F452932

General Info

Members Datasets Scaffolds Average Seq Length
484 298 459 156

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10231544|Ga0105246_102315442
Length 187
Sequence LPVRGEETGVAFDIEAIAHVRGGRTEAVDDDWDHETAVIELDPRFGPDALAGLEDFSHAEIAFVFDRVPSDKVETGARHPRNRADWPLIGIFAQRGKNRPNRIGITICRIEKVEGTRLHVRGLDAIDGTPVIDIKPVLREFLPRGDVRQPDWASELMAGYWRAWPAPRLARPAPAQGGRPCWDRASR

Samples

Sample ID Description Type Environment
1 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
2 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
3 2643221729 Bacillus sp. Root11 Isolate Unclassified
4 2643221730 Bacillus sp. Root131 Isolate Unclassified
5 2684622632 Bacillus cereus 905 Isolate Unclassified
6 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
7 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
8 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
9 2738541358 Bacillus sp. OV752 Isolate Unclassified
10 2738543006 Bacillus sp. OK077 Isolate Unclassified
11 2738543017 Bacillus sp. OV186 Isolate Unclassified
12 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
13 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
14 2857586860 Bacillus sp. R-71935 Isolate Unclassified
15 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
16 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
17 2938917290 Bacillus sp. CR71 Isolate Unclassified
18 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
19 2965761152 Bacillus sp. COPE52 Isolate Unclassified
20 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
116 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
291 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
292 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
293 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
294 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
295 8022792930 Bacillus sp. Xin Isolate Rhizosphere
296 8023438354 Bacillus sp. BH2 Isolate Unclassified
297 8023444577 Bacillus sp. BH32 Isolate Unclassified
298 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 0
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 0.83
Rhizoplane 3.31
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000273 3300001915 Bacteria 15469
2 JGI24747J21853_1019216 3300001978 Bacteria 736
3 JGI24740J21852_10011128 3300001979 Bacteria 3435
4 JGI24737J22298_10000698 3300001990 Bacteria 11804
5 JGI24737J22298_10004668 3300001990 Bacteria 4764
6 JGI24744J21845_10052342 3300002077 Bacteria 751
7 JGI25159J45721_1001328 3300002987 Bacteria 10397
8 JGI25159J45721_1005749 3300002987 Bacteria 3837
9 JGI25159J45721_1019126 3300002987 Bacteria 1357
10 JGI25159J45721_1051519 3300002987 Bacteria 562
11 JGI25151J46595_10000173 3300003187 Bacteria 83223
12 JGI25151J46595_10002843 3300003187 Bacteria 9968
13 JGI25151J46595_10005549 3300003187 Bacteria 6497
14 JGI25151J46595_10006202 3300003187 Bacteria 6050
15 JGI25151J46595_10011124 3300003187 Bacteria 4148
16 JGI25151J46595_10044033 3300003187 Bacteria 1590
17 JGI25151J46595_10055319 3300003187 Bacteria 1309
18 JGI25151J46595_10110299 3300003187 Bacteria 721
19 JGI25151J46595_10158369 3300003187 Bacteria 535
20 JGI25153J46596_10000021 3300003215 Bacteria 252651
21 JGI25153J46596_10006222 3300003215 Bacteria 6108
22 rootH2_10061189 3300003320 Bacteria 2050
23 rootH1_10279068 3300003323 Bacteria 1032
24 Ga0055538_1000729 3300003751 Bacteria 9650
25 Ga0055532_1000490 3300003758 Bacteria 17635
26 Ga0055525_1000012 3300003759 Bacteria 486564
27 Ga0055542_1000094 3300003762 Bacteria 119899
28 Ga0055529_1000045 3300003763 Bacteria 209617
29 Ga0055536_1003107 3300003781 Bacteria 9031
30 Ga0055536_1007731 3300003781 Bacteria 4756
31 Ga0055536_1047830 3300003781 Bacteria 961
32 Ga0065715_10238104 3300005293 Bacteria 1209
33 Ga0065707_10010580 3300005295 Bacteria 2568
34 Ga0070658_10018031 3300005327 Bacteria 5645
35 Ga0070676_10337077 3300005328 Bacteria 1033
36 Ga0070670_100257536 3300005331 Bacteria 1521
37 Ga0070682_100254033 3300005337 Unclassified 1269
38 Ga0070660_100139110 3300005339 Bacteria 1947
39 Ga0070660_100863027 3300005339 Bacteria 762
40 Ga0070660_100890961 3300005339 Bacteria 750
41 Ga0070660_100994977 3300005339 Bacteria 708
42 Ga0070689_100066521 3300005340 Bacteria 2808
43 Ga0070661_100014248 3300005344 Bacteria 5601
44 Ga0070669_100867579 3300005353 Bacteria 770
45 Ga0070675_100111498 3300005354 Bacteria 2315
46 Ga0070675_100655644 3300005354 Bacteria 954
47 Ga0070674_100003272 3300005356 Bacteria 9056
48 Ga0070674_100014453 3300005356 Bacteria 4907
49 Ga0070674_100143583 3300005356 Bacteria 1794
50 Ga0070673_100009151 3300005364 Bacteria 6636
51 Ga0070659_100161682 3300005366 Bacteria 1831
52 Ga0070659_100459889 3300005366 Bacteria 1081
53 Ga0070659_100589472 3300005366 Bacteria 954
54 Ga0070667_100281088 3300005367 Bacteria 1494
55 Ga0070667_100991504 3300005367 Bacteria 784
56 Ga0070701_10079503 3300005438 Bacteria 1771
57 Ga0070700_100709600 3300005441 Bacteria 801
58 Ga0070694_100328030 3300005444 Bacteria 1180
59 Ga0070663_100396545 3300005455 Bacteria 1127
60 Ga0070663_100509571 3300005455 Bacteria 1000
61 Ga0070678_100000149 3300005456 Bacteria 29059
62 Ga0070678_100771642 3300005456 Bacteria 871
63 Ga0070678_100833829 3300005456 Bacteria 839
64 Ga0068867_100038847 3300005459 Bacteria 3467
65 Ga0068867_100267614 3300005459 Bacteria 1396
66 Ga0070698_100005242 3300005471 Bacteria 14179
67 Ga0070679_101405511 3300005530 Bacteria 644
68 Ga0070672_100166727 3300005543 Bacteria 1830
69 Ga0070672_100951174 3300005543 Bacteria 760
70 Ga0070686_100285611 3300005544 Bacteria 1218
71 Ga0070695_100099436 3300005545 Bacteria 1956
72 Ga0070693_100003881 3300005547 Bacteria 7011
73 Ga0070665_100000021 3300005548 Bacteria 389668
74 Ga0070665_100594023 3300005548 Bacteria 1120
75 Ga0068855_100298709 3300005563 Bacteria 1784
76 Ga0070664_100501138 3300005564 Bacteria 1119
77 Ga0068854_100006661 3300005578 Bacteria 7361
78 Ga0068854_100126720 3300005578 Bacteria 1945
79 Ga0068856_100121898 3300005614 Bacteria 2609
80 Ga0070702_100277755 3300005615 Bacteria 1149
81 Ga0068852_100002971 3300005616 Bacteria 11774
82 Ga0068852_100050318 3300005616 Bacteria 3570
83 Ga0068859_100016161 3300005617 Bacteria 7495
84 Ga0068859_100786486 3300005617 Bacteria 1040
85 Ga0068861_100000004 3300005719 Bacteria 105907
86 Ga0068861_100060663 3300005719 Bacteria 2899
87 Ga0068861_100459384 3300005719 Bacteria 1143
88 Ga0068851_10018246 3300005834 Bacteria 3379
89 Ga0068863_100012044 3300005841 Bacteria 8356
90 Ga0068863_100047629 3300005841 Bacteria 4066
91 Ga0068858_100091429 3300005842 Bacteria 2832
92 Ga0068858_100424053 3300005842 Bacteria 1279
93 Ga0068860_100056613 3300005843 Bacteria 3727
94 Ga0068860_100143279 3300005843 Bacteria 2298
95 Ga0068860_100311880 3300005843 Bacteria 1543
96 Ga0068862_100082451 3300005844 Bacteria 2791
97 Ga0068862_100273204 3300005844 Bacteria 1546
98 Ga0081455_10000431 3300005937 Bacteria 55069
99 Ga0070715_10570172 3300006163 Unclassified 659
100 Ga0075367_10398856 3300006178 Bacteria 870
101 Ga0075369_10103026 3300006186 Bacteria 1282
102 Ga0075366_10084487 3300006195 Bacteria 1898
103 Ga0097621_100803610 3300006237 Bacteria 872
104 Ga0097621_100934230 3300006237 Bacteria 809
105 Ga0068871_100009681 3300006358 Bacteria 6997
106 Ga0075430_101136538 3300006846 Unclassified 643
107 Ga0075431_100570431 3300006847 Bacteria 1118
108 Ga0075429_100195855 3300006880 Bacteria 1770
109 Ga0075436_100234220 3300006914 Bacteria 1305
110 Ga0097620_100016161 3300006931 Bacteria 7495
111 Ga0097620_100786551 3300006931 Bacteria 1040
112 Ga0075435_100003365 3300007076 Bacteria 10842
113 Ga0075435_100912115 3300007076 Bacteria 766
114 Ga0105251_10032877 3300009011 Bacteria 2580
115 Ga0105251_10191871 3300009011 Bacteria 920
116 Ga0105244_10019025 3300009036 Bacteria 3843
117 Ga0105244_10184530 3300009036 Bacteria 988
118 Ga0105250_10003183 3300009092 Bacteria 7855
119 Ga0105250_10018029 3300009092 Bacteria 2864
120 Ga0105250_10025112 3300009092 Bacteria 2402
121 Ga0105240_10418178 3300009093 Bacteria 1507
122 Ga0105245_10090931 3300009098 Bacteria 2808
123 Ga0105245_10416903 3300009098 Bacteria 1345
124 Ga0105245_11310822 3300009098 Bacteria 773
125 Ga0105247_10210204 3300009101 Bacteria 1312
126 Ga0105243_10000512 3300009148 Bacteria 39573
127 Ga0105243_10129370 3300009148 Bacteria 2140
128 Ga0105243_11778483 3300009148 Unclassified 647
129 Ga0105241_10180210 3300009174 Bacteria 1752
130 Ga0105241_10393422 3300009174 Bacteria 1214
131 Ga0105241_11030255 3300009174 Bacteria 771
132 Ga0105242_10078198 3300009176 Bacteria 2761
133 Ga0105248_10002150 3300009177 Bacteria 21793
134 Ga0105248_10010555 3300009177 Bacteria 10177
135 Ga0105248_10013044 3300009177 Bacteria 9160
136 Ga0105248_10815943 3300009177 Bacteria 1053
137 Ga0105237_10087434 3300009545 Bacteria 3106
138 Ga0105237_10182631 3300009545 Bacteria 2097
139 Ga0105237_10259990 3300009545 Bacteria 1739
140 Ga0105238_11268544 3300009551 Bacteria 762
141 Ga0105249_10199328 3300009553 Bacteria 1958
142 Ga0105249_10373239 3300009553 Bacteria 1451
143 Ga0105249_11588358 3300009553 Unclassified 727
144 Ga0105239_10119575 3300010375 Bacteria 2924
145 Ga0105246_10231544 3300011119 Bacteria 1455
146 Ga0105246_10618466 3300011119 Bacteria 938
147 Ga0157371_10000032 3300013102 Bacteria 230252
148 Ga0157369_10359299 3300013105 Bacteria 1512
149 Ga0157378_11414409 3300013297 Bacteria 739
150 Ga0163162_10491175 3300013306 Bacteria 1359
151 Ga0163162_10729818 3300013306 Bacteria 1111
152 Ga0163162_12982025 3300013306 Bacteria 544
153 Ga0157372_10410444 3300013307 Bacteria 1578
154 Ga0157379_10385925 3300014968 Bacteria 1286
155 Ga0163161_10207610 3300017792 Bacteria 1512
156 Ga0214544_1011478 3300021320 Bacteria 12205
157 Ga0214542_1001823 3300021321 Bacteria 44037
158 Ga0214545_1001477 3300021324 Bacteria 44037
159 Ga0214543_1004144 3300021327 Bacteria 27673
160 Ga0213876_10156284 3300021384 Unclassified 1213
161 Ga0209784_100054 3300025224 Bacteria 178541
162 Ga0209147_100057 3300025229 Bacteria 253870
163 Ga0209147_100185 3300025229 Bacteria 74400
164 Ga0209563_100030 3300025230 Bacteria 489259
165 Ga0209646_1004008 3300025246 Bacteria 2767
166 Ga0209148_1000011 3300025254 Bacteria 1196503
167 Ga0209455_1000006 3300025272 Bacteria 1196503
168 Ga0209455_1009479 3300025272 Bacteria 2554
169 Ga0209130_1000633 3300025284 Bacteria 33023
170 Ga0209130_1002051 3300025284 Bacteria 10934
171 Ga0209130_1007551 3300025284 Bacteria 3336
172 Ga0209130_1016609 3300025284 Bacteria 1776
173 Ga0209130_1022916 3300025284 Bacteria 1386
174 Ga0209676_1000494 3300025292 Bacteria 63484
175 Ga0209676_1000649 3300025292 Bacteria 49872
176 Ga0209676_1006704 3300025292 Bacteria 5606
177 Ga0209676_1020397 3300025292 Bacteria 2252
178 Ga0209676_1023446 3300025292 Bacteria 2020
179 Ga0209676_1048516 3300025292 Bacteria 1133
180 Ga0209025_1000107 3300025294 Bacteria 222387
181 Ga0209025_1000266 3300025294 Bacteria 122782
182 Ga0209025_1000355 3300025294 Bacteria 98571
183 Ga0209025_1001564 3300025294 Bacteria 29032
184 Ga0209025_1002190 3300025294 Bacteria 21650
185 Ga0209025_1002944 3300025294 Bacteria 16932
186 Ga0209025_1003509 3300025294 Bacteria 14740
187 Ga0209025_1004192 3300025294 Bacteria 12718
188 Ga0209025_1004850 3300025294 Bacteria 11349
189 Ga0209025_1005049 3300025294 Bacteria 11003
190 Ga0209025_1006327 3300025294 Bacteria 9235
191 Ga0209025_1080211 3300025294 Bacteria 1112
192 Ga0209025_1103042 3300025294 Bacteria 897
193 Ga0209758_1000023 3300025297 Bacteria 612453
194 Ga0209758_1000032 3300025297 Bacteria 481623
195 Ga0207656_10000615 3300025321 Bacteria 11705
196 Ga0207696_1005843 3300025711 Bacteria 5051
197 Ga0207696_1015056 3300025711 Bacteria 2631
198 Ga0207696_1049915 3300025711 Bacteria 1199
199 Ga0207655_1022342 3300025728 Bacteria 3175
200 Ga0207713_1032264 3300025735 Bacteria 2303
201 Ga0207713_1101937 3300025735 Bacteria 989
202 Ga0207710_10248201 3300025900 Bacteria 889
203 Ga0207680_10048178 3300025903 Bacteria 2529
204 Ga0207647_10011819 3300025904 Bacteria 6102
205 Ga0207647_10036845 3300025904 Bacteria 3105
206 Ga0207685_10210861 3300025905 Bacteria 918
207 Ga0207645_10035604 3300025907 Bacteria 3197
208 Ga0207645_10079482 3300025907 Bacteria 2102
209 Ga0207645_10750247 3300025907 Bacteria 664
210 Ga0207705_10001219 3300025909 Bacteria 20805
211 Ga0207654_10001636 3300025911 Bacteria 11707
212 Ga0207654_10171403 3300025911 Bacteria 1409
213 Ga0207695_10013219 3300025913 Bacteria 9851
214 Ga0207671_10005662 3300025914 Bacteria 11430
215 Ga0207671_10059958 3300025914 Bacteria 2822
216 Ga0207671_10172476 3300025914 Bacteria 1680
217 Ga0207663_10009441 3300025916 Bacteria 5151
218 Ga0207657_10010001 3300025919 Bacteria 9491
219 Ga0207649_10003922 3300025920 Bacteria 8116
220 Ga0207649_10895840 3300025920 Bacteria 695
221 Ga0207646_10162600 3300025922 Bacteria 2015
222 Ga0207681_10012522 3300025923 Bacteria 5234
223 Ga0207694_10008848 3300025924 Bacteria 7594
224 Ga0207694_11128722 3300025924 Bacteria 663
225 Ga0207650_10339483 3300025925 Bacteria 1233
226 Ga0207659_10080988 3300025926 Bacteria 2400
227 Ga0207659_10683967 3300025926 Bacteria 878
228 Ga0207687_10032248 3300025927 Bacteria 3547
229 Ga0207687_10199672 3300025927 Bacteria 1562
230 Ga0207687_10223033 3300025927 Bacteria 1485
231 Ga0207644_10101469 3300025931 Bacteria 2162
232 Ga0207690_10016577 3300025932 Bacteria 4486
233 Ga0207690_10122516 3300025932 Bacteria 1891
234 Ga0207706_10117408 3300025933 Bacteria 2340
235 Ga0207706_10186655 3300025933 Bacteria 1821
236 Ga0207706_10260539 3300025933 Bacteria 1514
237 Ga0207709_10000145 3300025935 Bacteria 98629
238 Ga0207669_10000118 3300025937 Bacteria 39673
239 Ga0207669_10000784 3300025937 Bacteria 13595
240 Ga0207669_10065466 3300025937 Bacteria 2255
241 Ga0207691_10003479 3300025940 Bacteria 15330
242 Ga0207691_10352583 3300025940 Bacteria 1259
243 Ga0207711_10020723 3300025941 Bacteria 5486
244 Ga0207711_11283650 3300025941 Bacteria 674
245 Ga0207679_10083807 3300025945 Bacteria 2445
246 Ga0207679_10437183 3300025945 Bacteria 1158
247 Ga0207667_10000002 3300025949 Bacteria 895662
248 Ga0207667_10591362 3300025949 Bacteria 1120
249 Ga0207651_10007510 3300025960 Bacteria 5811
250 Ga0207651_10155091 3300025960 Bacteria 1788
251 Ga0207651_10275454 3300025960 Bacteria 1388
252 Ga0207712_10051407 3300025961 Bacteria 2882
253 Ga0207712_10544830 3300025961 Bacteria 997
254 Ga0207640_10002033 3300025981 Bacteria 10932
255 Ga0207640_10004441 3300025981 Bacteria 7608
256 Ga0207658_10423454 3300025986 Bacteria 1174
257 Ga0207703_10174553 3300026035 Bacteria 1893
258 Ga0207703_10193348 3300026035 Bacteria 1804
259 Ga0207703_10225730 3300026035 Bacteria 1677
260 Ga0207703_10514355 3300026035 Bacteria 1125
261 Ga0207639_10004520 3300026041 Bacteria 9380
262 Ga0207678_10006272 3300026067 Bacteria 10561
263 Ga0207678_10295100 3300026067 Bacteria 1392
264 Ga0207708_10042079 3300026075 Bacteria 3483
265 Ga0207702_10006858 3300026078 Bacteria 9768
266 Ga0207702_10036825 3300026078 Bacteria 4093
267 Ga0207641_10029948 3300026088 Bacteria 4503
268 Ga0207641_10103558 3300026088 Bacteria 2511
269 Ga0207648_10019898 3300026089 Bacteria 6058
270 Ga0207648_10245386 3300026089 Bacteria 1596
271 Ga0207674_10065996 3300026116 Bacteria 3646
272 Ga0207674_10981409 3300026116 Bacteria 814
273 Ga0207675_100000032 3300026118 Bacteria 108677
274 Ga0207675_100041923 3300026118 Bacteria 4274
275 Ga0207675_102006141 3300026118 Bacteria 596
276 Ga0207683_10000881 3300026121 Bacteria 27549
277 Ga0207698_10002649 3300026142 Bacteria 10641
278 Ga0207698_10035858 3300026142 Bacteria 3633
279 Ga0268266_10000015 3300028379 Bacteria 630629
280 Ga0268266_10021691 3300028379 Bacteria 5473
281 Ga0268266_10399147 3300028379 Bacteria 1300
282 Ga0268265_10093993 3300028380 Bacteria 2404
283 Ga0268265_10126892 3300028380 Bacteria 2113
284 Ga0268264_10038204 3300028381 Bacteria 3961
285 Ga0268264_10099816 3300028381 Bacteria 2520
286 Ga0268264_10288644 3300028381 Bacteria 1540
287 Ga0265338_10013206 3300028800 Bacteria 9347
288 Ga0237817_10031 3300030083 Bacteria 49190
289 Ga0237817_10037 3300030083 Bacteria 47435
290 Ga0265339_10125051 3300031249 Bacteria 1319
291 Ga0265316_10273803 3300031344 Bacteria 1235
292 Ga0307513_10008158 3300031456 Bacteria 13441
293 Ga0307509_10524162 3300031507 Bacteria 866
294 Ga0307510_10077558 3300033180 Bacteria 3258
295 Ga0307510_10239544 3300033180 Bacteria 1310
296 Ga0373938_0034059 3300034957 Bacteria 1105
297 Ga0373949_0000141 3300035090 Bacteria 27063
298 Ga0373953_0023291 3300035117 Bacteria 2343
299 Ga0373953_0141664 3300035117 Bacteria 1028
300 Ga0373956_0075828 3300035119 Bacteria 1538
301 Ga0373956_0431494 3300035119 Bacteria 629
302 Ga0373942_0252006 3300035207 Bacteria 600
303 Ga0373924_0039664 3300035410 Bacteria 1925
304 Ga0373933_0027776 3300035724 Bacteria 3262
305 Ga0373937_0031146 3300036401 Bacteria 4830
306 Ga0373937_0902654 3300036401 Bacteria 832
307 Ga0395905_0001140 3300037471 Bacteria 33247
308 Ga0395905_0095511 3300037471 Bacteria 2790
309 Ga0395905_0210745 3300037471 Bacteria 1820
310 Ga0395901_0653553 3300038443 Bacteria 1054
311 Ga0237819_00044 3300038705 Bacteria 43089
312 Ga0237819_00450 3300038705 Bacteria 14003
313 Ga0436365_0412369 3300039437 Bacteria 1785
314 Ga0451800_0094444 3300041459 Bacteria 721
315 Ga0451833_0083082 3300041491 Bacteria 899
316 Ga0439449_0075341 3300042007 Bacteria 1243
317 Ga0451577_0602604 3300042876 Bacteria 997
318 Ga0451577_0937728 3300042876 Unclassified 779
319 Ga0466972_0001182 3300044658 Bacteria 12531
320 Ga0453683_0154911 3300044673 Bacteria 1448
321 Ga0466961_0130291 3300044693 Bacteria 1576
322 Ga0466964_0116699 3300044706 Bacteria 1197
323 Ga0453684_0000007 3300044712 Bacteria 1301482
324 Ga0453684_0010210 3300044712 Bacteria 16101
325 Ga0453684_0077002 3300044712 Bacteria 4184
326 Ga0453684_0137726 3300044712 Bacteria 2920
327 Ga0453684_0165355 3300044712 Bacteria 2612
328 Ga0453684_0223719 3300044712 Bacteria 2178
329 Ga0453684_0368232 3300044712 Bacteria 1616
330 Ga0453684_0459775 3300044712 Bacteria 1415
331 Ga0453684_1939661 3300044712 Bacteria 595
332 Ga0466960_0033649 3300044901 Bacteria 2383
333 Ga0451576_0562283 3300045051 Bacteria 1198
334 Ga0451576_0636647 3300045051 Bacteria 1120
335 Ga0466967_0067505 3300045976 Bacteria 3190
336 Ga0495592_0436549 3300046454 Bacteria 823
337 Ga0495638_0146259 3300046460 Bacteria 1375
338 Ga0495641_0168475 3300046461 Unclassified 980
339 Ga0495650_0000302 3300046471 Bacteria 89516
340 Ga0495662_0516464 3300046476 Bacteria 585
341 Ga0495584_0022624 3300046491 Bacteria 3189
342 Ga0495584_0034164 3300046491 Bacteria 2573
343 Ga0495585_0021537 3300046492 Bacteria 3701
344 Ga0495585_0023239 3300046492 Bacteria 3558
345 Ga0495585_0066580 3300046492 Bacteria 1972
346 Ga0495607_0067623 3300046501 Bacteria 2007
347 Ga0495583_0001345 3300046506 Bacteria 25472
348 Ga0495583_0005024 3300046506 Bacteria 9156
349 Ga0495583_0007631 3300046506 Bacteria 6750
350 Ga0495606_0001599 3300046507 Bacteria 29536
351 Ga0495606_0107631 3300046507 Bacteria 1686
352 Ga0495616_0015569 3300046513 Bacteria 4227
353 Ga0495620_0184122 3300046515 Bacteria 807
354 Ga0495628_0187074 3300046516 Unclassified 1565
355 Ga0495631_0060236 3300046518 Unclassified 1647
356 Ga0495643_0000203 3300046522 Bacteria 92549
357 Ga0495643_0001323 3300046522 Bacteria 23436
358 Ga0495643_0002857 3300046522 Bacteria 13130
359 Ga0495643_0049889 3300046522 Bacteria 2255
360 Ga0495643_0158903 3300046522 Bacteria 1113
361 Ga0495648_0000961 3300046524 Bacteria 29733
362 Ga0495663_0003785 3300046525 Bacteria 4317
363 Ga0495663_0004208 3300046525 Bacteria 4062
364 Ga0495640_0389954 3300046533 Bacteria 856
365 Ga0495587_0051172 3300046536 Bacteria 2443
366 Ga0495587_0171116 3300046536 Bacteria 1234
367 Ga0495598_0085902 3300046537 Bacteria 1017
368 Ga0495621_0051231 3300046539 Bacteria 1477
369 Ga0495621_0137062 3300046539 Bacteria 955
370 Ga0495622_0164813 3300046557 Bacteria 998
371 Ga0495633_0000770 3300046558 Bacteria 28708
372 Ga0495633_0102164 3300046558 Bacteria 1331
373 Ga0495668_0000016 3300046616 Bacteria 438197
374 Ga0495668_0167860 3300046616 Bacteria 1202
375 Ga0495668_0238633 3300046616 Bacteria 995
376 Ga0495611_0005595 3300046648 Bacteria 5359
377 Ga0495611_0013550 3300046648 Bacteria 3473
378 Ga0495611_0309917 3300046648 Bacteria 727
379 Ga0495625_0005534 3300046660 Bacteria 11479
380 Ga0495625_0014265 3300046660 Bacteria 6352
381 Ga0495625_0063004 3300046660 Bacteria 2619
382 Ga0495625_0208588 3300046660 Bacteria 1285
383 Ga0495625_0298972 3300046660 Bacteria 1030
384 Ga0495625_0461874 3300046660 Bacteria 782
385 Ga0495599_0270561 3300046678 Bacteria 1031
386 Ga0495647_0051224 3300046681 Bacteria 1604
387 Ga0495658_0034225 3300046683 Bacteria 2786
388 Ga0495658_0434152 3300046683 Bacteria 838
389 Ga0495658_0522993 3300046683 Unclassified 759
390 Ga0495658_0790300 3300046683 Bacteria 608
391 Ga0495669_0000050 3300046684 Bacteria 80688
392 Ga0495669_0007538 3300046684 Bacteria 4563
393 Ga0495613_0196511 3300046689 Bacteria 1424
394 Ga0495670_0005533 3300046691 Bacteria 6200
395 Ga0495670_0138698 3300046691 Bacteria 1270
396 Ga0495649_0072989 3300046694 Bacteria 1839
397 Ga0495600_0001875 3300046809 Bacteria 11796
398 Ga0495660_0207565 3300046810 Bacteria 931
399 Ga0495636_0071386 3300047318 Bacteria 1483
400 Ga0495680_0226173 3300047322 Unclassified 1334
401 Ga0495683_0000816 3300047323 Bacteria 22176
402 Ga0495683_0021963 3300047323 Bacteria 3285
403 Ga0495687_001300 3300047443 Bacteria 23447
404 Ga0495687_001654 3300047443 Bacteria 20024
405 Ga0495677_0001776 3300047445 Bacteria 8624
406 Ga0495677_0142669 3300047445 Bacteria 920
407 Ga0495681_0003424 3300047470 Bacteria 11041
408 Ga0495681_0039674 3300047470 Bacteria 2297
409 Ga0495602_0760877 3300048088 Unclassified 653
410 Ga0496102_0005894 3300048905 Bacteria 10430
411 Ga0496103_0000131 3300048906 Bacteria 79787
412 Ga0496103_0102879 3300048906 Bacteria 1809
413 Ga0496104_0116940 3300048907 Bacteria 2559
414 Ga0496105_0001020 3300048908 Bacteria 19340
415 Ga0496106_0807571 3300048909 Bacteria 744
416 Ga0496107_0240709 3300048910 Bacteria 1346
417 Ga0496107_0780004 3300048910 Unclassified 700
418 Ga0496108_0406443 3300048911 Bacteria 1189
419 Ga0496110_0081036 3300048913 Bacteria 2893
420 Ga0496111_0009756 3300048914 Bacteria 6418
421 Ga0496112_0471832 3300048915 Bacteria 1192
422 Ga0496113_0014634 3300048916 Bacteria 5361
423 Ga0496114_0018506 3300048917 Bacteria 5633
424 Ga0496115_0000133 3300048918 Bacteria 67951
425 Ga0496116_0005419 3300048919 Bacteria 11859
426 Ga0496117_0002127 3300048920 Bacteria 25909
427 Ga0496118_0000092 3300048921 Bacteria 169106
428 Ga0496119_0005121 3300048922 Bacteria 12704
429 Ga0496120_0094557 3300048923 Bacteria 1590
430 Ga0496121_0013328 3300048924 Bacteria 8848
431 Ga0496122_0015746 3300048925 Bacteria 7208
432 Ga0496123_0002753 3300048926 Bacteria 21034
433 Ga0496124_0000081 3300048927 Bacteria 208413
434 Ga0496124_0002777 3300048927 Bacteria 22248
435 Ga0496125_0002309 3300048928 Bacteria 25170
436 Ga0496126_0000283 3300048929 Bacteria 107129
437 Ga0496126_0007418 3300048929 Bacteria 12031
438 Ga0495678_197449 3300049459 Bacteria 622
439 nmdc:mga0k408_58101_c1 3300050493 Bacteria 2246
440 nmdc:mga09592_320836_c1 3300050508 Bacteria 1342
441 nmdc:mga0qj67_1006294_c1 3300050509 Bacteria 654
442 nmdc:mga06r32_313956_c1 3300050510 Bacteria 1553
443 nmdc:mga0rr50_3273_c1 3300050513 Bacteria 9292
444 nmdc:mga0rr50_804263_c1 3300050513 Bacteria 802
445 nmdc:mga08x19_232031_c1 3300050514 Bacteria 1270
446 nmdc:mga0sz30_247356_c1 3300050516 Bacteria 794
447 Ga0500610_0000471 3300053079 Bacteria 12420
448 Ga0495619_0376826 3300053085 Bacteria 981
449 Ga0500556_0000095 3300053104 Bacteria 82300
450 Ga0500593_001106 3300053117 Bacteria 9714
451 Ga0500595_001409 3300053119 Bacteria 12904
452 Ga0500595_003953 3300053119 Bacteria 6774
453 Ga0500559_0023316 3300053136 Bacteria 2627
454 Ga0500619_001400 3300053154 Bacteria 4254
455 Ga0500636_0004585 3300053177 Bacteria 7839
456 Ga0500645_000221 3300053730 Bacteria 43327
457 Ga0500596_001215 3300053735 Bacteria 5209
458 Ga0500601_051726 3300053737 Bacteria 512
459 Ga0500661_068745 3300055283 Bacteria 646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021320 Ga0214544_1011478 Ga0214544_101147812 147
2 3300021321 Ga0214542_1001823 Ga0214542_100182361 147
3 3300021324 Ga0214545_1001477 Ga0214545_100147761 147
4 3300021327 Ga0214543_1004144 Ga0214543_10041443 147
5 3300039437 Ga0436365_0412369 Ga0436365_0412369_1003_1449 147
6 iso_pu_bacteria 2643221676 2644422139 148
7 iso_pu_bacteria 2775507192 2777839420 148
8 iso_pu_bacteria 2551306519 2553395547 149
9 iso_pu_bacteria 2643221729 2644704633 149
10 iso_pu_bacteria 2643221730 2644709327 149
11 iso_pu_bacteria 2684622632 2685150124 149
12 iso_pu_bacteria 2695420987 2698323138 149
13 iso_pu_bacteria 2703719227 2705994098 149
14 iso_pu_bacteria 2718218445 2721505426 149
15 iso_pu_bacteria 2738541358 2739157937 149
16 iso_pu_bacteria 2738543006 2739210617 149
17 iso_pu_bacteria 2738543017 2739268006 149
18 iso_pu_bacteria 2818991443 2819578793 149
19 iso_pu_bacteria 2857586860 2857587100 149
20 iso_pu_bacteria 2929233124 2929235331 149
21 iso_pu_bacteria 2938917290 2938919508 149
22 iso_pu_bacteria 2947426588 2947428879 149
23 iso_pu_bacteria 2965761152 2965763372 149
24 iso_pu_bacteria 2979083700 2979085827 149
25 iso_pu_bacteria 8022621104 8022625673 149
26 iso_pu_bacteria 8022792930 8022798570 149
27 iso_pu_bacteria 8023438354 8023444110 149
28 iso_pu_bacteria 8023444577 8023449707 149
29 iso_pu_bacteria 8057582654 8057584918 149
30 3300007076 Ga0075435_100912115 Ga0075435_1009121152 151
31 3300009098 Ga0105245_10416903 Ga0105245_104169032 151
32 3300013306 Ga0163162_12982025 Ga0163162_129820251 151
33 3300025927 Ga0207687_10223033 Ga0207687_102230332 151
34 3300035090 Ga0373949_0000141 Ga0373949_0000141_3765_4220 151
35 3300044712 Ga0453684_0010210 Ga0453684_0010210_11468_11923 151
36 3300044712 Ga0453684_0077002 Ga0453684_0077002_822_1277 151
37 3300044712 Ga0453684_0165355 Ga0453684_0165355_2105_2560 151
38 3300044712 Ga0453684_0223719 Ga0453684_0223719_1600_2055 151
39 3300044712 Ga0453684_0368232 Ga0453684_0368232_404_859 151
40 3300045051 Ga0451576_0562283 Ga0451576_0562283_224_679 151
41 3300050513 nmdc:mga0rr50_804263_c1 nmdc:mga0rr50_804263_c1_243_698 151
42 iso_pu_bacteria 2918501144 2918508082 151
43 3300003215 JGI25153J46596_10006222 JGI25153J46596_100062225 152
44 3300003320 rootH2_10061189 rootH2_100611893 152
45 3300005339 Ga0070660_100890961 Ga0070660_1008909612 152
46 3300005366 Ga0070659_100161682 Ga0070659_1001616822 152
47 3300005530 Ga0070679_101405511 Ga0070679_1014055111 152
48 3300005578 Ga0068854_100006661 Ga0068854_1000066616 152
49 3300005614 Ga0068856_100121898 Ga0068856_1001218982 152
50 3300005616 Ga0068852_100002971 Ga0068852_1000029715 152
51 3300005841 Ga0068863_100012044 Ga0068863_1000120442 152
52 3300005842 Ga0068858_100424053 Ga0068858_1004240532 152
53 3300005843 Ga0068860_100143279 Ga0068860_1001432794 152
54 3300005937 Ga0081455_10000431 Ga0081455_100004314 152
55 3300006237 Ga0097621_100803610 Ga0097621_1008036102 152
56 3300006237 Ga0097621_100934230 Ga0097621_1009342301 152
57 3300009098 Ga0105245_11310822 Ga0105245_113108222 152
58 3300009101 Ga0105247_10210204 Ga0105247_102102042 152
59 3300009174 Ga0105241_10393422 Ga0105241_103934221 152
60 3300009177 Ga0105248_10013044 Ga0105248_100130444 152
61 3300009545 Ga0105237_10087434 Ga0105237_100874343 152
62 3300009545 Ga0105237_10259990 Ga0105237_102599902 152
63 3300009553 Ga0105249_10199328 Ga0105249_101993282 152
64 3300010375 Ga0105239_10119575 Ga0105239_101195753 152
65 3300011119 Ga0105246_10618466 Ga0105246_106184661 152
66 3300025229 Ga0209147_100185 Ga0209147_1001859 152
67 3300025297 Ga0209758_1000032 Ga0209758_1000032358 152
68 3300025900 Ga0207710_10248201 Ga0207710_102482012 152
69 3300025903 Ga0207680_10048178 Ga0207680_100481783 152
70 3300025911 Ga0207654_10171403 Ga0207654_101714032 152
71 3300025914 Ga0207671_10059958 Ga0207671_100599583 152
72 3300025914 Ga0207671_10172476 Ga0207671_101724762 152
73 3300025925 Ga0207650_10339483 Ga0207650_103394832 152
74 3300025932 Ga0207690_10122516 Ga0207690_101225161 152
75 3300025941 Ga0207711_10020723 Ga0207711_100207234 152
76 3300025961 Ga0207712_10051407 Ga0207712_100514073 152
77 3300025981 Ga0207640_10004441 Ga0207640_100044417 152
78 3300025986 Ga0207658_10423454 Ga0207658_104234542 152
79 3300026035 Ga0207703_10174553 Ga0207703_101745532 152
80 3300026078 Ga0207702_10036825 Ga0207702_100368255 152
81 3300026088 Ga0207641_10029948 Ga0207641_100299482 152
82 3300026116 Ga0207674_10981409 Ga0207674_109814091 152
83 3300026142 Ga0207698_10002649 Ga0207698_1000264910 152
84 3300028379 Ga0268266_10021691 Ga0268266_100216916 152
85 3300028381 Ga0268264_10099816 Ga0268264_100998164 152
86 3300028381 Ga0268264_10288644 Ga0268264_102886443 152
87 3300035207 Ga0373942_0252006 Ga0373942_0252006_97_576 152
88 3300042007 Ga0439449_0075341 Ga0439449_0075341_448_906 152
89 3300044658 Ga0466972_0001182 Ga0466972_0001182_6680_7180 152
90 3300044693 Ga0466961_0130291 Ga0466961_0130291_395_895 152
91 3300044706 Ga0466964_0116699 Ga0466964_0116699_330_830 152
92 3300044901 Ga0466960_0033649 Ga0466960_0033649_304_804 152
93 3300046558 Ga0495633_0102164 Ga0495633_0102164_267_734 152
94 3300048906 Ga0496103_0102879 Ga0496103_0102879_282_743 152
95 3300048910 Ga0496107_0780004 Ga0496107_0780004_224_685 152
96 3300048927 Ga0496124_0002777 Ga0496124_0002777_18068_18529 152
97 3300053119 Ga0500595_003953 Ga0500595_003953_1792_2256 152
98 3300002987 JGI25159J45721_1001328 JGI25159J45721_10013286 153
99 3300002987 JGI25159J45721_1019126 JGI25159J45721_10191261 153
100 3300002987 JGI25159J45721_1051519 JGI25159J45721_10515191 153
101 3300003187 JGI25151J46595_10000173 JGI25151J46595_1000017372 153
102 3300003187 JGI25151J46595_10002843 JGI25151J46595_100028436 153
103 3300003187 JGI25151J46595_10005549 JGI25151J46595_100055495 153
104 3300003187 JGI25151J46595_10006202 JGI25151J46595_100062021 153
105 3300003187 JGI25151J46595_10044033 JGI25151J46595_100440331 153
106 3300003187 JGI25151J46595_10055319 JGI25151J46595_100553193 153
107 3300003187 JGI25151J46595_10158369 JGI25151J46595_101583691 153
108 3300003751 Ga0055538_1000729 Ga0055538_100072910 153
109 3300003758 Ga0055532_1000490 Ga0055532_100049011 153
110 3300003781 Ga0055536_1003107 Ga0055536_10031079 153
111 3300003781 Ga0055536_1007731 Ga0055536_10077315 153
112 3300003781 Ga0055536_1047830 Ga0055536_10478301 153
113 3300005293 Ga0065715_10238104 Ga0065715_102381043 153
114 3300005295 Ga0065707_10010580 Ga0065707_100105802 153
115 3300005340 Ga0070689_100066521 Ga0070689_1000665213 153
116 3300005353 Ga0070669_100867579 Ga0070669_1008675791 153
117 3300005356 Ga0070674_100143583 Ga0070674_1001435833 153
118 3300005364 Ga0070673_100009151 Ga0070673_1000091515 153
119 3300005367 Ga0070667_100991504 Ga0070667_1009915042 153
120 3300005438 Ga0070701_10079503 Ga0070701_100795033 153
121 3300005441 Ga0070700_100709600 Ga0070700_1007096001 153
122 3300005444 Ga0070694_100328030 Ga0070694_1003280302 153
123 3300005455 Ga0070663_100396545 Ga0070663_1003965452 153
124 3300005459 Ga0068867_100038847 Ga0068867_1000388472 153
125 3300005543 Ga0070672_100166727 Ga0070672_1001667273 153
126 3300005544 Ga0070686_100285611 Ga0070686_1002856112 153
127 3300005545 Ga0070695_100099436 Ga0070695_1000994363 153
128 3300005547 Ga0070693_100003881 Ga0070693_1000038815 153
129 3300005563 Ga0068855_100298709 Ga0068855_1002987092 153
130 3300005615 Ga0070702_100277755 Ga0070702_1002777552 153
131 3300005616 Ga0068852_100050318 Ga0068852_1000503182 153
132 3300005617 Ga0068859_100016161 Ga0068859_1000161614 153
133 3300005617 Ga0068859_100786486 Ga0068859_1007864862 153
134 3300005719 Ga0068861_100000004 Ga0068861_10000000431 153
135 3300005719 Ga0068861_100060663 Ga0068861_1000606633 153
136 3300005841 Ga0068863_100047629 Ga0068863_1000476293 153
137 3300005842 Ga0068858_100091429 Ga0068858_1000914294 153
138 3300005843 Ga0068860_100311880 Ga0068860_1003118803 153
139 3300005844 Ga0068862_100273204 Ga0068862_1002732042 153
140 3300006914 Ga0075436_100234220 Ga0075436_1002342202 153
141 3300006931 Ga0097620_100016161 Ga0097620_1000161615 153
142 3300006931 Ga0097620_100786551 Ga0097620_1007865512 153
143 3300007076 Ga0075435_100003365 Ga0075435_1000033655 153
144 3300009011 Ga0105251_10191871 Ga0105251_101918712 153
145 3300009036 Ga0105244_10019025 Ga0105244_100190253 153
146 3300009036 Ga0105244_10184530 Ga0105244_101845302 153
147 3300009092 Ga0105250_10018029 Ga0105250_100180291 153
148 3300009092 Ga0105250_10025112 Ga0105250_100251123 153
149 3300009098 Ga0105245_10090931 Ga0105245_100909312 153
150 3300009148 Ga0105243_10129370 Ga0105243_101293702 153
151 3300009176 Ga0105242_10078198 Ga0105242_100781981 153
152 3300009177 Ga0105248_10002150 Ga0105248_1000215013 153
153 3300009177 Ga0105248_10010555 Ga0105248_100105552 153
154 3300009177 Ga0105248_10815943 Ga0105248_108159432 153
155 3300009553 Ga0105249_10373239 Ga0105249_103732392 153
156 3300013306 Ga0163162_10729818 Ga0163162_107298182 153
157 3300014968 Ga0157379_10385925 Ga0157379_103859252 153
158 3300025224 Ga0209784_100054 Ga0209784_10005410 153
159 3300025229 Ga0209147_100057 Ga0209147_1000578 153
160 3300025284 Ga0209130_1002051 Ga0209130_10020518 153
161 3300025284 Ga0209130_1016609 Ga0209130_10166091 153
162 3300025284 Ga0209130_1022916 Ga0209130_10229161 153
163 3300025292 Ga0209676_1000494 Ga0209676_100049428 153
164 3300025292 Ga0209676_1000649 Ga0209676_10006493 153
165 3300025292 Ga0209676_1006704 Ga0209676_10067041 153
166 3300025292 Ga0209676_1020397 Ga0209676_10203972 153
167 3300025292 Ga0209676_1023446 Ga0209676_10234462 153
168 3300025292 Ga0209676_1048516 Ga0209676_10485161 153
169 3300025294 Ga0209025_1000107 Ga0209025_100010744 153
170 3300025294 Ga0209025_1000266 Ga0209025_100026653 153
171 3300025294 Ga0209025_1000355 Ga0209025_100035563 153
172 3300025294 Ga0209025_1001564 Ga0209025_100156417 153
173 3300025294 Ga0209025_1002190 Ga0209025_100219015 153
174 3300025294 Ga0209025_1002944 Ga0209025_10029449 153
175 3300025294 Ga0209025_1004192 Ga0209025_10041928 153
176 3300025294 Ga0209025_1004850 Ga0209025_10048507 153
177 3300025294 Ga0209025_1006327 Ga0209025_10063279 153
178 3300025294 Ga0209025_1080211 Ga0209025_10802111 153
179 3300025294 Ga0209025_1103042 Ga0209025_11030422 153
180 3300025711 Ga0207696_1015056 Ga0207696_10150564 153
181 3300025711 Ga0207696_1049915 Ga0207696_10499152 153
182 3300025728 Ga0207655_1022342 Ga0207655_10223424 153
183 3300025735 Ga0207713_1032264 Ga0207713_10322644 153
184 3300025907 Ga0207645_10035604 Ga0207645_100356042 153
185 3300025923 Ga0207681_10012522 Ga0207681_100125227 153
186 3300025926 Ga0207659_10683967 Ga0207659_106839671 153
187 3300025927 Ga0207687_10032248 Ga0207687_100322484 153
188 3300025927 Ga0207687_10199672 Ga0207687_101996722 153
189 3300025931 Ga0207644_10101469 Ga0207644_101014693 153
190 3300025933 Ga0207706_10117408 Ga0207706_101174083 153
191 3300025937 Ga0207669_10065466 Ga0207669_100654662 153
192 3300025940 Ga0207691_10003479 Ga0207691_100034799 153
193 3300025941 Ga0207711_11283650 Ga0207711_112836501 153
194 3300025949 Ga0207667_10591362 Ga0207667_105913622 153
195 3300025960 Ga0207651_10007510 Ga0207651_100075104 153
196 3300026035 Ga0207703_10193348 Ga0207703_101933482 153
197 3300026067 Ga0207678_10295100 Ga0207678_102951001 153
198 3300026075 Ga0207708_10042079 Ga0207708_100420793 153
199 3300026088 Ga0207641_10103558 Ga0207641_101035583 153
200 3300026089 Ga0207648_10019898 Ga0207648_100198983 153
201 3300026118 Ga0207675_100000032 Ga0207675_10000003253 153
202 3300026118 Ga0207675_100041923 Ga0207675_1000419235 153
203 3300028380 Ga0268265_10126892 Ga0268265_101268923 153
204 3300030083 Ga0237817_10031 Ga0237817_1003122 153
205 3300030083 Ga0237817_10037 Ga0237817_100374 153
206 3300031344 Ga0265316_10273803 Ga0265316_102738033 153
207 3300034957 Ga0373938_0034059 Ga0373938_0034059_266_733 153
208 3300035117 Ga0373953_0141664 Ga0373953_0141664_315_785 153
209 3300035119 Ga0373956_0431494 Ga0373956_0431494_133_600 153
210 3300035410 Ga0373924_0039664 Ga0373924_0039664_528_998 153
211 3300035724 Ga0373933_0027776 Ga0373933_0027776_1257_1727 153
212 3300036401 Ga0373937_0031146 Ga0373937_0031146_2449_2919 153
213 3300036401 Ga0373937_0902654 Ga0373937_0902654_178_645 153
214 3300038705 Ga0237819_00044 Ga0237819_00044_15293_15772 153
215 3300038705 Ga0237819_00450 Ga0237819_00450_12858_13337 153
216 3300041459 Ga0451800_0094444 Ga0451800_0094444_42_512 153
217 3300042876 Ga0451577_0602604 Ga0451577_0602604_67_528 153
218 3300042876 Ga0451577_0937728 Ga0451577_0937728_233_694 153
219 3300044673 Ga0453683_0154911 Ga0453683_0154911_701_1162 153
220 3300044712 Ga0453684_0459775 Ga0453684_0459775_899_1360 153
221 3300044712 Ga0453684_1939661 Ga0453684_1939661_77_538 153
222 3300045051 Ga0451576_0636647 Ga0451576_0636647_604_1065 153
223 3300045976 Ga0466967_0067505 Ga0466967_0067505_304_783 153
224 3300046516 Ga0495628_0187074 Ga0495628_0187074_531_998 153
225 3300046522 Ga0495643_0000203 Ga0495643_0000203_82618_83091 153
226 3300046536 Ga0495587_0171116 Ga0495587_0171116_564_1034 153
227 3300046678 Ga0495599_0270561 Ga0495599_0270561_58_525 153
228 3300046681 Ga0495647_0051224 Ga0495647_0051224_189_659 153
229 3300046683 Ga0495658_0034225 Ga0495658_0034225_454_924 153
230 3300046683 Ga0495658_0434152 Ga0495658_0434152_229_699 153
231 3300048909 Ga0496106_0807571 Ga0496106_0807571_18_485 153
232 3300050513 nmdc:mga0rr50_3273_c1 nmdc:mga0rr50_3273_c1_2999_3466 153
233 3300050514 nmdc:mga08x19_232031_c1 nmdc:mga08x19_232031_c1_421_888 153
234 3300053085 Ga0495619_0376826 Ga0495619_0376826_329_799 153
235 3300001915 JGI24741J21665_1000273 JGI24741J21665_10002737 154
236 3300001978 JGI24747J21853_1019216 JGI24747J21853_10192162 154
237 3300001979 JGI24740J21852_10011128 JGI24740J21852_100111285 154
238 3300001990 JGI24737J22298_10000698 JGI24737J22298_1000069811 154
239 3300001990 JGI24737J22298_10004668 JGI24737J22298_100046683 154
240 3300002077 JGI24744J21845_10052342 JGI24744J21845_100523422 154
241 3300002987 JGI25159J45721_1005749 JGI25159J45721_10057491 154
242 3300003187 JGI25151J46595_10011124 JGI25151J46595_100111243 154
243 3300003187 JGI25151J46595_10110299 JGI25151J46595_101102991 154
244 3300003215 JGI25153J46596_10000021 JGI25153J46596_10000021203 154
245 3300003323 rootH1_10279068 rootH1_102790682 154
246 3300003759 Ga0055525_1000012 Ga0055525_1000012380 154
247 3300003762 Ga0055542_1000094 Ga0055542_100009426 154
248 3300003763 Ga0055529_1000045 Ga0055529_1000045106 154
249 3300005327 Ga0070658_10018031 Ga0070658_100180315 154
250 3300005328 Ga0070676_10337077 Ga0070676_103370771 154
251 3300005331 Ga0070670_100257536 Ga0070670_1002575362 154
252 3300005337 Ga0070682_100254033 Ga0070682_1002540331 154
253 3300005339 Ga0070660_100139110 Ga0070660_1001391102 154
254 3300005339 Ga0070660_100863027 Ga0070660_1008630271 154
255 3300005339 Ga0070660_100994977 Ga0070660_1009949771 154
256 3300005344 Ga0070661_100014248 Ga0070661_1000142486 154
257 3300005354 Ga0070675_100111498 Ga0070675_1001114982 154
258 3300005354 Ga0070675_100655644 Ga0070675_1006556442 154
259 3300005356 Ga0070674_100003272 Ga0070674_1000032722 154
260 3300005356 Ga0070674_100014453 Ga0070674_1000144531 154
261 3300005366 Ga0070659_100459889 Ga0070659_1004598892 154
262 3300005366 Ga0070659_100589472 Ga0070659_1005894721 154
263 3300005367 Ga0070667_100281088 Ga0070667_1002810882 154
264 3300005455 Ga0070663_100509571 Ga0070663_1005095712 154
265 3300005456 Ga0070678_100000149 Ga0070678_10000014916 154
266 3300005456 Ga0070678_100771642 Ga0070678_1007716421 154
267 3300005456 Ga0070678_100833829 Ga0070678_1008338291 154
268 3300005459 Ga0068867_100267614 Ga0068867_1002676142 154
269 3300005471 Ga0070698_100005242 Ga0070698_10000524211 154
270 3300005543 Ga0070672_100951174 Ga0070672_1009511742 154
271 3300005548 Ga0070665_100000021 Ga0070665_10000002132 154
272 3300005548 Ga0070665_100594023 Ga0070665_1005940232 154
273 3300005564 Ga0070664_100501138 Ga0070664_1005011382 154
274 3300005578 Ga0068854_100126720 Ga0068854_1001267202 154
275 3300005719 Ga0068861_100459384 Ga0068861_1004593842 154
276 3300005834 Ga0068851_10018246 Ga0068851_100182462 154
277 3300005843 Ga0068860_100056613 Ga0068860_1000566135 154
278 3300005844 Ga0068862_100082451 Ga0068862_1000824514 154
279 3300006163 Ga0070715_10570172 Ga0070715_105701721 154
280 3300006178 Ga0075367_10398856 Ga0075367_103988562 154
281 3300006186 Ga0075369_10103026 Ga0075369_101030262 154
282 3300006195 Ga0075366_10084487 Ga0075366_100844872 154
283 3300006358 Ga0068871_100009681 Ga0068871_1000096813 154
284 3300006846 Ga0075430_101136538 Ga0075430_1011365381 154
285 3300006847 Ga0075431_100570431 Ga0075431_1005704313 154
286 3300006880 Ga0075429_100195855 Ga0075429_1001958552 154
287 3300009011 Ga0105251_10032877 Ga0105251_100328772 154
288 3300009092 Ga0105250_10003183 Ga0105250_100031838 154
289 3300009093 Ga0105240_10418178 Ga0105240_104181782 154
290 3300009148 Ga0105243_10000512 Ga0105243_1000051221 154
291 3300009148 Ga0105243_11778483 Ga0105243_117784832 154
292 3300009174 Ga0105241_10180210 Ga0105241_101802102 154
293 3300009174 Ga0105241_11030255 Ga0105241_110302552 154
294 3300009545 Ga0105237_10182631 Ga0105237_101826312 154
295 3300009551 Ga0105238_11268544 Ga0105238_112685441 154
296 3300009553 Ga0105249_11588358 Ga0105249_115883581 154
297 3300011119 Ga0105246_10231544 Ga0105246_102315442 154
298 3300013102 Ga0157371_10000032 Ga0157371_10000032139 154
299 3300013105 Ga0157369_10359299 Ga0157369_103592991 154
300 3300013297 Ga0157378_11414409 Ga0157378_114144092 154
301 3300013306 Ga0163162_10491175 Ga0163162_104911752 154
302 3300013307 Ga0157372_10410444 Ga0157372_104104442 154
303 3300017792 Ga0163161_10207610 Ga0163161_102076102 154
304 3300021384 Ga0213876_10156284 Ga0213876_101562843 154
305 3300025230 Ga0209563_100030 Ga0209563_10003070 154
306 3300025246 Ga0209646_1004008 Ga0209646_10040085 154
307 3300025254 Ga0209148_1000011 Ga0209148_1000011659 154
308 3300025272 Ga0209455_1000006 Ga0209455_1000006534 154
309 3300025272 Ga0209455_1009479 Ga0209455_10094792 154
310 3300025284 Ga0209130_1000633 Ga0209130_100063317 154
311 3300025284 Ga0209130_1007551 Ga0209130_10075513 154
312 3300025294 Ga0209025_1003509 Ga0209025_10035098 154
313 3300025294 Ga0209025_1005049 Ga0209025_10050493 154
314 3300025297 Ga0209758_1000023 Ga0209758_100002381 154
315 3300025321 Ga0207656_10000615 Ga0207656_100006159 154
316 3300025711 Ga0207696_1005843 Ga0207696_10058433 154
317 3300025735 Ga0207713_1101937 Ga0207713_11019372 154
318 3300025904 Ga0207647_10011819 Ga0207647_100118194 154
319 3300025904 Ga0207647_10036845 Ga0207647_100368454 154
320 3300025905 Ga0207685_10210861 Ga0207685_102108612 154
321 3300025907 Ga0207645_10079482 Ga0207645_100794824 154
322 3300025907 Ga0207645_10750247 Ga0207645_107502472 154
323 3300025909 Ga0207705_10001219 Ga0207705_100012197 154
324 3300025911 Ga0207654_10001636 Ga0207654_1000163613 154
325 3300025913 Ga0207695_10013219 Ga0207695_100132199 154
326 3300025914 Ga0207671_10005662 Ga0207671_1000566212 154
327 3300025916 Ga0207663_10009441 Ga0207663_100094413 154
328 3300025919 Ga0207657_10010001 Ga0207657_100100014 154
329 3300025920 Ga0207649_10003922 Ga0207649_100039225 154
330 3300025920 Ga0207649_10895840 Ga0207649_108958401 154
331 3300025922 Ga0207646_10162600 Ga0207646_101626003 154
332 3300025924 Ga0207694_10008848 Ga0207694_100088484 154
333 3300025924 Ga0207694_11128722 Ga0207694_111287222 154
334 3300025926 Ga0207659_10080988 Ga0207659_100809883 154
335 3300025932 Ga0207690_10016577 Ga0207690_100165774 154
336 3300025933 Ga0207706_10186655 Ga0207706_101866552 154
337 3300025933 Ga0207706_10260539 Ga0207706_102605392 154
338 3300025935 Ga0207709_10000145 Ga0207709_1000014578 154
339 3300025937 Ga0207669_10000118 Ga0207669_1000011823 154
340 3300025937 Ga0207669_10000784 Ga0207669_100007847 154
341 3300025940 Ga0207691_10352583 Ga0207691_103525832 154
342 3300025945 Ga0207679_10083807 Ga0207679_100838071 154
343 3300025945 Ga0207679_10437183 Ga0207679_104371831 154
344 3300025949 Ga0207667_10000002 Ga0207667_10000002387 154
345 3300025960 Ga0207651_10155091 Ga0207651_101550912 154
346 3300025960 Ga0207651_10275454 Ga0207651_102754542 154
347 3300025961 Ga0207712_10544830 Ga0207712_105448302 154
348 3300025981 Ga0207640_10002033 Ga0207640_1000203311 154
349 3300026035 Ga0207703_10225730 Ga0207703_102257302 154
350 3300026035 Ga0207703_10514355 Ga0207703_105143552 154
351 3300026041 Ga0207639_10004520 Ga0207639_1000452010 154
352 3300026067 Ga0207678_10006272 Ga0207678_1000627211 154
353 3300026078 Ga0207702_10006858 Ga0207702_100068583 154
354 3300026089 Ga0207648_10245386 Ga0207648_102453862 154
355 3300026116 Ga0207674_10065996 Ga0207674_100659963 154
356 3300026118 Ga0207675_102006141 Ga0207675_1020061411 154
357 3300026121 Ga0207683_10000881 Ga0207683_1000088114 154
358 3300026142 Ga0207698_10035858 Ga0207698_100358582 154
359 3300028379 Ga0268266_10000015 Ga0268266_10000015419 154
360 3300028379 Ga0268266_10399147 Ga0268266_103991472 154
361 3300028380 Ga0268265_10093993 Ga0268265_100939932 154
362 3300028381 Ga0268264_10038204 Ga0268264_100382045 154
363 3300028800 Ga0265338_10013206 Ga0265338_100132067 154
364 3300031249 Ga0265339_10125051 Ga0265339_101250512 154
365 3300031456 Ga0307513_10008158 Ga0307513_100081584 154
366 3300031507 Ga0307509_10524162 Ga0307509_105241622 154
367 3300033180 Ga0307510_10077558 Ga0307510_100775582 154
368 3300033180 Ga0307510_10239544 Ga0307510_102395442 154
369 3300035117 Ga0373953_0023291 Ga0373953_0023291_977_1450 154
370 3300035119 Ga0373956_0075828 Ga0373956_0075828_475_948 154
371 3300037471 Ga0395905_0001140 Ga0395905_0001140_16490_16957 154
372 3300037471 Ga0395905_0095511 Ga0395905_0095511_1236_1700 154
373 3300037471 Ga0395905_0210745 Ga0395905_0210745_11_487 154
374 3300038443 Ga0395901_0653553 Ga0395901_0653553_344_808 154
375 3300041491 Ga0451833_0083082 Ga0451833_0083082_380_844 154
376 3300044712 Ga0453684_0000007 Ga0453684_0000007_504740_505222 154
377 3300044712 Ga0453684_0137726 Ga0453684_0137726_2183_2680 154
378 3300046454 Ga0495592_0436549 Ga0495592_0436549_193_657 154
379 3300046460 Ga0495638_0146259 Ga0495638_0146259_242_706 154
380 3300046461 Ga0495641_0168475 Ga0495641_0168475_42_509 154
381 3300046471 Ga0495650_0000302 Ga0495650_0000302_68032_68496 154
382 3300046476 Ga0495662_0516464 Ga0495662_0516464_103_567 154
383 3300046491 Ga0495584_0022624 Ga0495584_0022624_921_1385 154
384 3300046491 Ga0495584_0034164 Ga0495584_0034164_1008_1472 154
385 3300046492 Ga0495585_0021537 Ga0495585_0021537_75_545 154
386 3300046492 Ga0495585_0023239 Ga0495585_0023239_1854_2336 154
387 3300046492 Ga0495585_0066580 Ga0495585_0066580_656_1120 154
388 3300046501 Ga0495607_0067623 Ga0495607_0067623_414_878 154
389 3300046506 Ga0495583_0001345 Ga0495583_0001345_16556_17020 154
390 3300046506 Ga0495583_0005024 Ga0495583_0005024_2273_2737 154
391 3300046506 Ga0495583_0007631 Ga0495583_0007631_5220_5684 154
392 3300046507 Ga0495606_0001599 Ga0495606_0001599_23194_23658 154
393 3300046507 Ga0495606_0107631 Ga0495606_0107631_97_561 154
394 3300046513 Ga0495616_0015569 Ga0495616_0015569_662_1126 154
395 3300046515 Ga0495620_0184122 Ga0495620_0184122_255_719 154
396 3300046518 Ga0495631_0060236 Ga0495631_0060236_682_1146 154
397 3300046522 Ga0495643_0001323 Ga0495643_0001323_6690_7154 154
398 3300046522 Ga0495643_0002857 Ga0495643_0002857_1900_2364 154
399 3300046522 Ga0495643_0049889 Ga0495643_0049889_1596_2060 154
400 3300046522 Ga0495643_0158903 Ga0495643_0158903_455_919 154
401 3300046524 Ga0495648_0000961 Ga0495648_0000961_21832_22296 154
402 3300046525 Ga0495663_0003785 Ga0495663_0003785_2152_2622 154
403 3300046525 Ga0495663_0004208 Ga0495663_0004208_3524_3988 154
404 3300046533 Ga0495640_0389954 Ga0495640_0389954_372_839 154
405 3300046536 Ga0495587_0051172 Ga0495587_0051172_1203_1667 154
406 3300046537 Ga0495598_0085902 Ga0495598_0085902_321_791 154
407 3300046539 Ga0495621_0051231 Ga0495621_0051231_36_509 154
408 3300046539 Ga0495621_0137062 Ga0495621_0137062_243_713 154
409 3300046557 Ga0495622_0164813 Ga0495622_0164813_167_631 154
410 3300046558 Ga0495633_0000770 Ga0495633_0000770_15460_15924 154
411 3300046616 Ga0495668_0000016 Ga0495668_0000016_351198_351662 154
412 3300046616 Ga0495668_0167860 Ga0495668_0167860_261_725 154
413 3300046616 Ga0495668_0238633 Ga0495668_0238633_288_752 154
414 3300046648 Ga0495611_0005595 Ga0495611_0005595_4468_4932 154
415 3300046648 Ga0495611_0013550 Ga0495611_0013550_901_1365 154
416 3300046648 Ga0495611_0309917 Ga0495611_0309917_161_625 154
417 3300046660 Ga0495625_0005534 Ga0495625_0005534_6815_7297 154
418 3300046660 Ga0495625_0014265 Ga0495625_0014265_785_1249 154
419 3300046660 Ga0495625_0063004 Ga0495625_0063004_1316_1780 154
420 3300046660 Ga0495625_0208588 Ga0495625_0208588_341_805 154
421 3300046660 Ga0495625_0298972 Ga0495625_0298972_503_967 154
422 3300046660 Ga0495625_0461874 Ga0495625_0461874_288_752 154
423 3300046683 Ga0495658_0522993 Ga0495658_0522993_153_626 154
424 3300046683 Ga0495658_0790300 Ga0495658_0790300_43_510 154
425 3300046684 Ga0495669_0000050 Ga0495669_0000050_64734_65198 154
426 3300046684 Ga0495669_0007538 Ga0495669_0007538_2622_3092 154
427 3300046689 Ga0495613_0196511 Ga0495613_0196511_252_716 154
428 3300046691 Ga0495670_0005533 Ga0495670_0005533_2716_3180 154
429 3300046691 Ga0495670_0138698 Ga0495670_0138698_464_934 154
430 3300046694 Ga0495649_0072989 Ga0495649_0072989_133_597 154
431 3300046809 Ga0495600_0001875 Ga0495600_0001875_7454_7918 154
432 3300046810 Ga0495660_0207565 Ga0495660_0207565_301_765 154
433 3300047318 Ga0495636_0071386 Ga0495636_0071386_505_969 154
434 3300047322 Ga0495680_0226173 Ga0495680_0226173_423_890 154
435 3300047323 Ga0495683_0000816 Ga0495683_0000816_14675_15139 154
436 3300047323 Ga0495683_0021963 Ga0495683_0021963_1174_1638 154
437 3300047443 Ga0495687_001300 Ga0495687_001300_7807_8271 154
438 3300047443 Ga0495687_001654 Ga0495687_001654_5007_5471 154
439 3300047445 Ga0495677_0001776 Ga0495677_0001776_1814_2278 154
440 3300047445 Ga0495677_0142669 Ga0495677_0142669_130_594 154
441 3300047470 Ga0495681_0003424 Ga0495681_0003424_2655_3119 154
442 3300047470 Ga0495681_0039674 Ga0495681_0039674_1206_1670 154
443 3300048088 Ga0495602_0760877 Ga0495602_0760877_85_558 154
444 3300048905 Ga0496102_0005894 Ga0496102_0005894_2430_2894 154
445 3300048906 Ga0496103_0000131 Ga0496103_0000131_17444_17908 154
446 3300048907 Ga0496104_0116940 Ga0496104_0116940_1788_2252 154
447 3300048908 Ga0496105_0001020 Ga0496105_0001020_6138_6602 154
448 3300048910 Ga0496107_0240709 Ga0496107_0240709_387_851 154
449 3300048911 Ga0496108_0406443 Ga0496108_0406443_647_1111 154
450 3300048913 Ga0496110_0081036 Ga0496110_0081036_1821_2285 154
451 3300048914 Ga0496111_0009756 Ga0496111_0009756_3618_4082 154
452 3300048915 Ga0496112_0471832 Ga0496112_0471832_198_662 154
453 3300048916 Ga0496113_0014634 Ga0496113_0014634_223_687 154
454 3300048917 Ga0496114_0018506 Ga0496114_0018506_1541_2005 154
455 3300048918 Ga0496115_0000133 Ga0496115_0000133_50121_50585 154
456 3300048919 Ga0496116_0005419 Ga0496116_0005419_8900_9364 154
457 3300048920 Ga0496117_0002127 Ga0496117_0002127_7606_8070 154
458 3300048921 Ga0496118_0000092 Ga0496118_0000092_79761_80225 154
459 3300048922 Ga0496119_0005121 Ga0496119_0005121_2604_3068 154
460 3300048923 Ga0496120_0094557 Ga0496120_0094557_422_886 154
461 3300048924 Ga0496121_0013328 Ga0496121_0013328_1816_2280 154
462 3300048925 Ga0496122_0015746 Ga0496122_0015746_5010_5474 154
463 3300048926 Ga0496123_0002753 Ga0496123_0002753_14525_14989 154
464 3300048927 Ga0496124_0000081 Ga0496124_0000081_128117_128581 154
465 3300048928 Ga0496125_0002309 Ga0496125_0002309_7298_7762 154
466 3300048929 Ga0496126_0000283 Ga0496126_0000283_88890_89354 154
467 3300048929 Ga0496126_0007418 Ga0496126_0007418_6086_6553 154
468 3300049459 Ga0495678_197449 Ga0495678_197449_109_573 154
469 3300050493 nmdc:mga0k408_58101_c1 nmdc:mga0k408_58101_c1_469_933 154
470 3300050508 nmdc:mga09592_320836_c1 nmdc:mga09592_320836_c1_148_633 154
471 3300050509 nmdc:mga0qj67_1006294_c1 nmdc:mga0qj67_1006294_c1_145_630 154
472 3300050510 nmdc:mga06r32_313956_c1 nmdc:mga06r32_313956_c1_905_1390 154
473 3300050516 nmdc:mga0sz30_247356_c1 nmdc:mga0sz30_247356_c1_293_757 154
474 3300053079 Ga0500610_0000471 Ga0500610_0000471_1602_2066 154
475 3300053104 Ga0500556_0000095 Ga0500556_0000095_7485_7952 154
476 3300053117 Ga0500593_001106 Ga0500593_001106_5617_6084 154
477 3300053119 Ga0500595_001409 Ga0500595_001409_4121_4585 154
478 3300053136 Ga0500559_0023316 Ga0500559_0023316_1608_2078 154
479 3300053154 Ga0500619_001400 Ga0500619_001400_516_980 154
480 3300053177 Ga0500636_0004585 Ga0500636_0004585_103_567 154
481 3300053730 Ga0500645_000221 Ga0500645_000221_8104_8568 154
482 3300053735 Ga0500596_001215 Ga0500596_001215_1982_2446 154
483 3300053737 Ga0500601_051726 Ga0500601_051726_19_489 154
484 3300055283 Ga0500661_068745 Ga0500661_068745_14_478 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

29

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.8661 1 139
7bu1-assembly1.cif.gz_B crystal structure of trmo from pseudomonas aeruginosa 0.8648 1 139
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8589 3 137
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.853 3 137
7btu-assembly1.cif.gz_A crystal structure of trmo from p. areuginosa 0.8459 1 143
ID Description Score Start End Superfamily
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8567 5 135 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8559 4 137 2.40.30.70
1xqbB01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8527 1 141 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.85 4 137 2.40.30.70
af_P28634_1_140_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8485 1 129 2.40.30.70
ID Description Score Start End GO Terms
AF-C7Q1X8-F1-model_v4 TsaA-like domain-containing protein 0.9883 2 152
AF-A0A810LN61-F1-model_v4 deleted 0.9883 1 152
AF-A0A6I1ZDX3-F1-model_v4 TsaA-like domain-containing protein 0.9879 1 152
AF-A0A1M3ADH7-F1-model_v4 deleted 0.9878 1 152
AF-A0A2N3W5S7-F1-model_v4 tRNA (Thr-GGU) A37 N-methylase 0.987 1 152 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.82 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map