663_101024477
517 Ga0070678_100002594
518 Ga0070681_10035786
519 Ga0070681_10281253
520 Ga0068867_100034823
521 Ga0070699_100038586
522 Ga0070679_100017288
523 Ga0068853_100093611
524 Ga0068853_100303829
525 Ga0070672_100123866
526 Ga0070686_100067091
527 Ga0070695_100002554
528 Ga0070696_100001443
529 Ga0070665_100005442
530 Ga0070665_100014481
531 Ga0070665_100045273
532 Ga0070665_100047121
533 Ga0068855_100032357
534 Ga0068855_100114994
535 Ga0068855_100285468
536 Ga0070664_100082104
537 Ga0068854_100104735
538 Ga0068856_100006458
539 Ga0068856_100042931
540 Ga0068856_100161497
541 Ga0070702_100447944
542 Ga0068852_100874579
543 Ga0068859_100000641
544 Ga0068859_100056515
545 Ga0068866_10002031
546 Ga0068863_100008761
547 Ga0068858_100000125
548 Ga0068858_100004270
549 Ga0068858_100054829
550 Ga0068858_100364805
551 Ga0068860_100006244
552 Ga0068860_100009263
553 Ga0068860_100010872
554 Ga0068862_100117477
555 Ga0081455_10000719
556 Ga0081455_10423156
557 Ga0070717_10213898
558 Ga0070715_10000668
559 Ga0070715_10032786
560 Ga0070716_100034519
561 Ga0070716_100069198
562 Ga0070712_100001456
563 Ga0070712_100057768
564 Ga0070712_100250139
565 Ga0097621_100003525
566 Ga0068871_100044280
567 Ga0075428_100792515
568 Ga0075428_101643673
569 Ga0075430_100302524
570 Ga0075429_100025759
571 Ga0068865_100001214
572 Ga0075436_100243591
573 Ga0097620_100000641
574 Ga0097620_100056514
575 Ga0099794_10054040
576 Ga0099794_10137971
577 Ga0099795_10000254
578 Ga0099795_10046176
579 Ga0105250_10072284
580 Ga0105240_10065094
581 Ga0105240_10086135
582 Ga0105240_10459695
583 Ga0105240_10496035
584 Ga0111539_10575152
585 Ga0105245_10099675
586 Ga0105247_10002466
587 Ga0105247_10015909
588 Ga0105241_10011879
589 Ga0105242_10003628
590 Ga0105248_10003146
591 Ga0105248_10005842
592 Ga0105248_10260281
593 Ga0105237_10096005
594 Ga0105237_10099219
595 Ga0105238_10022279
596 Ga0105238_10248804
597 Ga0105238_10337205
598 Ga0105249_10014582
599 Ga0105249_10115367
600 Ga0105249_10690590
601 Ga0099796_10005277
602 Ga0099796_10161632
603 Ga0105246_10036204
604 Ga0157373_10448086
605 Ga0157370_10253845
606 Ga0157370_10343782
607 Ga0157369_10015323
608 Ga0157369_10051835
609 Ga0157369_10988423
610 Ga0157374_10002813
611 Ga0157374_10361226
612 Ga0157378_10006374
613 Ga0163162_10006236
614 Ga0163162_10026596
615 Ga0163162_10096841
616 Ga0157372_10049576
617 Ga0157375_10006856
618 Ga0163163_10007457
619 Ga0163163_10171101
620 Ga0157379_10006918
621 Ga0157379_10055138
622 Ga0157379_10082681
623 Ga0157379_10104840
624 Ga0157376_10131141
625 Ga0206351_10700694
626 Ga0206354_10785729
627 Ga0206353_11779741
628 Ga0213874_10021138
629 Ga0213874_10153789
630 Ga0213871_10014920
631 Ga0207692_10065245
632 Ga0207642_10016853
633 Ga0207710_10000332
634 Ga0207710_10009562
635 Ga0207710_10010376
636 Ga0207710_10056714
637 Ga0207680_10009301
638 Ga0207680_10063035
639 Ga0207680_10264563
640 Ga0207685_10000121
641 Ga0207685_10032092
642 Ga0207699_10051184
643 Ga0207654_10034349
644 Ga0207707_10000276
645 Ga0207707_10000410
646 Ga0207707_10025066
647 Ga0207707_10181062
648 Ga0207695_10052562
649 Ga0207695_10072121
650 Ga0207695_10234878
651 Ga0207671_10010563
652 Ga0207671_10073947
653 Ga0207671_10340351
654 Ga0207671_10466977
655 Ga0207693_10000448
656 Ga0207693_10096881
657 Ga0207693_10172430
658 Ga0207663_10046147
659 Ga0207660_10002217
660 Ga0207657_10063277
661 Ga0207649_11013164
662 Ga0207652_10003383
663 Ga0207694_10003326
664 Ga0207650_10025940
665 Ga0207687_10076669
666 Ga0207700_10003609
667 Ga0207700_10030554
668 Ga0207700_10098071
669 Ga0207664_10007010
670 Ga0207664_10040627
671 Ga0207644_10000428
672 Ga0207644_10004012
673 Ga0207686_10007583
674 Ga0207709_10529278
675 Ga0207704_10002424
676 Ga0207665_10122982
677 Ga0207691_10122749
678 Ga0207711_10004185
679 Ga0207711_10078295
680 Ga0207711_10147675
681 Ga0207679_10093035
682 Ga0207667_10008242
683 Ga0207667_10034654
684 Ga0207667_10048865
685 Ga0207667_11412403
686 Ga0207651_10007788
687 Ga0207712_10093330
688 Ga0207712_10293331
689 Ga0207712_10968991
690 Ga0207640_11644916
691 Ga0207658_10004751
692 Ga0207677_10017062
693 Ga0207703_10001524
694 Ga0207703_10019203
695 Ga0207703_10024678
696 Ga0207678_10005556
697 Ga0207702_10043700
698 Ga0207641_10002325
699 Ga0207641_10010988
700 Ga0207648_10052141
701 Ga0207676_10141379
702 Ga0207675_100447158
703 Ga0207675_101157852
704 Ga0207683_10002499
705 Ga0207698_10869311
706 Ga0210000_1009803
707 Ga0207428_10117654
708 Ga0265354_1003002
709 Ga0265356_1000652
710 Ga0265355_1001301
711 Ga0268266_10000943
712 Ga0268266_10010307
713 Ga0268266_10018044
714 Ga0268266_10078059
715 Ga0268266_11518098
716 Ga0268265_10131702
717 Ga0268265_11267149
718 Ga0268264_10000102
719 Ga0268264_10011424
720 Ga0268264_10013393
721 Ga0307515_10194780
722 Ga0265338_10005919
723 Ga0265338_10049050
724 Ga0265338_10095180
725 Ga0265338_10200568
726 Ga0265763_1001367
727 Ga0265770_1000452
728 Ga0265768_101041
729 Ga0265760_10001436
730 Ga0265760_10016486
731 Ga0265320_10230536
732 Ga0265340_10140260
733 Ga0265316_10470706
734 Ga0307509_10186885
735 Ga0307509_10280952
736 Ga0316575_10009147
737 Ga0316575_10016662
738 Ga0316579_10031893
739 Ga0265342_10501765
740 Ga0316576_10011141
741 Ga0316576_10118356
742 Ga0316578_10026381
743 Ga0316578_10078056
744 Ga0307516_10001316
745 Ga0307416_100101875
746 Ga0307416_100612891
747 Ga0316593_10005115
748 Ga0316593_10115806
749 Ga0307510_10000006
750 Ga0307510_10029950
751 Ga0307510_10083840
752 Ga0316596_1004126
753 Ga0316596_1023684
754 Ga0373926_0022611
755 Ga0373923_0030963
756 Ga0373923_0108715
757 Ga0373954_0076921
758 Ga0373956_0089228
759 Ga0373957_0089402
760 Ga0373946_0049639
761 Ga0373955_0018691
762 Ga0373955_0046500
763 Ga0316574_0024069
764 Ga0316574_0037387
765 Ga0316574_0038892
766 Ga0316574_0260206
767 Ga0373924_0068613
768 Ga0373935_0124420
769 Ga0373935_0382277
770 Ga0373927_0009161
771 Ga0373933_0019812
772 Ga0373933_0121455
773 Ga0373937_0069392
774 Ga0373937_0086972
775 Ga0373937_0114140
776 Ga0316584_0248223
777 Ga0316584_0293643
778 Ga0373925_0026649
779 Ga0373925_0492416
780 Ga0373925_0714458
781 Ga0395900_0328446
782 Ga0395898_0014841
783 Ga0395898_0266406
784 Ga0395898_0740577
785 Ga0436364_1319238
786 Ga0436364_1434626
787 Ga0395901_0563062
788 Ga0436365_0032067
789 Ga0436365_0123496
790 Ga0436360_0007268
791 Ga0436360_0226775
792 Ga0436360_0858685
793 Ga0436360_1071583
794 Ga0436361_0054611
795 Ga0436361_0201021
796 Ga0436361_0725603
797 Ga0436363_0251444
798 Ga0436363_0498253
799 Ga0436363_0854207
800 Ga0436363_1530821
801 Ga0436362_0226664
802 Ga0436362_0485101
803 Ga0436362_0693496
804 Ga0436362_0892755
805 Ga0451807_0310094
806 Ga0466966_0002570
807 Ga0466964_0000625
808 Ga0466971_0001102
809 Ga0466968_0018375
810 Ga0466970_0013525
811 Ga0466957_0529047
812 Ga0466960_0071463
813 Ga0466959_0103445
814 Ga0466959_0473198
815 Ga0451576_0079035
816 Ga0451576_1572370
817 Ga0495591_012181
818 Ga0495580_0110709
819 Ga0495580_0256741
820 Ga0495580_0262299
821 Ga0495582_0021138
822 Ga0495639_0038324
823 Ga0495606_0121762
824 Ga0495606_0178577
825 Ga0495606_0302734
826 Ga0495618_0218792
827 Ga0495628_0371882
828 Ga0495630_0140489
829 Ga0495630_0553636
830 Ga0495643_0036660
831 Ga0495644_0042747
832 Ga0495663_0172354
833 Ga0495666_0151868
834 Ga0495642_0041099
835 Ga0495640_0102492
836 Ga0495598_0000303
837 Ga0495609_0106656
838 Ga0495645_0126845
839 Ga0495645_0396572
840 Ga0495633_0031438
841 Ga0495656_0017671
842 Ga0495611_0045842
843 Ga0495625_0070385
844 Ga0495647_0006386
845 Ga0495647_0032589
846 Ga0495658_0027808
847 Ga0495658_0027894
848 Ga0495658_0184027
849 Ga0495671_0133944
850 Ga0495649_0078294
851 Ga0495660_0135192
852 Ga0495604_0208301
853 Ga0495680_0151453
854 Ga0495683_0162856
855 Ga0495681_0005696
856 Ga0495686_0195418
857 Ga0496100_0003550
858 Ga0496100_0035274
859 Ga0496100_0271449
860 Ga0496101_0018936
861 Ga0496101_0048517
862 Ga0496101_0088368
863 Ga0496101_0329075
864 Ga0496102_0003295
865 Ga0496102_0006276
866 Ga0496102_0091759
867 Ga0496102_0120316
868 Ga0496102_0162163
869 Ga0496103_0004906
870 Ga0496104_0016622
871 Ga0496104_0043605
872 Ga0496105_0003469
873 Ga0496105_0010900
874 Ga0496105_0078997
875 Ga0496106_0004678
876 Ga0496106_0066543
877 Ga0496107_0001576
878 Ga0496107_0039998
879 Ga0496107_0095607
880 Ga0496107_0179047
881 Ga0496108_0002086
882 Ga0496109_0006030
883 Ga0496110_0005639
884 Ga0496111_0003878
885 Ga0496112_0009054
886 Ga0496113_0106557
887 Ga0496114_0002220
888 Ga0496114_0017246
889 Ga0496115_0005471
890 Ga0496115_0126283
891 Ga0496115_0137279
892 Ga0496115_0885551
893 Ga0496116_0024881
894 Ga0496117_0000787
895 Ga0496117_0073497
896 Ga0496118_0000032
897 Ga0496118_0013267
898 Ga0496119_0052426
899 Ga0496120_0020312
900 Ga0496120_0175802
901 Ga0496121_0000704
902 Ga0496121_0192815
903 Ga0496124_0006228
904 Ga0496125_0001378
905 Ga0496125_0005100
906 Ga0496125_0081233
907 Ga0496125_0279403
908 Ga0496126_0011396
909 Ga0496126_0404154
910 Ga0496126_0999333
911 Ga0495682_0111199
912 Ga0501031_0121777
913 Ga0501032_0186579
914 Ga0501033_0106171
915 Ga0501036_0048255
916 Ga0501037_0024581
917 Ga0501038_0090870
918 Ga0501040_0008066
919 Ga0501041_0119305
920 Ga0501042_0158721
921 Ga0501043_0255676
922 Ga0501046_0105554
923 Ga0501048_0067468
924 Ga0501068_0026867
925 Ga0501070_0044235
926 Ga0501070_0311987
927 Ga0501070_0808365
928 Ga0501071_0003527
929 Ga0501071_0046738
930 Ga0501072_0025385
931 Ga0501072_0284010
932 Ga0501073_0089829
933 Ga0501075_0055471
934 Ga0501075_0277299
935 Ga0501076_0022764
936 Ga0501077_0029086
937 Ga0501077_0059648
938 Ga0501077_0121296
939 Ga0501080_0037660
940 Ga0501081_0018126
941 Ga0501083_0067453
942 Ga0501083_0079781
943 Ga0501035_0180906
944 Ga0501044_0260398
945 Ga0501045_0084307
946 Ga0501045_0649723
947 nmdc:mga09592_8260_c1
948 nmdc:mga08y16_15367_c1
949 nmdc:mga08x19_29504_c1
950 Ga0495601_0083233
951 Ga0495612_0085153
952 Ga0495612_0109745
953 Ga0495612_0302336
954 Ga0495619_0091313
955 Ga0500583_0052059
956 Ga0500558_173529
957 Ga0500591_078333
958 Ga0500616_0007626
959 Ga0501084_0144399
960 Ga0501084_0997132
961 Ga0587082_085789
962 Ga0587067_027451
963 Ga0587076_086292
964 Ga0501082_0087089
965 Ga0501082_0679045
966 Ga0466962_0001207
967 Ga0530510_0078825
968 Ga0530510_0119058
969 Ga0530510_0170978
970 2600813797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

125

200

0.99

PF02421

FeoB_N

Ferrous iron transport protein B

3

81

0.93

PF00347

Ribosomal_L6

Ribosomal protein L6

58

117

0.87

PF01926

MMR_HSR1

50S ribosome-binding GTPase

4

125

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9604 1 169
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9603 1 168
8cgv-assembly1.cif.gz_g tiamulin bound to the 50s subunit 0.9587 1 171
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9551 1 169
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9548 1 169
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9435 77 168 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9395 77 169 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9386 1 76 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9322 79 171 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9322 77 171 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A2T4CLW1-F1-model_v4 50S ribosomal protein L6 0.9815 1 150 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9767 67 162
AF-A0A6A5L2Q1-F1-model_v4 deleted 0.9733 1 166
AF-A0A352Q4J4-F1-model_v4 50S ribosomal protein L6 0.9731 1 143 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6A5LCT1-F1-model_v4 deleted 0.972 2 163

Map