F452971

General Info

Members Datasets Scaffolds Average Seq Length
484 278 481 322

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0013508|Ga0373925_0013508_1166_2218
Length 350
Sequence MGRRRQGGEDPDRLSAETSMARIVFAAGTSHTPMLLASDETLPRFVETDQKMKHRDKEGRPVTYGDLLERADPKLAHMVAPEHLVARQNVARAAVRHLRDAVSAAALDALVVFGDDQNESYLEDCRPTFAIYYGDTIRNSNVQHQAYSHLPDWYIKNRSAFFEPDAPRDYPVHAALAMHLIPALAAADFDVASSKSLRTGEGEGHAVAYVHRHVLDARQPVPVVPVFLNTYFPPNQPSPRRCYLLGQAVRKAVEGFPGDARVGVLASGGLSHFLVDEDFDRAILKALADKDAAFLRTLPPGKLHAGSSEILNWVAVAGAAEALDLDWFEYVPGYRTPAGTGTGMSFATWR

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 1.24
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0
Rhizoplane 1.24
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10018193 3300003911 Bacteria 1401
2 Ga0058862_12441534 3300004803 Bacteria 1014
3 Ga0065714_10089046 3300005288 Bacteria 1994
4 Ga0065712_10073141 3300005290 Unclassified 4480
5 Ga0065715_10106044 3300005293 Unclassified 2854
6 Ga0065707_10001580 3300005295 Bacteria 11558
7 Ga0070658_10314738 3300005327 Unclassified 1336
8 Ga0070683_100026552 3300005329 Bacteria 5216
9 Ga0070690_100168873 3300005330 Unclassified 1504
10 Ga0070670_100009039 3300005331 Bacteria 8511
11 Ga0070670_100137961 3300005331 Bacteria 2108
12 Ga0070666_10210396 3300005335 Bacteria 1369
13 Ga0070680_100064046 3300005336 Unclassified 3012
14 Ga0070682_100139591 3300005337 Unclassified 1650
15 Ga0070660_100055345 3300005339 Bacteria 3065
16 Ga0070691_10078481 3300005341 Bacteria 1613
17 Ga0070661_100071544 3300005344 Unclassified 2552
18 Ga0070692_10102329 3300005345 Bacteria 1572
19 Ga0070671_100003473 3300005355 Bacteria 12306
20 Ga0070667_100036074 3300005367 Unclassified 4145
21 Ga0070714_100014781 3300005435 Bacteria 6272
22 Ga0070714_100107043 3300005435 Bacteria 2471
23 Ga0070714_100443293 3300005435 Bacteria 1232
24 Ga0070713_100034988 3300005436 Bacteria 4041
25 Ga0070711_100003534 3300005439 Bacteria 9120
26 Ga0070705_100328081 3300005440 Bacteria 1108
27 Ga0070708_100094804 3300005445 Bacteria 2724
28 Ga0070708_100175682 3300005445 Bacteria 2001
29 Ga0070708_100332383 3300005445 Bacteria 1432
30 Ga0070678_100040980 3300005456 Bacteria 3280
31 Ga0070662_100039879 3300005457 Unclassified 3342
32 Ga0070662_100158624 3300005457 Bacteria 1768
33 Ga0070681_10099920 3300005458 Bacteria 2847
34 Ga0070681_10302944 3300005458 Bacteria 1507
35 Ga0070681_10408215 3300005458 Bacteria 1270
36 Ga0070706_100212030 3300005467 Bacteria 1808
37 Ga0070706_100247634 3300005467 Bacteria 1664
38 Ga0070707_100004593 3300005468 Bacteria 12919
39 Ga0070707_100026639 3300005468 Bacteria 5491
40 Ga0070707_100511898 3300005468 Bacteria 1162
41 Ga0070698_100003592 3300005471 Bacteria 17049
42 Ga0070698_100133169 3300005471 Bacteria 2440
43 Ga0070699_100091118 3300005518 Bacteria 2665
44 Ga0070679_100011439 3300005530 Bacteria 8458
45 Ga0070679_100298628 3300005530 Bacteria 1561
46 Ga0070684_100029837 3300005535 Bacteria 4626
47 Ga0070684_100476334 3300005535 Bacteria 1155
48 Ga0070697_100136972 3300005536 Bacteria 2056
49 Ga0070672_100283242 3300005543 Bacteria 1402
50 Ga0070686_100141960 3300005544 Unclassified 1672
51 Ga0070695_100212634 3300005545 Bacteria 1389
52 Ga0070696_100069754 3300005546 Bacteria 2471
53 Ga0070665_100027641 3300005548 Bacteria 5713
54 Ga0070665_100061224 3300005548 Bacteria 3772
55 Ga0068855_100101379 3300005563 Bacteria 3314
56 Ga0068855_100141437 3300005563 Bacteria 2742
57 Ga0070664_100406729 3300005564 Bacteria 1245
58 Ga0068857_100368332 3300005577 Bacteria 1333
59 Ga0068854_100073332 3300005578 Unclassified 2509
60 Ga0068856_100020190 3300005614 Bacteria 6471
61 Ga0068856_100046460 3300005614 Bacteria 4277
62 Ga0068859_100103092 3300005617 Bacteria 2911
63 Ga0068859_100421954 3300005617 Bacteria 1430
64 Ga0068864_100281592 3300005618 Unclassified 1552
65 Ga0068863_100332049 3300005841 Unclassified 1478
66 Ga0081455_10000043 3300005937 Bacteria 132283
67 Ga0081455_10000301 3300005937 Bacteria 65118
68 Ga0081455_10011374 3300005937 Bacteria 8945
69 Ga0081455_10040953 3300005937 Unclassified 4081
70 Ga0081455_10055852 3300005937 Bacteria 3356
71 Ga0081455_10141249 3300005937 Bacteria 1870
72 Ga0081538_10002729 3300005981 Bacteria 16958
73 Ga0081538_10026634 3300005981 Bacteria 4037
74 Ga0081538_10039426 3300005981 Unclassified 3030
75 Ga0081538_10042635 3300005981 Bacteria 2860
76 Ga0081538_10073773 3300005981 Unclassified 1862
77 Ga0081539_10001802 3300005985 Bacteria 33905
78 Ga0070717_10004284 3300006028 Bacteria 10285
79 Ga0070717_10141821 3300006028 Bacteria 2073
80 Ga0070717_10152106 3300006028 Bacteria 2002
81 Ga0075365_10190005 3300006038 Bacteria 1437
82 Ga0075363_100008831 3300006048 Bacteria 4714
83 Ga0075364_10023557 3300006051 Bacteria 3899
84 Ga0070712_100060503 3300006175 Bacteria 2671
85 Ga0070712_100216066 3300006175 Bacteria 1515
86 Ga0075362_10008379 3300006177 Bacteria 3950
87 Ga0075362_10026101 3300006177 Unclassified 2492
88 Ga0075369_10003043 3300006186 Bacteria 6066
89 Ga0075366_10019835 3300006195 Unclassified 3896
90 Ga0075366_10022090 3300006195 Bacteria 3699
91 Ga0075366_10094267 3300006195 Bacteria 1794
92 Ga0075370_10074219 3300006353 Bacteria 1949
93 Ga0075370_10090597 3300006353 Bacteria 1764
94 Ga0068871_100078634 3300006358 Unclassified 2727
95 Ga0075428_100068420 3300006844 Unclassified 3884
96 Ga0075428_100199187 3300006844 Bacteria 2165
97 Ga0075428_100226099 3300006844 Bacteria 2020
98 Ga0075428_100436399 3300006844 Bacteria 1403
99 Ga0075430_100022936 3300006846 Bacteria 5309
100 Ga0075431_100033468 3300006847 Bacteria 5297
101 Ga0075431_100297323 3300006847 Bacteria 1631
102 Ga0075433_10010287 3300006852 Bacteria 7504
103 Ga0075433_10040339 3300006852 Unclassified 4041
104 Ga0075433_10082447 3300006852 Bacteria 2836
105 Ga0075433_10133961 3300006852 Unclassified 2202
106 Ga0075433_10177368 3300006852 Bacteria 1896
107 Ga0075434_100002235 3300006871 Bacteria 16912
108 Ga0075434_100008677 3300006871 Bacteria 9465
109 Ga0075434_100107140 3300006871 Bacteria 2805
110 Ga0075434_100278164 3300006871 Unclassified 1693
111 Ga0075429_100395060 3300006880 Bacteria 1211
112 Ga0075436_100023920 3300006914 Bacteria 4199
113 Ga0075436_100048315 3300006914 Bacteria 2936
114 Ga0075436_100131580 3300006914 Unclassified 1755
115 Ga0097620_100103091 3300006931 Bacteria 2911
116 Ga0097620_100421993 3300006931 Bacteria 1430
117 Ga0075435_100005085 3300007076 Bacteria 9139
118 Ga0075435_100020710 3300007076 Bacteria 5046
119 Ga0075435_100394381 3300007076 Bacteria 1190
120 Ga0075435_100426382 3300007076 Bacteria 1143
121 Ga0099795_10004859 3300007788 Bacteria 3513
122 Ga0099795_10012645 3300007788 Bacteria 2567
123 Ga0099795_10054238 3300007788 Bacteria 1469
124 Ga0105240_10160452 3300009093 Bacteria 2671
125 Ga0111539_10026266 3300009094 Bacteria 7122
126 Ga0111539_10113523 3300009094 Bacteria 3178
127 Ga0111539_10348619 3300009094 Unclassified 1723
128 Ga0111539_10544781 3300009094 Bacteria 1352
129 Ga0114129_10061321 3300009147 Bacteria 5255
130 Ga0114129_10138157 3300009147 Bacteria 3343
131 Ga0114129_10417160 3300009147 Bacteria 1766
132 Ga0114129_11067961 3300009147 Unclassified 1013
133 Ga0105035_104981 3300009988 Bacteria 1066
134 Ga0099796_10001075 3300010159 Bacteria 5217
135 Ga0099796_10007704 3300010159 Bacteria 2828
136 Ga0105239_10141705 3300010375 Unclassified 2679
137 Ga0105239_10464759 3300010375 Bacteria 1436
138 Ga0157373_10069533 3300013100 Bacteria 2489
139 Ga0157370_10109579 3300013104 Bacteria 2581
140 Ga0157369_10113083 3300013105 Bacteria 2884
141 Ga0157378_10014939 3300013297 Bacteria 6796
142 Ga0157378_10406164 3300013297 Bacteria 1343
143 Ga0157372_10045260 3300013307 Unclassified 4881
144 Ga0163163_10456996 3300014325 Unclassified 1337
145 Ga0182008_10009647 3300014497 Bacteria 5199
146 Ga0183362_10010 3300015683 Bacteria 106392
147 Ga0197907_10162685 3300020069 Bacteria 1605
148 Ga0206352_11005722 3300020078 Bacteria 1488
149 Ga0213873_10014078 3300021358 Bacteria 1767
150 Ga0213872_10016220 3300021361 Bacteria 3459
151 Ga0213876_10003178 3300021384 Bacteria 9453
152 Ga0213876_10074559 3300021384 Unclassified 1792
153 Ga0213875_10000823 3300021388 Bacteria 23085
154 Ga0213875_10012126 3300021388 Bacteria 4263
155 Ga0213875_10015912 3300021388 Bacteria 3654
156 Ga0213871_10002718 3300021441 Bacteria 3297
157 Ga0224712_10020205 3300022467 Bacteria 2257
158 Ga0224712_10144871 3300022467 Unclassified 1048
159 Ga0207682_10013854 3300025893 Unclassified 3140
160 Ga0207692_10163602 3300025898 Bacteria 1284
161 Ga0207680_10093279 3300025903 Bacteria 1920
162 Ga0207680_10143742 3300025903 Bacteria 1584
163 Ga0207647_10129278 3300025904 Bacteria 1485
164 Ga0207645_10001093 3300025907 Bacteria 22381
165 Ga0207705_10243269 3300025909 Unclassified 1371
166 Ga0207684_10371352 3300025910 Bacteria 1230
167 Ga0207707_10017654 3300025912 Bacteria 6223
168 Ga0207707_10064534 3300025912 Unclassified 3188
169 Ga0207695_10405847 3300025913 Bacteria 1247
170 Ga0207693_10000731 3300025915 Bacteria 29597
171 Ga0207693_10034474 3300025915 Bacteria 3992
172 Ga0207693_10077508 3300025915 Unclassified 2603
173 Ga0207693_10111259 3300025915 Bacteria 2148
174 Ga0207693_10181945 3300025915 Bacteria 1654
175 Ga0207663_10106042 3300025916 Bacteria 1898
176 Ga0207660_10201146 3300025917 Bacteria 1556
177 Ga0207662_10239326 3300025918 Bacteria 1188
178 Ga0207657_10060308 3300025919 Bacteria 3256
179 Ga0207652_10050761 3300025921 Bacteria 3554
180 Ga0207652_10059852 3300025921 Unclassified 3284
181 Ga0207646_10009580 3300025922 Bacteria 9554
182 Ga0207646_10056535 3300025922 Bacteria 3506
183 Ga0207646_10238338 3300025922 Bacteria 1644
184 Ga0207650_10004896 3300025925 Bacteria 9143
185 Ga0207650_10125162 3300025925 Bacteria 2006
186 Ga0207700_10024629 3300025928 Bacteria 4167
187 Ga0207700_10104122 3300025928 Bacteria 2270
188 Ga0207700_10240756 3300025928 Bacteria 1542
189 Ga0207664_10109049 3300025929 Bacteria 2300
190 Ga0207664_10111879 3300025929 Bacteria 2272
191 Ga0207664_10305608 3300025929 Bacteria 1400
192 Ga0207644_10066293 3300025931 Unclassified 2628
193 Ga0207690_10210945 3300025932 Bacteria 1481
194 Ga0207690_10286734 3300025932 Unclassified 1284
195 Ga0207704_10149850 3300025938 Unclassified 1644
196 Ga0207665_10035113 3300025939 Bacteria 3326
197 Ga0207691_10006178 3300025940 Bacteria 11574
198 Ga0207691_10170029 3300025940 Bacteria 1909
199 Ga0207661_10124301 3300025944 Bacteria 2201
200 Ga0207679_10104357 3300025945 Bacteria 2224
201 Ga0207679_10186221 3300025945 Unclassified 1721
202 Ga0207667_10063210 3300025949 Bacteria 3868
203 Ga0207667_10130113 3300025949 Bacteria 2592
204 Ga0207658_10059892 3300025986 Unclassified 2839
205 Ga0207678_10030109 3300026067 Unclassified 4739
206 Ga0207702_10085194 3300026078 Bacteria 2753
207 Ga0207702_10260180 3300026078 Bacteria 1633
208 Ga0207702_10297583 3300026078 Bacteria 1531
209 Ga0207675_100167290 3300026118 Unclassified 2100
210 Ga0209973_1007671 3300027252 Bacteria 1211
211 Ga0209967_1003125 3300027364 Bacteria 2171
212 Ga0209984_1000911 3300027424 Bacteria 3164
213 Ga0209179_1009636 3300027512 Bacteria 1663
214 Ga0209982_1006733 3300027552 Bacteria 1674
215 Ga0209971_1003905 3300027682 Unclassified 3526
216 Ga0209966_1002843 3300027695 Bacteria 2904
217 Ga0209974_10004211 3300027876 Bacteria 5139
218 Ga0207428_10008757 3300027907 Bacteria 9128
219 Ga0268266_10012578 3300028379 Bacteria 7313
220 Ga0268266_10091181 3300028379 Bacteria 2672
221 Ga0268266_10147824 3300028379 Bacteria 2115
222 Ga0268266_10169866 3300028379 Unclassified 1979
223 Ga0268264_10289136 3300028381 Bacteria 1539
224 Ga0265338_10114124 3300028800 Bacteria 2168
225 Ga0265763_1000520 3300030763 Bacteria 2374
226 Ga0265332_10009572 3300031238 Bacteria 4322
227 Ga0265325_10006612 3300031241 Bacteria 7023
228 Ga0265325_10092220 3300031241 Bacteria 1492
229 Ga0265329_10018922 3300031242 Bacteria 2348
230 Ga0265340_10006360 3300031247 Bacteria 6509
231 Ga0265339_10000034 3300031249 Bacteria 125636
232 Ga0265339_10040493 3300031249 Bacteria 2589
233 Ga0265331_10008600 3300031250 Bacteria 5794
234 Ga0307513_10378092 3300031456 Bacteria 1156
235 Ga0307408_100017855 3300031548 Bacteria 4754
236 Ga0265313_10000185 3300031595 Bacteria 66161
237 Ga0265342_10000026 3300031712 Bacteria 166610
238 Ga0307405_10205662 3300031731 Unclassified 1433
239 Ga0307409_100589108 3300031995 Unclassified 1097
240 Ga0373926_0063201 3300035083 Bacteria 1352
241 Ga0373926_0079210 3300035083 Bacteria 1213
242 Ga0373936_0000456 3300035113 Bacteria 13739
243 Ga0373953_0012708 3300035117 Bacteria 2989
244 Ga0373954_0001257 3300035118 Bacteria 10191
245 Ga0373954_0007726 3300035118 Bacteria 4704
246 Ga0373956_0055609 3300035119 Bacteria 1785
247 Ga0373960_0024031 3300035121 Bacteria 1645
248 Ga0373943_0077612 3300035170 Bacteria 1696
249 Ga0373946_0064434 3300035171 Bacteria 1567
250 Ga0373955_0044240 3300035172 Bacteria 2397
251 Ga0373924_0031896 3300035410 Bacteria 2120
252 Ga0373931_0116948 3300035691 Bacteria 1520
253 Ga0373935_0000136 3300035692 Bacteria 33845
254 Ga0373935_0008926 3300035692 Bacteria 5999
255 Ga0373935_0132472 3300035692 Bacteria 1676
256 Ga0373935_0236958 3300035692 Unclassified 1273
257 Ga0373933_0005809 3300035724 Bacteria 6713
258 Ga0373947_0012938 3300035725 Bacteria 4785
259 Ga0373947_0030385 3300035725 Unclassified 3174
260 Ga0373947_0304546 3300035725 Bacteria 1063
261 Ga0373937_0000643 3300036401 Bacteria 30619
262 Ga0373937_0046738 3300036401 Bacteria 3959
263 Ga0373937_0098159 3300036401 Bacteria 2717
264 Ga0373937_0305012 3300036401 Bacteria 1505
265 Ga0373925_0000931 3300037068 Bacteria 26647
266 Ga0373925_0013508 3300037068 Bacteria 5912
267 Ga0373925_0027667 3300037068 Bacteria 4150
268 Ga0373925_0136477 3300037068 Bacteria 1917
269 Ga0373925_0183547 3300037068 Bacteria 1657
270 Ga0395899_0001894 3300037312 Bacteria 17272
271 Ga0395899_0009759 3300037312 Bacteria 7365
272 Ga0395899_0013106 3300037312 Bacteria 6340
273 Ga0395900_0002661 3300037418 Bacteria 19525
274 Ga0395900_0003260 3300037418 Bacteria 17577
275 Ga0395900_0019217 3300037418 Bacteria 6966
276 Ga0395900_0069776 3300037418 Bacteria 3612
277 Ga0395898_0004813 3300037466 Bacteria 14690
278 Ga0395898_0013304 3300037466 Bacteria 8473
279 Ga0395898_0022782 3300037466 Bacteria 6338
280 Ga0395905_0001043 3300037471 Bacteria 35100
281 Ga0395905_0205891 3300037471 Bacteria 1844
282 Ga0436364_0031022 3300037853 Bacteria 9757
283 Ga0436364_0103806 3300037853 Bacteria 67638
284 Ga0436364_0138009 3300037853 Bacteria 4857
285 Ga0436364_0466445 3300037853 Bacteria 33380
286 Ga0436364_1470617 3300037853 Bacteria 2653
287 Ga0395901_0003211 3300038443 Bacteria 16457
288 Ga0395901_0016579 3300038443 Bacteria 7507
289 Ga0395901_0062223 3300038443 Bacteria 3884
290 Ga0395901_0244989 3300038443 Bacteria 1868
291 Ga0436365_0065977 3300039437 Unclassified 1775
292 Ga0436365_0467999 3300039437 Bacteria 1621
293 Ga0436365_0662098 3300039437 Bacteria 1322
294 Ga0436365_1432406 3300039437 Bacteria 3589
295 Ga0436365_1484851 3300039437 Bacteria 20930
296 Ga0436365_1623543 3300039437 Bacteria 1746
297 Ga0436365_1629961 3300039437 Bacteria 12928
298 Ga0436360_0218641 3300039438 Bacteria 5474
299 Ga0436360_0628072 3300039438 Bacteria 978
300 Ga0436360_0688239 3300039438 Bacteria 3966
301 Ga0436360_0946427 3300039438 Bacteria 1226
302 Ga0436360_1122774 3300039438 Bacteria 1855
303 Ga0436361_0722764 3300039447 Bacteria 1177
304 Ga0436361_0858235 3300039447 Bacteria 4033
305 Ga0436361_0949301 3300039447 Bacteria 5204
306 Ga0436363_0033906 3300039450 Bacteria 1081
307 Ga0436363_0035801 3300039450 Bacteria 2128
308 Ga0436363_0450048 3300039450 Bacteria 3911
309 Ga0436363_1537196 3300039450 Bacteria 2320
310 Ga0436362_0334069 3300039453 Bacteria 3774
311 Ga0436362_0525299 3300039453 Bacteria 7368
312 Ga0439453_0002437 3300041408 Bacteria 2569
313 Ga0453683_0005968 3300044673 Bacteria 8396
314 Ga0451576_0373459 3300045051 Unclassified 1494
315 Ga0466967_0093489 3300045976 Bacteria 2736
316 Ga0495592_0000354 3300046454 Bacteria 37127
317 Ga0495592_0154967 3300046454 Unclassified 1581
318 Ga0495653_0000223 3300046463 Bacteria 46348
319 Ga0495580_0000548 3300046472 Bacteria 31739
320 Ga0495580_0205071 3300046472 Bacteria 1358
321 Ga0495580_0244902 3300046472 Bacteria 1228
322 Ga0495639_0107406 3300046475 Bacteria 1322
323 Ga0495664_0000058 3300046477 Bacteria 54445
324 Ga0495608_0000126 3300046511 Bacteria 54818
325 Ga0495618_0000788 3300046514 Bacteria 22129
326 Ga0495628_0000004 3300046516 Bacteria 462184
327 Ga0495630_0001976 3300046517 Bacteria 14272
328 Ga0495644_0049092 3300046523 Bacteria 1585
329 Ga0495652_0001911 3300046529 Bacteria 22152
330 Ga0495640_0000004 3300046533 Bacteria 357515
331 Ga0495640_0220545 3300046533 Unclassified 1196
332 Ga0495586_0012966 3300046535 Bacteria 4417
333 Ga0495587_0000729 3300046536 Bacteria 22005
334 Ga0495645_0000006 3300046543 Bacteria 382503
335 Ga0495667_0000010 3300046559 Bacteria 222698
336 Ga0495634_0022952 3300046642 Bacteria 4394
337 Ga0495634_0078692 3300046642 Unclassified 2160
338 Ga0495659_0027298 3300046664 Bacteria 1969
339 Ga0495657_0001234 3300046675 Bacteria 22377
340 Ga0495599_0000527 3300046678 Bacteria 22027
341 Ga0495599_0128992 3300046678 Unclassified 1571
342 Ga0495623_0000725 3300046679 Bacteria 22034
343 Ga0495646_0000089 3300046680 Bacteria 44751
344 Ga0495669_0095090 3300046684 Bacteria 1380
345 Ga0495613_0177350 3300046689 Bacteria 1510
346 Ga0495613_0180985 3300046689 Bacteria 1493
347 Ga0495600_0000167 3300046809 Bacteria 38318
348 Ga0495600_0075732 3300046809 Unclassified 2197
349 Ga0495581_0084251 3300047315 Bacteria 1842
350 Ga0495636_0144019 3300047318 Bacteria 1066
351 Ga0495674_0000021 3300047319 Bacteria 174056
352 Ga0495680_0001901 3300047322 Bacteria 21934
353 Ga0495680_0249021 3300047322 Unclassified 1260
354 Ga0495675_0000653 3300047444 Bacteria 21977
355 Ga0495684_0001071 3300047471 Bacteria 22148
356 Ga0495593_0020136 3300047673 Bacteria 3736
357 Ga0495602_0001679 3300048088 Bacteria 22033
358 Ga0496104_0469321 3300048907 Unclassified 1170
359 Ga0496106_0099978 3300048909 Unclassified 2249
360 Ga0496108_0331249 3300048911 Bacteria 1328
361 Ga0496112_0186710 3300048915 Bacteria 2036
362 Ga0496113_0017131 3300048916 Bacteria 5023
363 Ga0496113_0042769 3300048916 Bacteria 3349
364 Ga0496126_0040789 3300048929 Bacteria 4302
365 Ga0501031_0057088 3300049568 Bacteria 2544
366 Ga0501032_0228020 3300049569 Bacteria 1211
367 Ga0501033_0010640 3300049570 Bacteria 7055
368 Ga0501034_0002944 3300049571 Bacteria 19729
369 Ga0501034_0006355 3300049571 Bacteria 12722
370 Ga0501034_0075065 3300049571 Bacteria 3389
371 Ga0501034_0140793 3300049571 Bacteria 2392
372 Ga0501036_0010211 3300049572 Bacteria 7740
373 Ga0501037_0023189 3300049573 Unclassified 4590
374 Ga0501038_0006918 3300049574 Bacteria 10473
375 Ga0501039_0034591 3300049575 Bacteria 3899
376 Ga0501039_0162329 3300049575 Bacteria 1756
377 Ga0501039_0307630 3300049575 Unclassified 1246
378 Ga0501040_0000584 3300049576 Bacteria 22238
379 Ga0501040_0113232 3300049576 Bacteria 1898
380 Ga0501041_0009356 3300049577 Bacteria 5772
381 Ga0501041_0136787 3300049577 Bacteria 1527
382 Ga0501042_0011194 3300049578 Bacteria 6043
383 Ga0501043_0021501 3300049579 Bacteria 5059
384 Ga0501043_0027698 3300049579 Bacteria 4449
385 Ga0501046_0008239 3300049580 Bacteria 9101
386 Ga0501046_0060180 3300049580 Unclassified 2972
387 Ga0501046_0099477 3300049580 Bacteria 2232
388 Ga0501048_0006413 3300049582 Bacteria 8942
389 Ga0501068_0025655 3300049584 Bacteria 3468
390 Ga0501068_0099847 3300049584 Bacteria 1798
391 Ga0501069_0038039 3300049585 Bacteria 2655
392 Ga0501070_0087583 3300049586 Bacteria 2577
393 Ga0501071_0006627 3300049587 Bacteria 7525
394 Ga0501071_0097913 3300049587 Unclassified 2160
395 Ga0501072_0002073 3300049588 Bacteria 14911
396 Ga0501074_0017162 3300049590 Bacteria 5251
397 Ga0501075_0077966 3300049591 Bacteria 2508
398 Ga0501075_0229901 3300049591 Bacteria 1414
399 Ga0501076_0001597 3300049592 Bacteria 15243
400 Ga0501076_0026885 3300049592 Bacteria 4461
401 Ga0501076_0117145 3300049592 Bacteria 2156
402 Ga0501076_0124105 3300049592 Bacteria 2092
403 Ga0501076_0129893 3300049592 Unclassified 2043
404 Ga0501077_0003445 3300049593 Bacteria 9497
405 Ga0501077_0172207 3300049593 Bacteria 1375
406 Ga0501079_0005867 3300049741 Bacteria 9189
407 Ga0501079_0254588 3300049741 Unclassified 1372
408 Ga0501080_0060642 3300049742 Bacteria 3521
409 Ga0501080_0083387 3300049742 Unclassified 2969
410 Ga0501080_0314264 3300049742 Unclassified 1419
411 Ga0501081_0004391 3300049743 Bacteria 9042
412 Ga0501081_0062302 3300049743 Bacteria 2587
413 Ga0501083_0037754 3300049744 Bacteria 3287
414 Ga0501035_0004933 3300049822 Bacteria 12658
415 Ga0501035_0021018 3300049822 Bacteria 6000
416 Ga0501044_0026794 3300049823 Bacteria 6100
417 Ga0501044_0065981 3300049823 Bacteria 3691
418 Ga0501045_0000475 3300049824 Bacteria 24883
419 Ga0501045_0155004 3300049824 Bacteria 1704
420 nmdc:mga03683_7446_c1 3300050489 Unclassified 3801
421 nmdc:mga03n38_4146_c1 3300050490 Bacteria 4759
422 nmdc:mga00v17_18777_c1 3300050491 Bacteria 3934
423 nmdc:mga0k408_19892_c1 3300050493 Unclassified 3758
424 nmdc:mga0k408_23504_c1 3300050493 Bacteria 3478
425 nmdc:mga06z11_54627_c1 3300050494 Bacteria 2059
426 nmdc:mga05p37_205804_c1 3300050507 Unclassified 2381
427 nmdc:mga05p37_281532_c1 3300050507 Bacteria 1983
428 nmdc:mga05p37_805985_c1 3300050507 Unclassified 1027
429 nmdc:mga05p37_82526_c1 3300050507 Unclassified 3961
430 nmdc:mga09592_127366_c1 3300050508 Bacteria 2189
431 nmdc:mga09592_207329_c1 3300050508 Unclassified 1698
432 nmdc:mga09592_55020_c1 3300050508 Unclassified 3362
433 nmdc:mga0qj67_34615_c1 3300050509 Bacteria 3946
434 nmdc:mga06r32_20262_c1 3300050510 Bacteria 6119
435 nmdc:mga08y16_150613_c1 3300050511 Bacteria 2418
436 nmdc:mga08y16_3128_c1 3300050511 Bacteria 17138
437 nmdc:mga08y16_72169_c1 3300050511 Unclassified 3597
438 nmdc:mga0n895_107407_c1 3300050512 Bacteria 2805
439 nmdc:mga0n895_125533_c1 3300050512 Unclassified 2590
440 nmdc:mga0n895_18167_c1 3300050512 Bacteria 6502
441 nmdc:mga0rr50_110278_c1 3300050513 Bacteria 2176
442 nmdc:mga0rr50_141316_c1 3300050513 Unclassified 1937
443 nmdc:mga0rr50_187991_c1 3300050513 Bacteria 1691
444 nmdc:mga0rr50_23762_c1 3300050513 Bacteria 4234
445 nmdc:mga0rr50_428329_c1 3300050513 Bacteria 1120
446 nmdc:mga08x19_153144_c1 3300050514 Unclassified 1562
447 nmdc:mga08x19_207949_c1 3300050514 Bacteria 1343
448 nmdc:mga08x19_34048_c1 3300050514 Bacteria 3218
449 nmdc:mga08x19_59712_c1 3300050514 Archaea 2469
450 nmdc:mga08x19_81342_c1 3300050514 Bacteria 2127
451 nmdc:mga0a205_107866_c1 3300050515 Bacteria 2683
452 nmdc:mga0a205_17271_c1 3300050515 Bacteria 6760
453 nmdc:mga0a205_18426_c1 3300050515 Bacteria 6564
454 nmdc:mga0a205_262096_c1 3300050515 Bacteria 1606
455 nmdc:mga0a205_6727_c1 3300050515 Bacteria 10395
456 nmdc:mga0sz30_476_c1 3300050516 Bacteria 15116
457 Ga0495601_0000079 3300053077 Bacteria 51915
458 Ga0495601_0058396 3300053077 Bacteria 2445
459 Ga0495601_0070459 3300053077 Bacteria 2232
460 Ga0495612_0000066 3300053078 Bacteria 47930
461 Ga0495595_0000233 3300053084 Bacteria 22127
462 Ga0495595_0010690 3300053084 Bacteria 3822
463 Ga0495619_0000695 3300053085 Bacteria 21986
464 Ga0495619_0014735 3300053085 Bacteria 4939
465 Ga0495619_0028693 3300053085 Bacteria 3591
466 Ga0495619_0176345 3300053085 Unclassified 1478
467 Ga0500641_0006189 3300053096 Bacteria 4242
468 Ga0500641_0036713 3300053096 Bacteria 1961
469 Ga0500616_0079487 3300053153 Bacteria 1651
470 Ga0501084_0000869 3300054114 Bacteria 23334
471 Ga0501084_0190166 3300054114 Bacteria 1732
472 Ga0590071_028928 3300059421 Bacteria 1316
473 Ga0590075_047674 3300059424 Bacteria 1098
474 Ga0590077_001421 3300059426 Bacteria 5618
475 Ga0501082_0007914 3300060353 Bacteria 9180
476 Ga0501082_0242985 3300060353 Bacteria 1567
477 Ga0501082_0442892 3300060353 Unclassified 1135
478 Ga0530510_0000275 3300061734 Bacteria 32534
479 Ga0530510_0011710 3300061734 Bacteria 6156
480 Ga0530510_0058205 3300061734 Bacteria 2794
481 Ga0530510_0231735 3300061734 Unclassified 1374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0304546 Ga0373947_0304546_209_1048 263
2 3300060353 Ga0501082_0242985 Ga0501082_0242985_11_823 264
3 3300046533 Ga0495640_0220545 Ga0495640_0220545_363_1172 269
4 3300049592 Ga0501076_0117145 Ga0501076_0117145_143_964 271
5 3300031456 Ga0307513_10378092 Ga0307513_103780921 286
6 3300053153 Ga0500616_0079487 Ga0500616_0079487_119_1102 286
7 3300006353 Ga0075370_10090597 Ga0075370_100905972 287
8 3300009093 Ga0105240_10160452 Ga0105240_101604522 293
9 3300005563 Ga0068855_100141437 Ga0068855_1001414372 294
10 3300013104 Ga0157370_10109579 Ga0157370_101095793 294
11 3300025913 Ga0207695_10405847 Ga0207695_104058472 294
12 3300025949 Ga0207667_10063210 Ga0207667_100632104 294
13 3300046689 Ga0495613_0180985 Ga0495613_0180985_12_911 294
14 3300046684 Ga0495669_0095090 Ga0495669_0095090_456_1367 298
15 3300049591 Ga0501075_0077966 Ga0501075_0077966_1575_2486 298
16 3300053077 Ga0495601_0058396 Ga0495601_0058396_325_1278 298
17 3300059426 Ga0590077_001421 Ga0590077_001421_4657_5577 301
18 3300050494 nmdc:mga06z11_54627_c1 nmdc:mga06z11_54627_c1_327_1262 302
19 3300025903 Ga0207680_10093279 Ga0207680_100932791 303
20 3300022467 Ga0224712_10144871 Ga0224712_101448711 304
21 3300021384 Ga0213876_10003178 Ga0213876_100031789 305
22 3300021384 Ga0213876_10074559 Ga0213876_100745592 305
23 3300021388 Ga0213875_10012126 Ga0213875_100121262 305
24 3300027424 Ga0209984_1000911 Ga0209984_10009113 305
25 3300037068 Ga0373925_0136477 Ga0373925_0136477_91_1077 305
26 3300037853 Ga0436364_0031022 Ga0436364_0031022_8646_9566 305
27 3300039437 Ga0436365_0065977 Ga0436365_0065977_511_1443 305
28 3300039437 Ga0436365_0467999 Ga0436365_0467999_350_1282 305
29 3300039437 Ga0436365_1484851 Ga0436365_1484851_3637_4557 305
30 3300039450 Ga0436363_0033906 Ga0436363_0033906_69_989 305
31 3300039450 Ga0436363_0450048 Ga0436363_0450048_198_1130 305
32 3300039437 Ga0436365_1629961 Ga0436365_1629961_10363_11286 306
33 3300005535 Ga0070684_100476334 Ga0070684_1004763341 308
34 3300020069 Ga0197907_10162685 Ga0197907_101626852 308
35 3300020078 Ga0206352_11005722 Ga0206352_110057222 308
36 3300022467 Ga0224712_10020205 Ga0224712_100202052 308
37 3300005530 Ga0070679_100298628 Ga0070679_1002986282 309
38 3300006844 Ga0075428_100436399 Ga0075428_1004363992 311
39 3300035691 Ga0373931_0116948 Ga0373931_0116948_176_1132 311
40 3300036401 Ga0373937_0098159 Ga0373937_0098159_1414_2409 312
41 3300037068 Ga0373925_0027667 Ga0373925_0027667_1875_2828 312
42 3300047322 Ga0495680_0249021 Ga0495680_0249021_145_1140 312
43 3300050513 nmdc:mga0rr50_428329_c1 nmdc:mga0rr50_428329_c1_148_1089 312
44 3300004803 Ga0058862_12441534 Ga0058862_124415341 313
45 3300005288 Ga0065714_10089046 Ga0065714_100890461 313
46 3300005290 Ga0065712_10073141 Ga0065712_100731413 313
47 3300005293 Ga0065715_10106044 Ga0065715_101060441 313
48 3300005295 Ga0065707_10001580 Ga0065707_100015807 313
49 3300005327 Ga0070658_10314738 Ga0070658_103147381 313
50 3300005330 Ga0070690_100168873 Ga0070690_1001688732 313
51 3300005331 Ga0070670_100009039 Ga0070670_1000090393 313
52 3300005331 Ga0070670_100137961 Ga0070670_1001379612 313
53 3300005335 Ga0070666_10210396 Ga0070666_102103961 313
54 3300005336 Ga0070680_100064046 Ga0070680_1000640464 313
55 3300005337 Ga0070682_100139591 Ga0070682_1001395912 313
56 3300005341 Ga0070691_10078481 Ga0070691_100784811 313
57 3300005344 Ga0070661_100071544 Ga0070661_1000715441 313
58 3300005345 Ga0070692_10102329 Ga0070692_101023292 313
59 3300005367 Ga0070667_100036074 Ga0070667_1000360745 313
60 3300005440 Ga0070705_100328081 Ga0070705_1003280811 313
61 3300005445 Ga0070708_100332383 Ga0070708_1003323831 313
62 3300005457 Ga0070662_100039879 Ga0070662_1000398793 313
63 3300005458 Ga0070681_10099920 Ga0070681_100999202 313
64 3300005458 Ga0070681_10302944 Ga0070681_103029442 313
65 3300005530 Ga0070679_100011439 Ga0070679_1000114397 313
66 3300005544 Ga0070686_100141960 Ga0070686_1001419602 313
67 3300005545 Ga0070695_100212634 Ga0070695_1002126342 313
68 3300005546 Ga0070696_100069754 Ga0070696_1000697543 313
69 3300005578 Ga0068854_100073332 Ga0068854_1000733323 313
70 3300005841 Ga0068863_100332049 Ga0068863_1003320492 313
71 3300005937 Ga0081455_10000301 Ga0081455_1000030141 313
72 3300005937 Ga0081455_10040953 Ga0081455_100409534 313
73 3300005937 Ga0081455_10141249 Ga0081455_101412492 313
74 3300005981 Ga0081538_10039426 Ga0081538_100394263 313
75 3300006358 Ga0068871_100078634 Ga0068871_1000786343 313
76 3300006844 Ga0075428_100068420 Ga0075428_1000684202 313
77 3300006844 Ga0075428_100199187 Ga0075428_1001991872 313
78 3300006846 Ga0075430_100022936 Ga0075430_1000229364 313
79 3300006847 Ga0075431_100033468 Ga0075431_1000334682 313
80 3300006847 Ga0075431_100297323 Ga0075431_1002973232 313
81 3300006852 Ga0075433_10010287 Ga0075433_100102878 313
82 3300006852 Ga0075433_10040339 Ga0075433_100403394 313
83 3300006852 Ga0075433_10082447 Ga0075433_100824472 313
84 3300006852 Ga0075433_10133961 Ga0075433_101339612 313
85 3300006852 Ga0075433_10177368 Ga0075433_101773682 313
86 3300006871 Ga0075434_100002235 Ga0075434_10000223513 313
87 3300006871 Ga0075434_100008677 Ga0075434_1000086772 313
88 3300006871 Ga0075434_100107140 Ga0075434_1001071401 313
89 3300006871 Ga0075434_100278164 Ga0075434_1002781642 313
90 3300006880 Ga0075429_100395060 Ga0075429_1003950602 313
91 3300006914 Ga0075436_100023920 Ga0075436_1000239203 313
92 3300006914 Ga0075436_100131580 Ga0075436_1001315802 313
93 3300007076 Ga0075435_100005085 Ga0075435_1000050853 313
94 3300007076 Ga0075435_100020710 Ga0075435_1000207103 313
95 3300007076 Ga0075435_100394381 Ga0075435_1003943811 313
96 3300009094 Ga0111539_10026266 Ga0111539_100262665 313
97 3300009094 Ga0111539_10348619 Ga0111539_103486192 313
98 3300009094 Ga0111539_10544781 Ga0111539_105447812 313
99 3300009147 Ga0114129_10061321 Ga0114129_100613215 313
100 3300009147 Ga0114129_10138157 Ga0114129_101381572 313
101 3300009147 Ga0114129_10417160 Ga0114129_104171602 313
102 3300009147 Ga0114129_11067961 Ga0114129_110679611 313
103 3300010375 Ga0105239_10141705 Ga0105239_101417053 313
104 3300013297 Ga0157378_10014939 Ga0157378_100149394 313
105 3300013307 Ga0157372_10045260 Ga0157372_100452602 313
106 3300014325 Ga0163163_10456996 Ga0163163_104569962 313
107 3300025893 Ga0207682_10013854 Ga0207682_100138542 313
108 3300025907 Ga0207645_10001093 Ga0207645_1000109317 313
109 3300025909 Ga0207705_10243269 Ga0207705_102432691 313
110 3300025912 Ga0207707_10017654 Ga0207707_100176544 313
111 3300025912 Ga0207707_10064534 Ga0207707_100645344 313
112 3300025915 Ga0207693_10077508 Ga0207693_100775082 313
113 3300025916 Ga0207663_10106042 Ga0207663_101060421 313
114 3300025921 Ga0207652_10050761 Ga0207652_100507612 313
115 3300025921 Ga0207652_10059852 Ga0207652_100598522 313
116 3300025925 Ga0207650_10004896 Ga0207650_100048967 313
117 3300025925 Ga0207650_10125162 Ga0207650_101251622 313
118 3300025931 Ga0207644_10066293 Ga0207644_100662932 313
119 3300025932 Ga0207690_10286734 Ga0207690_102867342 313
120 3300025938 Ga0207704_10149850 Ga0207704_101498501 313
121 3300025940 Ga0207691_10006178 Ga0207691_100061782 313
122 3300025945 Ga0207679_10186221 Ga0207679_101862212 313
123 3300025986 Ga0207658_10059892 Ga0207658_100598922 313
124 3300026067 Ga0207678_10030109 Ga0207678_100301093 313
125 3300026118 Ga0207675_100167290 Ga0207675_1001672902 313
126 3300027252 Ga0209973_1007671 Ga0209973_10076711 313
127 3300027364 Ga0209967_1003125 Ga0209967_10031252 313
128 3300027552 Ga0209982_1006733 Ga0209982_10067332 313
129 3300027682 Ga0209971_1003905 Ga0209971_10039053 313
130 3300027695 Ga0209966_1002843 Ga0209966_10028432 313
131 3300027876 Ga0209974_10004211 Ga0209974_100042113 313
132 3300027907 Ga0207428_10008757 Ga0207428_100087578 313
133 3300028379 Ga0268266_10169866 Ga0268266_101698662 313
134 3300028381 Ga0268264_10289136 Ga0268264_102891362 313
135 3300031548 Ga0307408_100017855 Ga0307408_1000178553 313
136 3300031731 Ga0307405_10205662 Ga0307405_102056622 313
137 3300031995 Ga0307409_100589108 Ga0307409_1005891081 313
138 3300035692 Ga0373935_0132472 Ga0373935_0132472_610_1566 313
139 3300035725 Ga0373947_0030385 Ga0373947_0030385_1958_2914 313
140 3300036401 Ga0373937_0046738 Ga0373937_0046738_1068_2027 313
141 3300037068 Ga0373925_0183547 Ga0373925_0183547_59_1015 313
142 3300037853 Ga0436364_0138009 Ga0436364_0138009_876_1817 313
143 3300039438 Ga0436360_0628072 Ga0436360_0628072_24_965 313
144 3300039438 Ga0436360_1122774 Ga0436360_1122774_734_1675 313
145 3300039453 Ga0436362_0334069 Ga0436362_0334069_2619_3560 313
146 3300044673 Ga0453683_0005968 Ga0453683_0005968_2194_3150 313
147 3300045051 Ga0451576_0373459 Ga0451576_0373459_38_994 313
148 3300046472 Ga0495580_0000548 Ga0495580_0000548_25081_26046 313
149 3300046472 Ga0495580_0205071 Ga0495580_0205071_254_1210 313
150 3300046472 Ga0495580_0244902 Ga0495580_0244902_165_1121 313
151 3300046523 Ga0495644_0049092 Ga0495644_0049092_384_1340 313
152 3300046664 Ga0495659_0027298 Ga0495659_0027298_21_977 313
153 3300047318 Ga0495636_0144019 Ga0495636_0144019_20_976 313
154 3300048909 Ga0496106_0099978 Ga0496106_0099978_880_1836 313
155 3300048915 Ga0496112_0186710 Ga0496112_0186710_893_1849 313
156 3300048916 Ga0496113_0017131 Ga0496113_0017131_1418_2374 313
157 3300049568 Ga0501031_0057088 Ga0501031_0057088_1317_2273 313
158 3300049569 Ga0501032_0228020 Ga0501032_0228020_215_1171 313
159 3300049570 Ga0501033_0010640 Ga0501033_0010640_2732_3688 313
160 3300049572 Ga0501036_0010211 Ga0501036_0010211_1846_2802 313
161 3300049573 Ga0501037_0023189 Ga0501037_0023189_19_975 313
162 3300049574 Ga0501038_0006918 Ga0501038_0006918_4025_4981 313
163 3300049575 Ga0501039_0034591 Ga0501039_0034591_2853_3809 313
164 3300049575 Ga0501039_0162329 Ga0501039_0162329_244_1200 313
165 3300049575 Ga0501039_0307630 Ga0501039_0307630_117_1073 313
166 3300049576 Ga0501040_0000584 Ga0501040_0000584_18473_19429 313
167 3300049576 Ga0501040_0113232 Ga0501040_0113232_107_1063 313
168 3300049577 Ga0501041_0009356 Ga0501041_0009356_2102_3058 313
169 3300049578 Ga0501042_0011194 Ga0501042_0011194_2958_3914 313
170 3300049579 Ga0501043_0021501 Ga0501043_0021501_474_1430 313
171 3300049579 Ga0501043_0027698 Ga0501043_0027698_196_1152 313
172 3300049580 Ga0501046_0008239 Ga0501046_0008239_3209_4165 313
173 3300049580 Ga0501046_0060180 Ga0501046_0060180_358_1314 313
174 3300049580 Ga0501046_0099477 Ga0501046_0099477_719_1675 313
175 3300049582 Ga0501048_0006413 Ga0501048_0006413_5171_6127 313
176 3300049584 Ga0501068_0099847 Ga0501068_0099847_433_1389 313
177 3300049585 Ga0501069_0038039 Ga0501069_0038039_218_1174 313
178 3300049586 Ga0501070_0087583 Ga0501070_0087583_742_1698 313
179 3300049587 Ga0501071_0006627 Ga0501071_0006627_3119_4075 313
180 3300049587 Ga0501071_0097913 Ga0501071_0097913_155_1111 313
181 3300049588 Ga0501072_0002073 Ga0501072_0002073_3357_4313 313
182 3300049590 Ga0501074_0017162 Ga0501074_0017162_161_1117 313
183 3300049592 Ga0501076_0001597 Ga0501076_0001597_3283_4239 313
184 3300049592 Ga0501076_0026885 Ga0501076_0026885_2402_3358 313
185 3300049593 Ga0501077_0003445 Ga0501077_0003445_5065_6021 313
186 3300049593 Ga0501077_0172207 Ga0501077_0172207_71_1099 313
187 3300049741 Ga0501079_0005867 Ga0501079_0005867_5729_6685 313
188 3300049741 Ga0501079_0254588 Ga0501079_0254588_116_1072 313
189 3300049742 Ga0501080_0060642 Ga0501080_0060642_2478_3434 313
190 3300049742 Ga0501080_0083387 Ga0501080_0083387_506_1462 313
191 3300049743 Ga0501081_0004391 Ga0501081_0004391_5047_6003 313
192 3300049744 Ga0501083_0037754 Ga0501083_0037754_2125_3081 313
193 3300049822 Ga0501035_0004933 Ga0501035_0004933_11481_12437 313
194 3300049822 Ga0501035_0021018 Ga0501035_0021018_1925_2881 313
195 3300049823 Ga0501044_0065981 Ga0501044_0065981_2545_3501 313
196 3300049824 Ga0501045_0000475 Ga0501045_0000475_1353_2309 313
197 3300049824 Ga0501045_0155004 Ga0501045_0155004_192_1148 313
198 3300050507 nmdc:mga05p37_205804_c1 nmdc:mga05p37_205804_c1_1048_2004 313
199 3300050507 nmdc:mga05p37_281532_c1 nmdc:mga05p37_281532_c1_130_1086 313
200 3300050507 nmdc:mga05p37_805985_c1 nmdc:mga05p37_805985_c1_27_983 313
201 3300050507 nmdc:mga05p37_82526_c1 nmdc:mga05p37_82526_c1_27_983 313
202 3300050508 nmdc:mga09592_127366_c1 nmdc:mga09592_127366_c1_35_991 313
203 3300050508 nmdc:mga09592_207329_c1 nmdc:mga09592_207329_c1_384_1340 313
204 3300050508 nmdc:mga09592_55020_c1 nmdc:mga09592_55020_c1_197_1153 313
205 3300050509 nmdc:mga0qj67_34615_c1 nmdc:mga0qj67_34615_c1_912_1868 313
206 3300050510 nmdc:mga06r32_20262_c1 nmdc:mga06r32_20262_c1_4521_5477 313
207 3300050511 nmdc:mga08y16_150613_c1 nmdc:mga08y16_150613_c1_1033_1989 313
208 3300050511 nmdc:mga08y16_3128_c1 nmdc:mga08y16_3128_c1_8746_9702 313
209 3300050512 nmdc:mga0n895_107407_c1 nmdc:mga0n895_107407_c1_1595_2560 313
210 3300050512 nmdc:mga0n895_125533_c1 nmdc:mga0n895_125533_c1_124_1080 313
211 3300050512 nmdc:mga0n895_18167_c1 nmdc:mga0n895_18167_c1_1739_2704 313
212 3300050513 nmdc:mga0rr50_110278_c1 nmdc:mga0rr50_110278_c1_188_1144 313
213 3300050513 nmdc:mga0rr50_141316_c1 nmdc:mga0rr50_141316_c1_158_1114 313
214 3300050513 nmdc:mga0rr50_187991_c1 nmdc:mga0rr50_187991_c1_51_1007 313
215 3300050513 nmdc:mga0rr50_23762_c1 nmdc:mga0rr50_23762_c1_1920_2885 313
216 3300050514 nmdc:mga08x19_153144_c1 nmdc:mga08x19_153144_c1_10_966 313
217 3300050514 nmdc:mga08x19_207949_c1 nmdc:mga08x19_207949_c1_132_1088 313
218 3300050514 nmdc:mga08x19_34048_c1 nmdc:mga08x19_34048_c1_593_1558 313
219 3300050514 nmdc:mga08x19_59712_c1 nmdc:mga08x19_59712_c1_757_1728 313
220 3300050514 nmdc:mga08x19_81342_c1 nmdc:mga08x19_81342_c1_904_1860 313
221 3300050515 nmdc:mga0a205_107866_c1 nmdc:mga0a205_107866_c1_1276_2232 313
222 3300050515 nmdc:mga0a205_17271_c1 nmdc:mga0a205_17271_c1_1783_2748 313
223 3300050515 nmdc:mga0a205_18426_c1 nmdc:mga0a205_18426_c1_4497_5453 313
224 3300050515 nmdc:mga0a205_262096_c1 nmdc:mga0a205_262096_c1_94_1050 313
225 3300050515 nmdc:mga0a205_6727_c1 nmdc:mga0a205_6727_c1_9185_10150 313
226 3300054114 Ga0501084_0000869 Ga0501084_0000869_18791_19747 313
227 3300054114 Ga0501084_0190166 Ga0501084_0190166_708_1664 313
228 3300059421 Ga0590071_028928 Ga0590071_028928_205_1161 313
229 3300059424 Ga0590075_047674 Ga0590075_047674_21_977 313
230 3300060353 Ga0501082_0007914 Ga0501082_0007914_2852_3808 313
231 3300060353 Ga0501082_0442892 Ga0501082_0442892_95_1051 313
232 3300061734 Ga0530510_0000275 Ga0530510_0000275_20908_21864 313
233 3300061734 Ga0530510_0011710 Ga0530510_0011710_3469_4425 313
234 3300061734 Ga0530510_0231735 Ga0530510_0231735_156_1112 313
235 3300045976 Ga0466967_0093489 Ga0466967_0093489_1206_2213 315
236 3300005329 Ga0070683_100026552 Ga0070683_1000265525 316
237 3300005457 Ga0070662_100158624 Ga0070662_1001586242 316
238 3300005471 Ga0070698_100133169 Ga0070698_1001331694 316
239 3300005518 Ga0070699_100091118 Ga0070699_1000911181 316
240 3300005535 Ga0070684_100029837 Ga0070684_1000298374 316
241 3300005563 Ga0068855_100101379 Ga0068855_1001013791 316
242 3300005614 Ga0068856_100046460 Ga0068856_1000464604 316
243 3300010375 Ga0105239_10464759 Ga0105239_104647592 316
244 3300013100 Ga0157373_10069533 Ga0157373_100695332 316
245 3300013105 Ga0157369_10113083 Ga0157369_101130832 316
246 3300025904 Ga0207647_10129278 Ga0207647_101292782 316
247 3300025928 Ga0207700_10240756 Ga0207700_102407562 316
248 3300025932 Ga0207690_10210945 Ga0207690_102109452 316
249 3300025944 Ga0207661_10124301 Ga0207661_101243012 316
250 3300025949 Ga0207667_10130113 Ga0207667_101301133 316
251 3300026078 Ga0207702_10260180 Ga0207702_102601802 316
252 3300030763 Ga0265763_1000520 Ga0265763_10005202 316
253 3300035692 Ga0373935_0236958 Ga0373935_0236958_121_1116 316
254 3300037418 Ga0395900_0002661 Ga0395900_0002661_8622_9629 316
255 3300038443 Ga0395901_0003211 Ga0395901_0003211_10245_11252 316
256 3300047315 Ga0495581_0084251 Ga0495581_0084251_482_1477 316
257 3300025917 Ga0207660_10201146 Ga0207660_102011462 317
258 3300037312 Ga0395899_0013106 Ga0395899_0013106_3325_4332 317
259 3300037418 Ga0395900_0019217 Ga0395900_0019217_1262_2269 317
260 3300037466 Ga0395898_0013304 Ga0395898_0013304_3933_4940 317
261 3300038443 Ga0395901_0016579 Ga0395901_0016579_5239_6246 317
262 3300049571 Ga0501034_0140793 Ga0501034_0140793_914_1921 317
263 3300005937 Ga0081455_10011374 Ga0081455_100113748 318
264 3300041408 Ga0439453_0002437 Ga0439453_0002437_1503_2498 318
265 3300005618 Ga0068864_100281592 Ga0068864_1002815922 320
266 3300007788 Ga0099795_10054238 Ga0099795_100542382 320
267 3300025918 Ga0207662_10239326 Ga0207662_102393261 320
268 3300048907 Ga0496104_0469321 Ga0496104_0469321_94_1089 320
269 3300049742 Ga0501080_0314264 Ga0501080_0314264_240_1220 320
270 3300005468 Ga0070707_100026639 Ga0070707_1000266392 321
271 3300025922 Ga0207646_10056535 Ga0207646_100565353 321
272 3300036401 Ga0373937_0305012 Ga0373937_0305012_13_999 321
273 3300039438 Ga0436360_0218641 Ga0436360_0218641_1048_2058 321
274 3300053085 Ga0495619_0014735 Ga0495619_0014735_3647_4633 321
275 iso_pu_bacteria 2643221541 2643731267 321
276 iso_pu_bacteria 2643221606 2644045227 321
277 iso_pu_bacteria 2643221671 2644391996 321
278 3300006186 Ga0075369_10003043 Ga0075369_100030433 322
279 3300053096 Ga0500641_0036713 Ga0500641_0036713_888_1889 322
280 3300039447 Ga0436361_0858235 Ga0436361_0858235_94_1080 323
281 3300049591 Ga0501075_0229901 Ga0501075_0229901_202_1197 323
282 3300049592 Ga0501076_0124105 Ga0501076_0124105_1015_2010 323
283 3300049743 Ga0501081_0062302 Ga0501081_0062302_127_1122 323
284 3300005536 Ga0070697_100136972 Ga0070697_1001369722 324
285 3300005548 Ga0070665_100027641 Ga0070665_1000276411 324
286 3300005548 Ga0070665_100061224 Ga0070665_1000612243 324
287 3300005577 Ga0068857_100368332 Ga0068857_1003683321 324
288 3300005937 Ga0081455_10055852 Ga0081455_100558524 324
289 3300005981 Ga0081538_10002729 Ga0081538_1000272916 324
290 3300005981 Ga0081538_10026634 Ga0081538_100266342 324
291 3300005981 Ga0081538_10042635 Ga0081538_100426352 324
292 3300005981 Ga0081538_10073773 Ga0081538_100737731 324
293 3300006844 Ga0075428_100226099 Ga0075428_1002260991 324
294 3300009094 Ga0111539_10113523 Ga0111539_101135233 324
295 3300025903 Ga0207680_10143742 Ga0207680_101437422 324
296 3300028379 Ga0268266_10012578 Ga0268266_100125781 324
297 3300028379 Ga0268266_10091181 Ga0268266_100911812 324
298 3300031238 Ga0265332_10009572 Ga0265332_100095722 324
299 3300031242 Ga0265329_10018922 Ga0265329_100189222 324
300 3300031247 Ga0265340_10006360 Ga0265340_100063605 324
301 3300031249 Ga0265339_10040493 Ga0265339_100404933 324
302 3300031250 Ga0265331_10008600 Ga0265331_100086004 324
303 3300031712 Ga0265342_10000026 Ga0265342_1000002651 324
304 3300048929 Ga0496126_0040789 Ga0496126_0040789_536_1540 324
305 3300049571 Ga0501034_0002944 Ga0501034_0002944_10720_11727 324
306 3300005458 Ga0070681_10408215 Ga0070681_104082151 325
307 3300006048 Ga0075363_100008831 Ga0075363_1000088313 325
308 3300006051 Ga0075364_10023557 Ga0075364_100235574 325
309 3300006177 Ga0075362_10008379 Ga0075362_100083792 325
310 3300006195 Ga0075366_10019835 Ga0075366_100198353 325
311 3300028800 Ga0265338_10114124 Ga0265338_101141242 325
312 3300031241 Ga0265325_10006612 Ga0265325_100066126 325
313 3300031249 Ga0265339_10000034 Ga0265339_1000003492 325
314 3300031595 Ga0265313_10000185 Ga0265313_1000018511 325
315 3300050489 nmdc:mga03683_7446_c1 nmdc:mga03683_7446_c1_1462_2448 325
316 3300050490 nmdc:mga03n38_4146_c1 nmdc:mga03n38_4146_c1_2953_3939 325
317 3300050491 nmdc:mga00v17_18777_c1 nmdc:mga00v17_18777_c1_2722_3708 325
318 3300050493 nmdc:mga0k408_19892_c1 nmdc:mga0k408_19892_c1_2353_3339 325
319 3300005339 Ga0070660_100055345 Ga0070660_1000553453 326
320 3300005445 Ga0070708_100094804 Ga0070708_1000948041 326
321 3300005467 Ga0070706_100212030 Ga0070706_1002120302 326
322 3300005614 Ga0068856_100020190 Ga0068856_1000201907 326
323 3300006028 Ga0070717_10152106 Ga0070717_101521062 326
324 3300006914 Ga0075436_100048315 Ga0075436_1000483152 326
325 3300007076 Ga0075435_100426382 Ga0075435_1004263821 326
326 3300007788 Ga0099795_10012645 Ga0099795_100126453 326
327 3300010159 Ga0099796_10001075 Ga0099796_100010753 326
328 3300010159 Ga0099796_10007704 Ga0099796_100077043 326
329 3300014497 Ga0182008_10009647 Ga0182008_100096474 326
330 3300021358 Ga0213873_10014078 Ga0213873_100140782 326
331 3300025919 Ga0207657_10060308 Ga0207657_100603083 326
332 3300025928 Ga0207700_10104122 Ga0207700_101041222 326
333 3300025929 Ga0207664_10305608 Ga0207664_103056082 326
334 3300025939 Ga0207665_10035113 Ga0207665_100351132 326
335 3300026078 Ga0207702_10085194 Ga0207702_100851942 326
336 3300026078 Ga0207702_10297583 Ga0207702_102975832 326
337 3300027512 Ga0209179_1009636 Ga0209179_10096362 326
338 3300031241 Ga0265325_10092220 Ga0265325_100922201 326
339 3300035083 Ga0373926_0063201 Ga0373926_0063201_44_1027 326
340 3300035083 Ga0373926_0079210 Ga0373926_0079210_127_1122 326
341 3300035113 Ga0373936_0000456 Ga0373936_0000456_11955_12950 326
342 3300035117 Ga0373953_0012708 Ga0373953_0012708_1878_2873 326
343 3300035118 Ga0373954_0001257 Ga0373954_0001257_7658_8653 326
344 3300035121 Ga0373960_0024031 Ga0373960_0024031_328_1311 326
345 3300035170 Ga0373943_0077612 Ga0373943_0077612_45_1040 326
346 3300035171 Ga0373946_0064434 Ga0373946_0064434_158_1153 326
347 3300035410 Ga0373924_0031896 Ga0373924_0031896_115_1110 326
348 3300035692 Ga0373935_0000136 Ga0373935_0000136_30091_31086 326
349 3300035692 Ga0373935_0008926 Ga0373935_0008926_1405_2400 326
350 3300035725 Ga0373947_0012938 Ga0373947_0012938_1280_2275 326
351 3300037068 Ga0373925_0000931 Ga0373925_0000931_21102_22097 326
352 3300037068 Ga0373925_0013508 Ga0373925_0013508_1166_2218 326
353 3300037853 Ga0436364_1470617 Ga0436364_1470617_187_1182 326
354 3300039437 Ga0436365_1432406 Ga0436365_1432406_1637_2632 326
355 3300039453 Ga0436362_0525299 Ga0436362_0525299_1623_2606 326
356 3300046454 Ga0495592_0000354 Ga0495592_0000354_120_1115 326
357 3300046463 Ga0495653_0000223 Ga0495653_0000223_33675_34670 326
358 3300046475 Ga0495639_0107406 Ga0495639_0107406_228_1223 326
359 3300046477 Ga0495664_0000058 Ga0495664_0000058_32515_33510 326
360 3300046511 Ga0495608_0000126 Ga0495608_0000126_32836_33831 326
361 3300046514 Ga0495618_0000788 Ga0495618_0000788_124_1119 326
362 3300046516 Ga0495628_0000004 Ga0495628_0000004_449458_450453 326
363 3300046517 Ga0495630_0001976 Ga0495630_0001976_12256_13251 326
364 3300046529 Ga0495652_0001911 Ga0495652_0001911_20988_21983 326
365 3300046533 Ga0495640_0000004 Ga0495640_0000004_23_1018 326
366 3300046535 Ga0495586_0012966 Ga0495586_0012966_1437_2420 326
367 3300046536 Ga0495587_0000729 Ga0495587_0000729_20993_21988 326
368 3300046543 Ga0495645_0000006 Ga0495645_0000006_11154_12149 326
369 3300046559 Ga0495667_0000010 Ga0495667_0000010_32790_33785 326
370 3300046642 Ga0495634_0022952 Ga0495634_0022952_71_1066 326
371 3300046642 Ga0495634_0078692 Ga0495634_0078692_703_1686 326
372 3300046675 Ga0495657_0001234 Ga0495657_0001234_461_1456 326
373 3300046678 Ga0495599_0000527 Ga0495599_0000527_52_1047 326
374 3300046678 Ga0495599_0128992 Ga0495599_0128992_97_1080 326
375 3300046679 Ga0495623_0000725 Ga0495623_0000725_20946_21941 326
376 3300046680 Ga0495646_0000089 Ga0495646_0000089_10959_11954 326
377 3300046689 Ga0495613_0177350 Ga0495613_0177350_471_1466 326
378 3300046809 Ga0495600_0000167 Ga0495600_0000167_26281_27276 326
379 3300046809 Ga0495600_0075732 Ga0495600_0075732_58_1041 326
380 3300047319 Ga0495674_0000021 Ga0495674_0000021_147319_148314 326
381 3300047322 Ga0495680_0001901 Ga0495680_0001901_25_1020 326
382 3300047444 Ga0495675_0000653 Ga0495675_0000653_41_1036 326
383 3300047471 Ga0495684_0001071 Ga0495684_0001071_21000_21995 326
384 3300047673 Ga0495593_0020136 Ga0495593_0020136_2691_3686 326
385 3300048088 Ga0495602_0001679 Ga0495602_0001679_20988_21983 326
386 3300048911 Ga0496108_0331249 Ga0496108_0331249_292_1275 326
387 3300048916 Ga0496113_0042769 Ga0496113_0042769_2002_2985 326
388 3300049577 Ga0501041_0136787 Ga0501041_0136787_205_1194 326
389 3300053077 Ga0495601_0000079 Ga0495601_0000079_21027_22022 326
390 3300053078 Ga0495612_0000066 Ga0495612_0000066_20974_21969 326
391 3300053084 Ga0495595_0000233 Ga0495595_0000233_21010_22005 326
392 3300053085 Ga0495619_0000695 Ga0495619_0000695_20917_21912 326
393 3300053085 Ga0495619_0176345 Ga0495619_0176345_96_1079 326
394 3300061734 Ga0530510_0058205 Ga0530510_0058205_498_1487 326
395 3300005435 Ga0070714_100014781 Ga0070714_1000147814 327
396 3300005435 Ga0070714_100107043 Ga0070714_1001070432 327
397 3300005435 Ga0070714_100443293 Ga0070714_1004432932 327
398 3300005436 Ga0070713_100034988 Ga0070713_1000349884 327
399 3300005439 Ga0070711_100003534 Ga0070711_1000035344 327
400 3300005445 Ga0070708_100175682 Ga0070708_1001756822 327
401 3300005467 Ga0070706_100247634 Ga0070706_1002476342 327
402 3300005468 Ga0070707_100004593 Ga0070707_1000045939 327
403 3300005468 Ga0070707_100511898 Ga0070707_1005118981 327
404 3300005471 Ga0070698_100003592 Ga0070698_10000359212 327
405 3300006028 Ga0070717_10004284 Ga0070717_100042845 327
406 3300006028 Ga0070717_10141821 Ga0070717_101418212 327
407 3300006175 Ga0070712_100060503 Ga0070712_1000605032 327
408 3300006175 Ga0070712_100216066 Ga0070712_1002160662 327
409 3300007788 Ga0099795_10004859 Ga0099795_100048593 327
410 3300015683 Ga0183362_10010 Ga0183362_1001067 327
411 3300021388 Ga0213875_10000823 Ga0213875_100008239 327
412 3300021388 Ga0213875_10015912 Ga0213875_100159122 327
413 3300025898 Ga0207692_10163602 Ga0207692_101636021 327
414 3300025910 Ga0207684_10371352 Ga0207684_103713521 327
415 3300025915 Ga0207693_10000731 Ga0207693_1000073121 327
416 3300025915 Ga0207693_10034474 Ga0207693_100344742 327
417 3300025915 Ga0207693_10111259 Ga0207693_101112592 327
418 3300025915 Ga0207693_10181945 Ga0207693_101819452 327
419 3300025922 Ga0207646_10009580 Ga0207646_100095803 327
420 3300025922 Ga0207646_10238338 Ga0207646_102383382 327
421 3300025928 Ga0207700_10024629 Ga0207700_100246293 327
422 3300025929 Ga0207664_10109049 Ga0207664_101090492 327
423 3300025929 Ga0207664_10111879 Ga0207664_101118792 327
424 3300025945 Ga0207679_10104357 Ga0207679_101043572 327
425 3300037312 Ga0395899_0001894 Ga0395899_0001894_6522_7505 327
426 3300037312 Ga0395899_0009759 Ga0395899_0009759_1920_2903 327
427 3300037418 Ga0395900_0003260 Ga0395900_0003260_8546_9529 327
428 3300037418 Ga0395900_0069776 Ga0395900_0069776_2257_3240 327
429 3300037466 Ga0395898_0004813 Ga0395898_0004813_5383_6366 327
430 3300037466 Ga0395898_0022782 Ga0395898_0022782_4746_5729 327
431 3300037471 Ga0395905_0001043 Ga0395905_0001043_8055_9038 327
432 3300037471 Ga0395905_0205891 Ga0395905_0205891_600_1583 327
433 3300037853 Ga0436364_0103806 Ga0436364_0103806_52472_53455 327
434 3300037853 Ga0436364_0466445 Ga0436364_0466445_6462_7448 327
435 3300038443 Ga0395901_0062223 Ga0395901_0062223_147_1130 327
436 3300038443 Ga0395901_0244989 Ga0395901_0244989_411_1394 327
437 3300039437 Ga0436365_1623543 Ga0436365_1623543_564_1547 327
438 3300039450 Ga0436363_0035801 Ga0436363_0035801_167_1150 327
439 3300039450 Ga0436363_1537196 Ga0436363_1537196_493_1476 327
440 3300005355 Ga0070671_100003473 Ga0070671_1000034738 328
441 3300005564 Ga0070664_100406729 Ga0070664_1004067291 328
442 3300005985 Ga0081539_10001802 Ga0081539_1000180223 328
443 3300006038 Ga0075365_10190005 Ga0075365_101900051 328
444 3300006177 Ga0075362_10026101 Ga0075362_100261012 328
445 3300006195 Ga0075366_10094267 Ga0075366_100942671 328
446 3300006353 Ga0075370_10074219 Ga0075370_100742192 328
447 3300009988 Ga0105035_104981 Ga0105035_1049811 328
448 3300035118 Ga0373954_0007726 Ga0373954_0007726_341_1327 328
449 3300035119 Ga0373956_0055609 Ga0373956_0055609_366_1352 328
450 3300035172 Ga0373955_0044240 Ga0373955_0044240_971_1957 328
451 3300035724 Ga0373933_0005809 Ga0373933_0005809_2490_3476 328
452 3300036401 Ga0373937_0000643 Ga0373937_0000643_15849_16835 328
453 3300039437 Ga0436365_0662098 Ga0436365_0662098_156_1142 328
454 3300039447 Ga0436361_0722764 Ga0436361_0722764_44_1030 328
455 3300046454 Ga0495592_0154967 Ga0495592_0154967_277_1263 328
456 3300049571 Ga0501034_0075065 Ga0501034_0075065_2064_3074 328
457 3300049592 Ga0501076_0129893 Ga0501076_0129893_406_1422 328
458 3300050511 nmdc:mga08y16_72169_c1 nmdc:mga08y16_72169_c1_298_1311 328
459 3300050516 nmdc:mga0sz30_476_c1 nmdc:mga0sz30_476_c1_8696_9709 328
460 3300053077 Ga0495601_0070459 Ga0495601_0070459_748_1734 328
461 3300053084 Ga0495595_0010690 Ga0495595_0010690_2104_3090 328
462 3300053085 Ga0495619_0028693 Ga0495619_0028693_1406_2392 328
463 3300053096 Ga0500641_0006189 Ga0500641_0006189_1098_2108 328
464 3300003911 JGI25405J52794_10018193 JGI25405J52794_100181932 329
465 3300005456 Ga0070678_100040980 Ga0070678_1000409803 329
466 3300005543 Ga0070672_100283242 Ga0070672_1002832422 329
467 3300005617 Ga0068859_100103092 Ga0068859_1001030922 329
468 3300005617 Ga0068859_100421954 Ga0068859_1004219542 329
469 3300005937 Ga0081455_10000043 Ga0081455_1000004352 329
470 3300006195 Ga0075366_10022090 Ga0075366_100220903 329
471 3300006931 Ga0097620_100103091 Ga0097620_1001030912 329
472 3300006931 Ga0097620_100421993 Ga0097620_1004219932 329
473 3300013297 Ga0157378_10406164 Ga0157378_104061641 329
474 3300021361 Ga0213872_10016220 Ga0213872_100162202 329
475 3300021441 Ga0213871_10002718 Ga0213871_100027183 329
476 3300025940 Ga0207691_10170029 Ga0207691_101700292 329
477 3300028379 Ga0268266_10147824 Ga0268266_101478242 329
478 3300039438 Ga0436360_0688239 Ga0436360_0688239_126_1130 329
479 3300039438 Ga0436360_0946427 Ga0436360_0946427_168_1172 329
480 3300039447 Ga0436361_0949301 Ga0436361_0949301_1177_2181 329
481 3300049571 Ga0501034_0006355 Ga0501034_0006355_7249_8256 329
482 3300049584 Ga0501068_0025655 Ga0501068_0025655_1072_2079 329
483 3300049823 Ga0501044_0026794 Ga0501044_0026794_1028_2035 329
484 3300050493 nmdc:mga0k408_23504_c1 nmdc:mga0k408_23504_c1_1697_2701 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

72

344

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.8179 2 329
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.8015 4 327
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.7985 7 329
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.7872 2 329
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.772 2 326
ID Description Score Start End Superfamily
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8015 5 327 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7723 2 326 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7216 2 326 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7209 5 327 3.40.830.10
3vshA00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.69 4 328 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A6P2EMG7-F1-model_v4 Protocatechuate 4,5-dioxygenase beta chain (EC 1.13.11.8) 0.9861 1 329 GO:0008198
GO:0018579
GO:0019489
AF-A0A6P2EMG7-F1-model_v4 Protocatechuate 4,5-dioxygenase beta chain (EC 1.13.11.8) 0.9831 1 329 GO:0008198
GO:0018579
GO:0019489
AF-A0A535RZV7-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9806 216 329
AF-A0A2V6RMY4-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9801 152 329 GO:0008198
GO:0016491
AF-A0A523E0B6-F1-model_v4 Extradiol ring-cleavage dioxygenase 0.9795 1 329 GO:0008198
GO:0051213

Feature Viewer

pLDDT pTM Quality
93.16 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map