F452645

General Info

Members Datasets Scaffolds Average Seq Length
482 348 480 324

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0054321|Ga0395900_0054321_176_1264
Length 362
Sequence MRLHFSGADRNVPRAKGATNASPEHCGGNMRAFVTRAFHLTRRAAVLAGISALAAASLGAAHAQSYPDHTVKIIVPFPAGGTADAVPRIVADWLSRKWGQPVVIENHTGAAGNIGSEIVYKAAPDGYTLLSAPPXPLVNNQNLYPHLPFDPAKFEPVSIMAEAPSGLFVNPDKIKAKSIPELIAYMKANPGKVLVATQGNGTTAHLTAELFNLMAGVKTQMVPYRGSAPALQGLLAGNVDIMFDNLGVSLPMAKAGKLKLLGVATAHRLKSMPDVPTIAETLPGFLSSAWYAVVAPPKTPKAVVDKINADINGALKDPAVIEKLKKLSCDVVGGTPQQAADFMKQEVKRWGNVIKSAHITLQ

Samples

Sample ID Description Type Environment
1 2643221599 Rhizobium sp. Root708 Isolate Unclassified
2 2738541293 Rhizobium sp. GV031 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
303 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.19
Nodule 0
Rhizoplane 2.7
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000103 3300001989 Bacteria 25576
2 JGI24737J22298_10001126 3300001990 Bacteria 9400
3 JGI24750J21931_1000146 3300002070 Bacteria 11547
4 JGI24745J21846_1000206 3300002073 Bacteria 4783
5 JGI24748J21848_1001081 3300002074 Bacteria 2971
6 JGI24749J21850_1001451 3300002076 Bacteria 3350
7 JGI24035J26624_1000077 3300002126 Bacteria 7943
8 JGI24742J22300_10000066 3300002244 Bacteria 15346
9 JGI24751J29686_10016809 3300002459 Bacteria 1510
10 rootL2_10019543 3300003322 Bacteria 2088
11 rootL2_10140712 3300003322 Bacteria 2880
12 rootL2_10156181 3300003322 Bacteria 3780
13 Ga0065715_10089784 3300005293 Bacteria 8534
14 Ga0065707_10120544 3300005295 Bacteria 2132
15 Ga0070658_10007426 3300005327 Bacteria 8848
16 Ga0070676_10014685 3300005328 Bacteria 4307
17 Ga0070683_100010341 3300005329 Bacteria 8025
18 Ga0070683_100131057 3300005329 Bacteria 2373
19 Ga0070690_100013073 3300005330 Bacteria 4897
20 Ga0070670_100035000 3300005331 Bacteria 4323
21 Ga0068869_100000236 3300005334 Bacteria 29097
22 Ga0070666_10009878 3300005335 Bacteria 5960
23 Ga0070680_100056705 3300005336 Bacteria 3202
24 Ga0070680_100098670 3300005336 Bacteria 2423
25 Ga0070680_100110307 3300005336 Bacteria 2290
26 Ga0070682_100002602 3300005337 Bacteria 9963
27 Ga0070660_100003492 3300005339 Bacteria 10828
28 Ga0070660_100089523 3300005339 Bacteria 2425
29 Ga0070689_100000466 3300005340 Bacteria 23849
30 Ga0070661_100000827 3300005344 Bacteria 22257
31 Ga0070692_10002292 3300005345 Bacteria 7364
32 Ga0070669_100002399 3300005353 Bacteria 13560
33 Ga0070675_100005703 3300005354 Bacteria 9530
34 Ga0070675_100362631 3300005354 Bacteria 1287
35 Ga0070671_100000736 3300005355 Bacteria 23441
36 Ga0070673_100000302 3300005364 Bacteria 25831
37 Ga0070673_100180064 3300005364 Bacteria 1809
38 Ga0070688_100004878 3300005365 Bacteria 7018
39 Ga0070659_100001555 3300005366 Bacteria 16548
40 Ga0070659_100210918 3300005366 Bacteria 1601
41 Ga0070667_100002272 3300005367 Bacteria 16919
42 Ga0070713_100118313 3300005436 Bacteria 2320
43 Ga0070713_100355796 3300005436 Bacteria 1359
44 Ga0070711_100216314 3300005439 Bacteria 1487
45 Ga0070705_100001212 3300005440 Bacteria 13972
46 Ga0070700_100001313 3300005441 Bacteria 12331
47 Ga0070694_100003865 3300005444 Bacteria 8952
48 Ga0070678_100046577 3300005456 Bacteria 3110
49 Ga0070681_10034348 3300005458 Bacteria 5091
50 Ga0068867_100001495 3300005459 Bacteria 16179
51 Ga0070685_10008541 3300005466 Bacteria 5268
52 Ga0070679_100039433 3300005530 Bacteria 4694
53 Ga0070679_100055816 3300005530 Bacteria 3934
54 Ga0070679_100169447 3300005530 Bacteria 2156
55 Ga0070679_100221413 3300005530 Bacteria 1853
56 Ga0070684_100005932 3300005535 Bacteria 9408
57 Ga0070684_100102246 3300005535 Bacteria 2562
58 Ga0070684_100365875 3300005535 Bacteria 1327
59 Ga0068853_100000919 3300005539 Bacteria 20601
60 Ga0068853_100380224 3300005539 Bacteria 1318
61 Ga0070672_100004500 3300005543 Bacteria 9131
62 Ga0070686_100000488 3300005544 Bacteria 24002
63 Ga0070695_100046428 3300005545 Bacteria 2771
64 Ga0070696_100011190 3300005546 Bacteria 6005
65 Ga0070696_100081624 3300005546 Bacteria 2291
66 Ga0070693_100002155 3300005547 Bacteria 9028
67 Ga0070665_100055383 3300005548 Bacteria 3977
68 Ga0070704_100037444 3300005549 Bacteria 3314
69 Ga0070704_100171379 3300005549 Bacteria 1727
70 Ga0068855_100058537 3300005563 Bacteria 4512
71 Ga0070664_100002753 3300005564 Bacteria 14191
72 Ga0068857_100001539 3300005577 Bacteria 18457
73 Ga0068854_100002718 3300005578 Bacteria 10971
74 Ga0068856_100001722 3300005614 Bacteria 22877
75 Ga0068856_100034102 3300005614 Bacteria 4985
76 Ga0070702_100005389 3300005615 Bacteria 5951
77 Ga0068852_100001817 3300005616 Bacteria 14500
78 Ga0068852_100017529 3300005616 Bacteria 5621
79 Ga0068859_100010286 3300005617 Bacteria 9417
80 Ga0068859_100184370 3300005617 Bacteria 2170
81 Ga0068864_100002498 3300005618 Bacteria 15204
82 Ga0068866_10050277 3300005718 Bacteria 2116
83 Ga0068851_10002190 3300005834 Bacteria 8596
84 Ga0068870_10000676 3300005840 Bacteria 13010
85 Ga0068858_100008130 3300005842 Bacteria 10087
86 Ga0068860_100007431 3300005843 Bacteria 10959
87 Ga0081455_10007525 3300005937 Bacteria 11455
88 Ga0081455_10010928 3300005937 Bacteria 9158
89 Ga0081540_1001581 3300005983 Bacteria 19462
90 Ga0081540_1003471 3300005983 Bacteria 12440
91 Ga0081540_1005915 3300005983 Bacteria 9026
92 Ga0081540_1012461 3300005983 Bacteria 5596
93 Ga0081540_1015842 3300005983 Bacteria 4752
94 Ga0081540_1018222 3300005983 Bacteria 4316
95 Ga0081540_1021249 3300005983 Bacteria 3873
96 Ga0081540_1029698 3300005983 Bacteria 3041
97 Ga0081540_1038766 3300005983 Bacteria 2507
98 Ga0081539_10071747 3300005985 Bacteria 1853
99 Ga0075364_10180736 3300006051 Bacteria 1427
100 Ga0070715_10082869 3300006163 Bacteria 1459
101 Ga0070716_100047325 3300006173 Bacteria 2425
102 Ga0075362_10039145 3300006177 Bacteria 2084
103 Ga0075366_10067932 3300006195 Bacteria 2121
104 Ga0075366_10073217 3300006195 Bacteria 2042
105 Ga0075370_10036860 3300006353 Bacteria 2748
106 Ga0068871_100474222 3300006358 Bacteria 1125
107 Ga0075428_100011535 3300006844 Bacteria 9828
108 Ga0075433_10025232 3300006852 Bacteria 5024
109 Ga0075434_100008346 3300006871 Bacteria 9627
110 Ga0075429_100058668 3300006880 Bacteria 3352
111 Ga0075429_100060201 3300006880 Bacteria 3308
112 Ga0068865_100000452 3300006881 Bacteria 22857
113 Ga0097620_100010289 3300006931 Bacteria 9417
114 Ga0097620_100184370 3300006931 Bacteria 2170
115 Ga0099794_10001140 3300007265 Bacteria 9116
116 Ga0099795_10004330 3300007788 Bacteria 3649
117 Ga0099795_10030630 3300007788 Bacteria 1848
118 Ga0099795_10064183 3300007788 Bacteria 1370
119 Ga0105251_10036852 3300009011 Bacteria 2403
120 Ga0105240_10005557 3300009093 Bacteria 18763
121 Ga0105240_10426285 3300009093 Bacteria 1489
122 Ga0111539_10002712 3300009094 Bacteria 23487
123 Ga0111539_10050272 3300009094 Bacteria 4966
124 Ga0111539_10103863 3300009094 Bacteria 3335
125 Ga0105245_10000380 3300009098 Bacteria 41293
126 Ga0105247_10007787 3300009101 Bacteria 6553
127 Ga0105247_10018268 3300009101 Bacteria 4207
128 Ga0114129_10444827 3300009147 Bacteria 1701
129 Ga0105243_10002254 3300009148 Bacteria 16204
130 Ga0105241_10000342 3300009174 Bacteria 35383
131 Ga0105242_10000855 3300009176 Bacteria 23621
132 Ga0105248_10012394 3300009177 Bacteria 9405
133 Ga0105238_10020559 3300009551 Bacteria 6721
134 Ga0105249_10001982 3300009553 Bacteria 17778
135 Ga0099796_10001257 3300010159 Bacteria 4976
136 Ga0099796_10040397 3300010159 Bacteria 1575
137 Ga0105239_10012830 3300010375 Bacteria 9320
138 Ga0157373_10130306 3300013100 Bacteria 1769
139 Ga0157373_10150466 3300013100 Bacteria 1637
140 Ga0157371_10011566 3300013102 Bacteria 6786
141 Ga0157370_10185261 3300013104 Bacteria 1933
142 Ga0157369_10095818 3300013105 Bacteria 3166
143 Ga0157369_10432819 3300013105 Bacteria 1363
144 Ga0157369_10585536 3300013105 Bacteria 1152
145 Ga0157374_10001986 3300013296 Bacteria 17156
146 Ga0157378_10001729 3300013297 Bacteria 19618
147 Ga0163162_10012026 3300013306 Bacteria 8439
148 Ga0157372_10024601 3300013307 Bacteria 6544
149 Ga0157375_10001883 3300013308 Bacteria 18038
150 Ga0163163_10010785 3300014325 Bacteria 8246
151 Ga0157380_10034105 3300014326 Bacteria 3924
152 Ga0157377_10000643 3300014745 Bacteria 14554
153 Ga0157379_10027375 3300014968 Bacteria 5076
154 Ga0157376_10000920 3300014969 Bacteria 19113
155 Ga0163161_10000379 3300017792 Bacteria 37281
156 Ga0213876_10096403 3300021384 Bacteria 1567
157 Ga0213875_10000074 3300021388 Bacteria 118349
158 Ga0207666_1000046 3300025271 Bacteria 24194
159 Ga0207673_1000260 3300025290 Bacteria 5398
160 Ga0207697_10000714 3300025315 Bacteria 18891
161 Ga0207682_10002945 3300025893 Bacteria 7495
162 Ga0207710_10007775 3300025900 Bacteria 4538
163 Ga0207688_10000083 3300025901 Bacteria 36050
164 Ga0207680_10122670 3300025903 Bacteria 1701
165 Ga0207647_10029321 3300025904 Bacteria 3563
166 Ga0207645_10002954 3300025907 Bacteria 13126
167 Ga0207643_10000128 3300025908 Bacteria 51191
168 Ga0207654_10001559 3300025911 Bacteria 12036
169 Ga0207654_10052267 3300025911 Bacteria 2354
170 Ga0207707_10007276 3300025912 Bacteria 9637
171 Ga0207695_10264093 3300025913 Bacteria 1618
172 Ga0207671_10059503 3300025914 Bacteria 2833
173 Ga0207693_10004725 3300025915 Bacteria 11455
174 Ga0207660_10001486 3300025917 Bacteria 15770
175 Ga0207660_10003129 3300025917 Bacteria 10821
176 Ga0207660_10186500 3300025917 Bacteria 1613
177 Ga0207662_10000301 3300025918 Bacteria 22744
178 Ga0207657_10001859 3300025919 Bacteria 22810
179 Ga0207657_10003072 3300025919 Bacteria 17870
180 Ga0207649_10003562 3300025920 Bacteria 8508
181 Ga0207652_10007379 3300025921 Bacteria 8865
182 Ga0207652_10023104 3300025921 Bacteria 5150
183 Ga0207652_10047852 3300025921 Bacteria 3654
184 Ga0207652_10067763 3300025921 Bacteria 3095
185 Ga0207681_10039680 3300025923 Bacteria 3127
186 Ga0207694_10048895 3300025924 Bacteria 3273
187 Ga0207650_10015442 3300025925 Bacteria 5318
188 Ga0207650_10443922 3300025925 Unclassified 1079
189 Ga0207659_10000142 3300025926 Bacteria 42302
190 Ga0207687_10000667 3300025927 Bacteria 23099
191 Ga0207664_10304599 3300025929 Bacteria 1402
192 Ga0207664_10407418 3300025929 Bacteria 1210
193 Ga0207644_10005279 3300025931 Bacteria 8432
194 Ga0207690_10002854 3300025932 Bacteria 10412
195 Ga0207690_10169421 3300025932 Bacteria 1635
196 Ga0207706_10004082 3300025933 Bacteria 13792
197 Ga0207686_10000579 3300025934 Bacteria 22963
198 Ga0207709_10000551 3300025935 Bacteria 32038
199 Ga0207670_10000556 3300025936 Bacteria 20667
200 Ga0207669_10000675 3300025937 Bacteria 14703
201 Ga0207665_10046601 3300025939 Bacteria 2904
202 Ga0207665_10144576 3300025939 Bacteria 1698
203 Ga0207691_10000599 3300025940 Bacteria 35997
204 Ga0207689_10000165 3300025942 Bacteria 57494
205 Ga0207661_10000744 3300025944 Bacteria 21117
206 Ga0207679_10000112 3300025945 Bacteria 65716
207 Ga0207667_10230191 3300025949 Bacteria 1898
208 Ga0207667_10398860 3300025949 Bacteria 1401
209 Ga0207667_10661937 3300025949 Bacteria 1049
210 Ga0207651_10000099 3300025960 Bacteria 38059
211 Ga0207712_10003302 3300025961 Bacteria 10231
212 Ga0207668_10144131 3300025972 Bacteria 1835
213 Ga0207640_10000320 3300025981 Bacteria 32131
214 Ga0207703_10014270 3300026035 Bacteria 6196
215 Ga0207639_10002883 3300026041 Bacteria 11555
216 Ga0207678_10001329 3300026067 Bacteria 22814
217 Ga0207708_10000862 3300026075 Bacteria 22870
218 Ga0207641_10001462 3300026088 Bacteria 23160
219 Ga0207648_10001891 3300026089 Bacteria 22870
220 Ga0207676_10001459 3300026095 Bacteria 17574
221 Ga0207674_10006899 3300026116 Bacteria 13310
222 Ga0207674_10393574 3300026116 Bacteria 1339
223 Ga0207675_100001575 3300026118 Bacteria 22801
224 Ga0207683_10001273 3300026121 Bacteria 22829
225 Ga0207683_10107760 3300026121 Bacteria 2493
226 Ga0207698_10396613 3300026142 Bacteria 1317
227 Ga0209588_1003420 3300027671 Bacteria 4407
228 Ga0209998_10009034 3300027717 Bacteria 2064
229 Ga0209974_10000708 3300027876 Bacteria 11387
230 Ga0207428_10000064 3300027907 Bacteria 151185
231 Ga0207428_10007064 3300027907 Bacteria 10281
232 Ga0268266_10040521 3300028379 Bacteria 3970
233 Ga0268265_10003386 3300028380 Bacteria 11479
234 Ga0268264_10003086 3300028381 Bacteria 14418
235 Ga0307517_10128300 3300028786 Bacteria 1839
236 Ga0307511_10081159 3300030521 Bacteria 2279
237 Ga0265325_10018825 3300031241 Bacteria 3827
238 Ga0307509_10072301 3300031507 Bacteria 3593
239 Ga0307509_10082839 3300031507 Bacteria 3308
240 Ga0265313_10000183 3300031595 Bacteria 66629
241 Ga0307508_10000003 3300031616 Bacteria 321602
242 Ga0265314_10000577 3300031711 Bacteria 46408
243 Ga0265342_10005221 3300031712 Bacteria 9970
244 Ga0307516_10003289 3300031730 Bacteria 20915
245 Ga0307516_10009900 3300031730 Bacteria 10566
246 Ga0307516_10023333 3300031730 Bacteria 6344
247 Ga0307507_10023941 3300033179 Bacteria 6678
248 Ga0307510_10018034 3300033180 Bacteria 8317
249 Ga0307510_10188073 3300033180 Unclassified 1617
250 Ga0373930_0006202 3300034816 Bacteria 2013
251 Ga0373948_0016849 3300034817 Bacteria 1355
252 Ga0373950_0021004 3300034818 Bacteria 1152
253 Ga0373950_0024155 3300034818 Bacteria 1091
254 Ga0373958_0001446 3300034819 Bacteria 3198
255 Ga0373938_0031072 3300034957 Bacteria 1143
256 Ga0373928_0003314 3300035084 Bacteria 3083
257 Ga0373934_0033966 3300035086 Bacteria 2004
258 Ga0373944_0005363 3300035089 Bacteria 3374
259 Ga0373949_0001191 3300035090 Bacteria 7712
260 Ga0373923_0016159 3300035111 Bacteria 2829
261 Ga0373923_0042573 3300035111 Bacteria 1876
262 Ga0373939_0003074 3300035114 Bacteria 3920
263 Ga0373941_0001129 3300035115 Bacteria 5569
264 Ga0373954_0000584 3300035118 Bacteria 13828
265 Ga0373954_0116940 3300035118 Bacteria 1293
266 Ga0373956_0002897 3300035119 Bacteria 6946
267 Ga0373957_0007168 3300035120 Bacteria 3555
268 Ga0373960_0001925 3300035121 Bacteria 4651
269 Ga0373943_0011057 3300035170 Bacteria 4054
270 Ga0373946_0153969 3300035171 Bacteria 1074
271 Ga0373955_0012385 3300035172 Bacteria 4098
272 Ga0373942_0001663 3300035207 Bacteria 5643
273 Ga0373961_0009354 3300035241 Bacteria 2398
274 Ga0373962_0003305 3300035242 Bacteria 3877
275 Ga0373935_0005223 3300035692 Bacteria 7647
276 Ga0373935_0040393 3300035692 Bacteria 2928
277 Ga0373935_0170569 3300035692 Bacteria 1488
278 Ga0373927_0007448 3300035695 Bacteria 7404
279 Ga0373927_0010805 3300035695 Bacteria 6083
280 Ga0373927_0012964 3300035695 Bacteria 5544
281 Ga0373927_0086550 3300035695 Bacteria 2034
282 Ga0373933_0019974 3300035724 Bacteria 3792
283 Ga0373933_0264223 3300035724 Bacteria 1110
284 Ga0373947_0037818 3300035725 Bacteria 2865
285 Ga0373937_0003318 3300036401 Bacteria 13517
286 Ga0373937_0014040 3300036401 Bacteria 7063
287 Ga0373937_0019535 3300036401 Bacteria 6063
288 Ga0373937_0058829 3300036401 Bacteria 3531
289 Ga0373925_0014183 3300037068 Bacteria 5766
290 Ga0373925_0040564 3300037068 Bacteria 3447
291 Ga0373925_0118423 3300037068 Bacteria 2053
292 Ga0395899_0054057 3300037312 Bacteria 2972
293 Ga0395900_0001761 3300037418 Bacteria 24849
294 Ga0395900_0054321 3300037418 Bacteria 4124
295 Ga0395900_0215484 3300037418 Bacteria 1938
296 Ga0395900_0377578 3300037418 Bacteria 1386
297 Ga0395898_0011123 3300037466 Bacteria 9369
298 Ga0395898_0038411 3300037466 Bacteria 4745
299 Ga0395898_0082048 3300037466 Bacteria 3108
300 Ga0395905_0006436 3300037471 Bacteria 11822
301 Ga0395905_0010549 3300037471 Bacteria 8973
302 Ga0395905_0023632 3300037471 Bacteria 5804
303 Ga0395905_0040113 3300037471 Bacteria 4392
304 Ga0436364_0090740 3300037853 Bacteria 19290
305 Ga0395901_0008259 3300038443 Bacteria 10518
306 Ga0395901_0017527 3300038443 Bacteria 7310
307 Ga0395901_0026202 3300038443 Bacteria 5985
308 Ga0436365_1057834 3300039437 Bacteria 10797
309 Ga0436365_1840295 3300039437 Bacteria 4566
310 Ga0436360_0643628 3300039438 Bacteria 1637
311 Ga0436362_0590305 3300039453 Bacteria 2001
312 Ga0439441_009775 3300042001 Unclassified 1596
313 Ga0439441_010504 3300042001 Bacteria 1554
314 Ga0439462_0023976 3300042015 Bacteria 1600
315 Ga0466966_0060336 3300044684 Bacteria 2394
316 Ga0466961_0177773 3300044693 Bacteria 1322
317 Ga0466963_0058327 3300044694 Bacteria 2574
318 Ga0466963_0244105 3300044694 Bacteria 1260
319 Ga0466958_0029379 3300045836 Bacteria 3262
320 Ga0495617_019606 3300046452 Bacteria 2287
321 Ga0495592_0017995 3300046454 Bacteria 5368
322 Ga0495592_0040377 3300046454 Bacteria 3502
323 Ga0495592_0050242 3300046454 Bacteria 3098
324 Ga0495603_0000330 3300046455 Bacteria 25593
325 Ga0495603_0005314 3300046455 Bacteria 7681
326 Ga0495603_0054895 3300046455 Bacteria 2361
327 Ga0495603_0092736 3300046455 Bacteria 1765
328 Ga0495590_0001091 3300046457 Bacteria 11939
329 Ga0495629_0000360 3300046459 Bacteria 38561
330 Ga0495629_0002194 3300046459 Bacteria 15062
331 Ga0495629_0039597 3300046459 Bacteria 3316
332 Ga0495638_0001509 3300046460 Bacteria 20944
333 Ga0495638_0022139 3300046460 Bacteria 4175
334 Ga0495641_0005597 3300046461 Bacteria 8413
335 Ga0495651_0001419 3300046462 Bacteria 18593
336 Ga0495651_0018674 3300046462 Bacteria 5372
337 Ga0495653_0002720 3300046463 Bacteria 14082
338 Ga0495653_0061303 3300046463 Bacteria 2846
339 Ga0495580_0001688 3300046472 Bacteria 19386
340 Ga0495580_0048851 3300046472 Bacteria 2993
341 Ga0495582_0000214 3300046473 Bacteria 32147
342 Ga0495639_0000015 3300046475 Bacteria 80742
343 Ga0495662_0004450 3300046476 Bacteria 7039
344 Ga0495664_0006096 3300046477 Bacteria 6653
345 Ga0495664_0016059 3300046477 Bacteria 4264
346 Ga0495584_0006973 3300046491 Bacteria 5902
347 Ga0495585_0013737 3300046492 Bacteria 4731
348 Ga0495594_0001132 3300046499 Bacteria 13911
349 Ga0495607_0023605 3300046501 Bacteria 3847
350 Ga0495608_0002889 3300046511 Bacteria 12309
351 Ga0495618_0037363 3300046514 Bacteria 3049
352 Ga0495618_0085006 3300046514 Bacteria 2022
353 Ga0495618_0147532 3300046514 Bacteria 1503
354 Ga0495628_0005140 3300046516 Bacteria 11501
355 Ga0495628_0049598 3300046516 Bacteria 3324
356 Ga0495666_0034357 3300046526 Bacteria 2475
357 Ga0495652_0022735 3300046529 Bacteria 5564
358 Ga0495652_0025881 3300046529 Bacteria 5184
359 Ga0495652_0026618 3300046529 Bacteria 5106
360 Ga0495665_0030800 3300046531 Bacteria 2870
361 Ga0495665_0067466 3300046531 Bacteria 1887
362 Ga0495640_0005334 3300046533 Bacteria 10222
363 Ga0495640_0012625 3300046533 Bacteria 6448
364 Ga0495587_0022631 3300046536 Bacteria 3868
365 Ga0495645_0016180 3300046543 Bacteria 5319
366 Ga0495622_0002296 3300046557 Bacteria 9301
367 Ga0495622_0084162 3300046557 Unclassified 1463
368 Ga0495633_0002471 3300046558 Bacteria 13043
369 Ga0495667_0066680 3300046559 Bacteria 2352
370 Ga0495656_0038771 3300046615 Bacteria 1975
371 Ga0495634_0000395 3300046642 Bacteria 42803
372 Ga0495634_0053495 3300046642 Bacteria 2704
373 Ga0495611_0003355 3300046648 Bacteria 7069
374 Ga0495635_0001940 3300046663 Bacteria 14058
375 Ga0495635_0004397 3300046663 Bacteria 9763
376 Ga0495588_0016953 3300046674 Bacteria 3529
377 Ga0495599_0012882 3300046678 Bacteria 5161
378 Ga0495623_0011556 3300046679 Bacteria 5715
379 Ga0495646_0015943 3300046680 Bacteria 4769
380 Ga0495647_0004081 3300046681 Bacteria 4719
381 Ga0495647_0006287 3300046681 Bacteria 3925
382 Ga0495658_0000342 3300046683 Bacteria 26121
383 Ga0495658_0034320 3300046683 Bacteria 2783
384 Ga0495669_0017715 3300046684 Bacteria 3059
385 Ga0495624_0004344 3300046690 Bacteria 10397
386 Ga0495670_0000506 3300046691 Bacteria 18484
387 Ga0495600_0002710 3300046809 Bacteria 10246
388 Ga0495600_0033194 3300046809 Bacteria 3350
389 Ga0495660_0026829 3300046810 Bacteria 3261
390 Ga0495581_0000341 3300047315 Bacteria 23276
391 Ga0495581_0062151 3300047315 Bacteria 2157
392 Ga0495604_0039197 3300047317 Bacteria 3724
393 Ga0495604_0124156 3300047317 Bacteria 1864
394 Ga0495674_0000557 3300047319 Bacteria 34594
395 Ga0495676_0140072 3300047321 Bacteria 1734
396 Ga0495680_0026905 3300047322 Bacteria 4734
397 Ga0495680_0036768 3300047322 Bacteria 3927
398 Ga0495675_0004080 3300047444 Bacteria 8846
399 Ga0495684_0003481 3300047471 Bacteria 12321
400 Ga0495593_0000506 3300047673 Bacteria 22030
401 Ga0495593_0008924 3300047673 Bacteria 5819
402 Ga0495602_0140416 3300048088 Bacteria 1913
403 Ga0496100_0025612 3300048903 Bacteria 3609
404 Ga0496101_0192699 3300048904 Bacteria 1573
405 Ga0496102_0002938 3300048905 Bacteria 14454
406 Ga0496103_0077578 3300048906 Bacteria 2085
407 Ga0496104_0066997 3300048907 Bacteria 3410
408 Ga0496105_0328864 3300048908 Bacteria 1224
409 Ga0496106_0005045 3300048909 Bacteria 9767
410 Ga0496106_0084266 3300048909 Bacteria 2445
411 Ga0496109_0000526 3300048912 Bacteria 32410
412 Ga0496110_0061140 3300048913 Bacteria 3324
413 Ga0496113_0006619 3300048916 Bacteria 7370
414 Ga0496114_0017211 3300048917 Bacteria 5831
415 Ga0496115_0017888 3300048918 Bacteria 5429
416 Ga0496118_0010928 3300048921 Bacteria 8928
417 Ga0496121_0003152 3300048924 Bacteria 23785
418 Ga0496124_0055132 3300048927 Bacteria 3361
419 Ga0496125_0057140 3300048928 Bacteria 3163
420 Ga0501292_000864 3300049515 Bacteria 3675
421 Ga0501297_004421 3300049520 Bacteria 1439
422 Ga0501033_0045452 3300049570 Bacteria 3268
423 Ga0501037_0075080 3300049573 Bacteria 2456
424 Ga0501037_0110159 3300049573 Bacteria 1984
425 Ga0501038_0017412 3300049574 Bacteria 6495
426 Ga0501039_0033014 3300049575 Bacteria 3993
427 Ga0501043_0051850 3300049579 Bacteria 3224
428 Ga0501046_0112657 3300049580 Bacteria 2077
429 Ga0501047_0054534 3300049581 Bacteria 3866
430 Ga0501069_0001498 3300049585 Bacteria 11535
431 Ga0501070_0003380 3300049586 Bacteria 13841
432 Ga0501070_0089757 3300049586 Bacteria 2543
433 Ga0501072_0076043 3300049588 Bacteria 2656
434 Ga0501076_0025564 3300049592 Bacteria 4571
435 Ga0501077_0037920 3300049593 Bacteria 3069
436 Ga0501206_001805 3300049653 Bacteria 2689
437 Ga0501080_0121335 3300049742 Bacteria 2422
438 Ga0501080_0437240 3300049742 Bacteria 1174
439 Ga0501035_0043346 3300049822 Bacteria 4055
440 Ga0501044_0008608 3300049823 Bacteria 11172
441 nmdc:mga0yw44_52348_c1 3300050492 Bacteria 1560
442 nmdc:mga07m45_104347_c1 3300050496 Bacteria 1630
443 nmdc:mga05p37_297643_c1 3300050507 Bacteria 1918
444 nmdc:mga05p37_306435_c1 3300050507 Bacteria 1884
445 nmdc:mga09592_45218_c1 3300050508 Bacteria 3708
446 nmdc:mga09592_59208_c1 3300050508 Bacteria 3238
447 nmdc:mga08y16_13657_c1 3300050511 Bacteria 8551
448 nmdc:mga08y16_160037_c1 3300050511 Bacteria 2339
449 nmdc:mga0n895_230371_c1 3300050512 Bacteria 1880
450 nmdc:mga0n895_35890_c1 3300050512 Bacteria 4784
451 nmdc:mga0a205_267834_c1 3300050515 Bacteria 1586
452 Ga0495601_0014495 3300053077 Bacteria 4751
453 Ga0495601_0042533 3300053077 Bacteria 2850
454 Ga0495612_0004598 3300053078 Bacteria 5719
455 Ga0495595_0002007 3300053084 Bacteria 7907
456 Ga0495595_0003084 3300053084 Bacteria 6589
457 Ga0495595_0122718 3300053084 Bacteria 1266
458 Ga0495619_0004943 3300053085 Bacteria 8466
459 Ga0495619_0005997 3300053085 Bacteria 7693
460 Ga0495619_0267305 3300053085 Bacteria 1185
461 Ga0500643_022872 3300053087 Bacteria 2005
462 Ga0500644_0000369 3300053088 Bacteria 22061
463 Ga0500651_0006191 3300053093 Bacteria 6878
464 Ga0500554_000492 3300053102 Bacteria 8231
465 Ga0500562_024810 3300053108 Bacteria 1568
466 Ga0500593_000200 3300053117 Bacteria 24380
467 Ga0500593_001572 3300053117 Bacteria 8219
468 Ga0500595_000029 3300053119 Bacteria 122318
469 Ga0500559_0006508 3300053136 Bacteria 5272
470 Ga0500603_002062 3300053150 Bacteria 4442
471 Ga0500616_0000006 3300053153 Bacteria 944738
472 Ga0500627_0084056 3300053158 Bacteria 1421
473 Ga0500638_135957 3300053162 Bacteria 1109
474 Ga0500636_0119783 3300053177 Bacteria 1477
475 Ga0500636_0139240 3300053177 Bacteria 1344
476 Ga0500637_0012749 3300053178 Bacteria 4388
477 Ga0500645_000143 3300053730 Bacteria 56081
478 Ga0500596_001432 3300053735 Bacteria 4828
479 Ga0466962_0031493 3300061719 Bacteria 2539
480 Ga0530510_0379192 3300061734 Bacteria 1064

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10000074 Ga0213875_1000007438 262
2 3300037853 Ga0436364_0090740 Ga0436364_0090740_7253_8044 262
3 3300025939 Ga0207665_10144576 Ga0207665_101445762 268
4 3300050507 nmdc:mga05p37_306435_c1 nmdc:mga05p37_306435_c1_958_1860 290
5 3300034817 Ga0373948_0016849 Ga0373948_0016849_421_1302 293
6 3300034818 Ga0373950_0021004 Ga0373950_0021004_48_929 293
7 3300006195 Ga0075366_10073217 Ga0075366_100732172 298
8 3300042001 Ga0439441_010504 Ga0439441_010504_117_1076 300
9 3300034818 Ga0373950_0024155 Ga0373950_0024155_85_1056 301
10 3300049515 Ga0501292_000864 Ga0501292_000864_1660_2619 301
11 3300049520 Ga0501297_004421 Ga0501297_004421_84_1043 301
12 3300049653 Ga0501206_001805 Ga0501206_001805_1479_2438 301
13 3300046460 Ga0495638_0022139 Ga0495638_0022139_110_1087 303
14 3300053093 Ga0500651_0006191 Ga0500651_0006191_2112_3089 303
15 3300053119 Ga0500595_000029 Ga0500595_000029_92968_93945 303
16 3300009551 Ga0105238_10020559 Ga0105238_100205594 304
17 3300025924 Ga0207694_10048895 Ga0207694_100488952 304
18 3300026121 Ga0207683_10107760 Ga0207683_101077602 304
19 3300039438 Ga0436360_0643628 Ga0436360_0643628_138_1067 304
20 3300053153 Ga0500616_0000006 Ga0500616_0000006_208113_209156 304
21 3300005327 Ga0070658_10007426 Ga0070658_100074265 305
22 3300028786 Ga0307517_10128300 Ga0307517_101283002 307
23 3300031730 Ga0307516_10003289 Ga0307516_100032892 307
24 3300046514 Ga0495618_0037363 Ga0495618_0037363_1424_2350 308
25 3300037471 Ga0395905_0040113 Ga0395905_0040113_2994_3941 312
26 3300049585 Ga0501069_0001498 Ga0501069_0001498_289_1254 312
27 3300049586 Ga0501070_0089757 Ga0501070_0089757_1525_2490 312
28 3300053087 Ga0500643_022872 Ga0500643_022872_68_1129 312
29 3300005617 Ga0068859_100184370 Ga0068859_1001843702 313
30 3300006844 Ga0075428_100011535 Ga0075428_1000115355 313
31 3300006880 Ga0075429_100060201 Ga0075429_1000602013 313
32 3300006931 Ga0097620_100184370 Ga0097620_1001843702 313
33 3300009094 Ga0111539_10050272 Ga0111539_100502722 313
34 3300009094 Ga0111539_10103863 Ga0111539_101038634 313
35 3300027907 Ga0207428_10007064 Ga0207428_100070645 313
36 3300031711 Ga0265314_10000577 Ga0265314_1000057745 313
37 3300050508 nmdc:mga09592_45218_c1 nmdc:mga09592_45218_c1_1856_2821 313
38 3300050511 nmdc:mga08y16_13657_c1 nmdc:mga08y16_13657_c1_3427_4392 313
39 3300053084 Ga0495595_0122718 Ga0495595_0122718_142_1083 313
40 3300053085 Ga0495619_0267305 Ga0495619_0267305_21_962 313
41 3300005295 Ga0065707_10120544 Ga0065707_101205442 314
42 3300007265 Ga0099794_10001140 Ga0099794_100011402 314
43 3300007788 Ga0099795_10004330 Ga0099795_100043303 314
44 3300007788 Ga0099795_10030630 Ga0099795_100306302 314
45 3300007788 Ga0099795_10064183 Ga0099795_100641832 314
46 3300010159 Ga0099796_10001257 Ga0099796_100012572 314
47 3300025925 Ga0207650_10443922 Ga0207650_104439221 314
48 3300042001 Ga0439441_009775 Ga0439441_009775_518_1486 314
49 3300050512 nmdc:mga0n895_230371_c1 nmdc:mga0n895_230371_c1_225_1169 314
50 3300006871 Ga0075434_100008346 Ga0075434_10000834610 315
51 3300026116 Ga0207674_10393574 Ga0207674_103935741 315
52 3300050512 nmdc:mga0n895_35890_c1 nmdc:mga0n895_35890_c1_394_1374 315
53 3300053088 Ga0500644_0000369 Ga0500644_0000369_10034_11011 315
54 3300053730 Ga0500645_000143 Ga0500645_000143_18865_19836 315
55 3300003322 rootL2_10140712 rootL2_101407121 316
56 3300003322 rootL2_10156181 rootL2_101561813 316
57 3300005546 Ga0070696_100081624 Ga0070696_1000816243 316
58 3300005549 Ga0070704_100171379 Ga0070704_1001713791 316
59 3300005983 Ga0081540_1003471 Ga0081540_10034719 316
60 3300006177 Ga0075362_10039145 Ga0075362_100391451 316
61 3300026142 Ga0207698_10396613 Ga0207698_103966132 316
62 3300037418 Ga0395900_0215484 Ga0395900_0215484_358_1320 316
63 3300037471 Ga0395905_0023632 Ga0395905_0023632_3300_4262 316
64 3300038443 Ga0395901_0017527 Ga0395901_0017527_4511_5473 316
65 3300042015 Ga0439462_0023976 Ga0439462_0023976_161_1120 316
66 3300050511 nmdc:mga08y16_160037_c1 nmdc:mga08y16_160037_c1_517_1518 316
67 3300053117 Ga0500593_000200 Ga0500593_000200_15929_16888 316
68 3300053158 Ga0500627_0084056 Ga0500627_0084056_182_1141 316
69 3300005329 Ga0070683_100131057 Ga0070683_1001310572 317
70 3300005336 Ga0070680_100110307 Ga0070680_1001103071 317
71 3300005535 Ga0070684_100365875 Ga0070684_1003658751 317
72 3300006173 Ga0070716_100047325 Ga0070716_1000473252 317
73 3300006195 Ga0075366_10067932 Ga0075366_100679322 317
74 3300006880 Ga0075429_100058668 Ga0075429_1000586682 317
75 3300009093 Ga0105240_10426285 Ga0105240_104262851 317
76 3300013100 Ga0157373_10150466 Ga0157373_101504662 317
77 3300013104 Ga0157370_10185261 Ga0157370_101852612 317
78 3300013105 Ga0157369_10432819 Ga0157369_104328191 317
79 3300025911 Ga0207654_10052267 Ga0207654_100522672 317
80 3300025913 Ga0207695_10264093 Ga0207695_102640932 317
81 3300025915 Ga0207693_10004725 Ga0207693_1000472510 317
82 3300025917 Ga0207660_10186500 Ga0207660_101865001 317
83 3300025929 Ga0207664_10304599 Ga0207664_103045991 317
84 3300025939 Ga0207665_10046601 Ga0207665_100466012 317
85 3300031595 Ga0265313_10000183 Ga0265313_1000018348 317
86 3300035086 Ga0373934_0033966 Ga0373934_0033966_115_1092 317
87 3300035692 Ga0373935_0170569 Ga0373935_0170569_231_1208 317
88 3300036401 Ga0373937_0003318 Ga0373937_0003318_8745_9722 317
89 3300037471 Ga0395905_0010549 Ga0395905_0010549_4565_5536 317
90 3300044684 Ga0466966_0060336 Ga0466966_0060336_21_980 317
91 3300046457 Ga0495590_0001091 Ga0495590_0001091_4047_5018 317
92 3300046810 Ga0495660_0026829 Ga0495660_0026829_680_1651 317
93 3300049570 Ga0501033_0045452 Ga0501033_0045452_2160_3131 317
94 3300049573 Ga0501037_0110159 Ga0501037_0110159_769_1740 317
95 3300049574 Ga0501038_0017412 Ga0501038_0017412_4118_5089 317
96 3300049579 Ga0501043_0051850 Ga0501043_0051850_2237_3208 317
97 3300049580 Ga0501046_0112657 Ga0501046_0112657_32_1003 317
98 3300049581 Ga0501047_0054534 Ga0501047_0054534_1278_2249 317
99 3300049586 Ga0501070_0003380 Ga0501070_0003380_11686_12657 317
100 3300049742 Ga0501080_0121335 Ga0501080_0121335_1185_2156 317
101 3300049822 Ga0501035_0043346 Ga0501035_0043346_2356_3327 317
102 3300049823 Ga0501044_0008608 Ga0501044_0008608_4326_5297 317
103 3300053117 Ga0500593_001572 Ga0500593_001572_5643_6647 317
104 3300061734 Ga0530510_0379192 Ga0530510_0379192_16_987 317
105 iso_pu_bacteria 2643221599 2644008058 317
106 iso_pu_bacteria 2738541293 2738802969 317
107 3300044694 Ga0466963_0058327 Ga0466963_0058327_1086_2066 318
108 3300005354 Ga0070675_100362631 Ga0070675_1003626311 319
109 3300005834 Ga0068851_10002190 Ga0068851_100021906 319
110 3300031730 Ga0307516_10023333 Ga0307516_100233334 319
111 3300035118 Ga0373954_0116940 Ga0373954_0116940_166_1125 319
112 3300035170 Ga0373943_0011057 Ga0373943_0011057_376_1335 319
113 3300035692 Ga0373935_0005223 Ga0373935_0005223_1740_2699 319
114 3300035695 Ga0373927_0007448 Ga0373927_0007448_391_1350 319
115 3300035724 Ga0373933_0264223 Ga0373933_0264223_141_1100 319
116 3300036401 Ga0373937_0058829 Ga0373937_0058829_252_1211 319
117 3300037068 Ga0373925_0014183 Ga0373925_0014183_2942_3901 319
118 3300046454 Ga0495592_0040377 Ga0495592_0040377_202_1161 319
119 3300046455 Ga0495603_0000330 Ga0495603_0000330_20767_21726 319
120 3300046459 Ga0495629_0000360 Ga0495629_0000360_20488_21447 319
121 3300046461 Ga0495641_0005597 Ga0495641_0005597_3600_4559 319
122 3300046472 Ga0495580_0001688 Ga0495580_0001688_7895_8854 319
123 3300046473 Ga0495582_0000214 Ga0495582_0000214_17412_18371 319
124 3300046475 Ga0495639_0000015 Ga0495639_0000015_70299_71258 319
125 3300046476 Ga0495662_0004450 Ga0495662_0004450_3871_4830 319
126 3300046477 Ga0495664_0016059 Ga0495664_0016059_3072_4031 319
127 3300046499 Ga0495594_0001132 Ga0495594_0001132_8447_9406 319
128 3300046514 Ga0495618_0085006 Ga0495618_0085006_1012_1971 319
129 3300046516 Ga0495628_0049598 Ga0495628_0049598_355_1314 319
130 3300046526 Ga0495666_0034357 Ga0495666_0034357_872_1831 319
131 3300046529 Ga0495652_0022735 Ga0495652_0022735_274_1233 319
132 3300046531 Ga0495665_0067466 Ga0495665_0067466_750_1709 319
133 3300046557 Ga0495622_0002296 Ga0495622_0002296_3512_4471 319
134 3300046642 Ga0495634_0000395 Ga0495634_0000395_20975_21934 319
135 3300046663 Ga0495635_0004397 Ga0495635_0004397_7182_8141 319
136 3300046681 Ga0495647_0004081 Ga0495647_0004081_3639_4598 319
137 3300046683 Ga0495658_0000342 Ga0495658_0000342_17526_18485 319
138 3300046690 Ga0495624_0004344 Ga0495624_0004344_7095_8054 319
139 3300047315 Ga0495581_0000341 Ga0495581_0000341_15218_16177 319
140 3300047319 Ga0495674_0000557 Ga0495674_0000557_18247_19206 319
141 3300047673 Ga0495593_0000506 Ga0495593_0000506_5818_6777 319
142 3300049573 Ga0501037_0075080 Ga0501037_0075080_1450_2442 319
143 3300049742 Ga0501080_0437240 Ga0501080_0437240_76_1068 319
144 3300050508 nmdc:mga09592_59208_c1 nmdc:mga09592_59208_c1_513_1523 319
145 3300005336 Ga0070680_100098670 Ga0070680_1000986702 320
146 3300005366 Ga0070659_100210918 Ga0070659_1002109181 320
147 3300005530 Ga0070679_100221413 Ga0070679_1002214132 320
148 3300005535 Ga0070684_100102246 Ga0070684_1001022462 320
149 3300005539 Ga0068853_100380224 Ga0068853_1003802241 320
150 3300006358 Ga0068871_100474222 Ga0068871_1004742221 320
151 3300009093 Ga0105240_10005557 Ga0105240_1000555719 320
152 3300009101 Ga0105247_10018268 Ga0105247_100182684 320
153 3300013105 Ga0157369_10095818 Ga0157369_100958181 320
154 3300025912 Ga0207707_10007276 Ga0207707_100072761 320
155 3300025914 Ga0207671_10059503 Ga0207671_100595031 320
156 3300025917 Ga0207660_10003129 Ga0207660_100031292 320
157 3300025919 Ga0207657_10003072 Ga0207657_1000307210 320
158 3300025921 Ga0207652_10007379 Ga0207652_1000737910 320
159 3300025932 Ga0207690_10169421 Ga0207690_101694212 320
160 3300025949 Ga0207667_10230191 Ga0207667_102301911 320
161 3300030521 Ga0307511_10081159 Ga0307511_100811592 320
162 3300031507 Ga0307509_10072301 Ga0307509_100723013 320
163 3300031507 Ga0307509_10082839 Ga0307509_100828393 320
164 3300031730 Ga0307516_10009900 Ga0307516_100099007 320
165 3300033179 Ga0307507_10023941 Ga0307507_100239414 320
166 3300033180 Ga0307510_10188073 Ga0307510_101880733 320
167 3300035089 Ga0373944_0005363 Ga0373944_0005363_106_1068 320
168 3300035111 Ga0373923_0016159 Ga0373923_0016159_211_1173 320
169 3300035692 Ga0373935_0040393 Ga0373935_0040393_1599_2603 320
170 3300035695 Ga0373927_0012964 Ga0373927_0012964_1101_2063 320
171 3300036401 Ga0373937_0019535 Ga0373937_0019535_4498_5460 320
172 3300037068 Ga0373925_0040564 Ga0373925_0040564_482_1486 320
173 3300037068 Ga0373925_0118423 Ga0373925_0118423_1018_1980 320
174 3300037471 Ga0395905_0006436 Ga0395905_0006436_2367_3344 320
175 3300039437 Ga0436365_1057834 Ga0436365_1057834_2876_3862 320
176 3300039453 Ga0436362_0590305 Ga0436362_0590305_571_1557 320
177 3300044694 Ga0466963_0244105 Ga0466963_0244105_253_1242 320
178 3300046452 Ga0495617_019606 Ga0495617_019606_500_1462 320
179 3300046454 Ga0495592_0050242 Ga0495592_0050242_1301_2263 320
180 3300046455 Ga0495603_0005314 Ga0495603_0005314_465_1427 320
181 3300046459 Ga0495629_0039597 Ga0495629_0039597_672_1634 320
182 3300046462 Ga0495651_0001419 Ga0495651_0001419_17399_18361 320
183 3300046463 Ga0495653_0002720 Ga0495653_0002720_13086_14048 320
184 3300046472 Ga0495580_0048851 Ga0495580_0048851_1571_2533 320
185 3300046477 Ga0495664_0006096 Ga0495664_0006096_4702_5664 320
186 3300046491 Ga0495584_0006973 Ga0495584_0006973_873_1835 320
187 3300046492 Ga0495585_0013737 Ga0495585_0013737_2489_3451 320
188 3300046501 Ga0495607_0023605 Ga0495607_0023605_2198_3160 320
189 3300046529 Ga0495652_0026618 Ga0495652_0026618_2265_3227 320
190 3300046531 Ga0495665_0030800 Ga0495665_0030800_336_1298 320
191 3300046533 Ga0495640_0005334 Ga0495640_0005334_4881_5843 320
192 3300046557 Ga0495622_0084162 Ga0495622_0084162_244_1248 320
193 3300046558 Ga0495633_0002471 Ga0495633_0002471_10270_11232 320
194 3300046615 Ga0495656_0038771 Ga0495656_0038771_374_1336 320
195 3300046648 Ga0495611_0003355 Ga0495611_0003355_313_1275 320
196 3300046674 Ga0495588_0016953 Ga0495588_0016953_2124_3086 320
197 3300046681 Ga0495647_0006287 Ga0495647_0006287_1855_2817 320
198 3300046683 Ga0495658_0034320 Ga0495658_0034320_266_1228 320
199 3300046684 Ga0495669_0017715 Ga0495669_0017715_421_1383 320
200 3300046691 Ga0495670_0000506 Ga0495670_0000506_16114_17076 320
201 3300046809 Ga0495600_0002710 Ga0495600_0002710_7483_8445 320
202 3300047315 Ga0495581_0062151 Ga0495581_0062151_505_1467 320
203 3300047317 Ga0495604_0039197 Ga0495604_0039197_804_1766 320
204 3300047321 Ga0495676_0140072 Ga0495676_0140072_99_1061 320
205 3300047322 Ga0495680_0026905 Ga0495680_0026905_688_1650 320
206 3300048088 Ga0495602_0140416 Ga0495602_0140416_148_1110 320
207 3300048909 Ga0496106_0005045 Ga0496106_0005045_3546_4550 320
208 3300048921 Ga0496118_0010928 Ga0496118_0010928_2901_3905 320
209 3300048924 Ga0496121_0003152 Ga0496121_0003152_21789_22793 320
210 3300048927 Ga0496124_0055132 Ga0496124_0055132_368_1372 320
211 3300048928 Ga0496125_0057140 Ga0496125_0057140_1144_2148 320
212 3300053077 Ga0495601_0042533 Ga0495601_0042533_715_1677 320
213 3300053078 Ga0495612_0004598 Ga0495612_0004598_1637_2599 320
214 3300053084 Ga0495595_0003084 Ga0495595_0003084_2129_3091 320
215 3300053085 Ga0495619_0005997 Ga0495619_0005997_4930_5892 320
216 3300053136 Ga0500559_0006508 Ga0500559_0006508_3200_4204 320
217 3300053162 Ga0500638_135957 Ga0500638_135957_17_1021 320
218 3300053177 Ga0500636_0119783 Ga0500636_0119783_309_1313 320
219 3300053177 Ga0500636_0139240 Ga0500636_0139240_133_1137 320
220 3300053735 Ga0500596_001432 Ga0500596_001432_2756_3760 320
221 3300005339 Ga0070660_100089523 Ga0070660_1000895232 321
222 3300005436 Ga0070713_100355796 Ga0070713_1003557962 321
223 3300005530 Ga0070679_100055816 Ga0070679_1000558165 321
224 3300005563 Ga0068855_100058537 Ga0068855_1000585374 321
225 3300005614 Ga0068856_100034102 Ga0068856_1000341022 321
226 3300005616 Ga0068852_100017529 Ga0068852_1000175293 321
227 3300013105 Ga0157369_10585536 Ga0157369_105855362 321
228 3300025921 Ga0207652_10047852 Ga0207652_100478523 321
229 3300025949 Ga0207667_10398860 Ga0207667_103988601 321
230 3300025949 Ga0207667_10661937 Ga0207667_106619371 321
231 3300027671 Ga0209588_1003420 Ga0209588_10034202 321
232 3300031616 Ga0307508_10000003 Ga0307508_10000003163 321
233 3300033180 Ga0307510_10018034 Ga0307510_100180342 321
234 3300035111 Ga0373923_0042573 Ga0373923_0042573_773_1777 321
235 3300035118 Ga0373954_0000584 Ga0373954_0000584_8063_9067 321
236 3300035119 Ga0373956_0002897 Ga0373956_0002897_5259_6263 321
237 3300035120 Ga0373957_0007168 Ga0373957_0007168_1403_2407 321
238 3300035172 Ga0373955_0012385 Ga0373955_0012385_1670_2674 321
239 3300035695 Ga0373927_0010805 Ga0373927_0010805_463_1593 321
240 3300035724 Ga0373933_0019974 Ga0373933_0019974_158_1162 321
241 3300036401 Ga0373937_0014040 Ga0373937_0014040_3665_4669 321
242 3300046454 Ga0495592_0017995 Ga0495592_0017995_1812_2816 321
243 3300046459 Ga0495629_0002194 Ga0495629_0002194_2630_3634 321
244 3300046460 Ga0495638_0001509 Ga0495638_0001509_9780_10784 321
245 3300046462 Ga0495651_0018674 Ga0495651_0018674_1469_2473 321
246 3300046463 Ga0495653_0061303 Ga0495653_0061303_1612_2616 321
247 3300046511 Ga0495608_0002889 Ga0495608_0002889_1812_2816 321
248 3300046514 Ga0495618_0147532 Ga0495618_0147532_358_1362 321
249 3300046516 Ga0495628_0005140 Ga0495628_0005140_7005_8009 321
250 3300046529 Ga0495652_0025881 Ga0495652_0025881_1281_2285 321
251 3300046533 Ga0495640_0012625 Ga0495640_0012625_3154_4158 321
252 3300046536 Ga0495587_0022631 Ga0495587_0022631_1396_2400 321
253 3300046543 Ga0495645_0016180 Ga0495645_0016180_443_1447 321
254 3300046559 Ga0495667_0066680 Ga0495667_0066680_139_1143 321
255 3300046642 Ga0495634_0053495 Ga0495634_0053495_1319_2323 321
256 3300046663 Ga0495635_0001940 Ga0495635_0001940_9354_10358 321
257 3300046678 Ga0495599_0012882 Ga0495599_0012882_3473_4477 321
258 3300046679 Ga0495623_0011556 Ga0495623_0011556_1812_2816 321
259 3300046680 Ga0495646_0015943 Ga0495646_0015943_3500_4504 321
260 3300046809 Ga0495600_0033194 Ga0495600_0033194_2116_3120 321
261 3300047317 Ga0495604_0124156 Ga0495604_0124156_630_1634 321
262 3300047322 Ga0495680_0036768 Ga0495680_0036768_2069_3073 321
263 3300047444 Ga0495675_0004080 Ga0495675_0004080_7484_8488 321
264 3300047471 Ga0495684_0003481 Ga0495684_0003481_7891_8895 321
265 3300047673 Ga0495593_0008924 Ga0495593_0008924_4661_5665 321
266 3300049575 Ga0501039_0033014 Ga0501039_0033014_2839_3918 321
267 3300049588 Ga0501072_0076043 Ga0501072_0076043_289_1368 321
268 3300049592 Ga0501076_0025564 Ga0501076_0025564_2014_3093 321
269 3300049593 Ga0501077_0037920 Ga0501077_0037920_528_1607 321
270 3300050492 nmdc:mga0yw44_52348_c1 nmdc:mga0yw44_52348_c1_266_1270 321
271 3300053077 Ga0495601_0014495 Ga0495601_0014495_3482_4486 321
272 3300053084 Ga0495595_0002007 Ga0495595_0002007_4662_5666 321
273 3300053085 Ga0495619_0004943 Ga0495619_0004943_6811_7815 321
274 3300053102 Ga0500554_000492 Ga0500554_000492_15_1019 321
275 3300053150 Ga0500603_002062 Ga0500603_002062_1601_2605 321
276 3300053178 Ga0500637_0012749 Ga0500637_0012749_892_1896 321
277 3300003322 rootL2_10019543 rootL2_100195432 322
278 3300005436 Ga0070713_100118313 Ga0070713_1001183133 322
279 3300005439 Ga0070711_100216314 Ga0070711_1002163142 322
280 3300005937 Ga0081455_10007525 Ga0081455_100075259 322
281 3300006163 Ga0070715_10082869 Ga0070715_100828691 322
282 3300021384 Ga0213876_10096403 Ga0213876_100964032 322
283 3300025929 Ga0207664_10407418 Ga0207664_104074181 322
284 3300039437 Ga0436365_1840295 Ga0436365_1840295_678_1649 322
285 3300005937 Ga0081455_10010928 Ga0081455_100109287 323
286 3300005983 Ga0081540_1001581 Ga0081540_100158122 323
287 3300005983 Ga0081540_1005915 Ga0081540_10059152 323
288 3300005983 Ga0081540_1012461 Ga0081540_10124613 323
289 3300005983 Ga0081540_1015842 Ga0081540_10158424 323
290 3300005983 Ga0081540_1018222 Ga0081540_10182222 323
291 3300005983 Ga0081540_1021249 Ga0081540_10212494 323
292 3300005983 Ga0081540_1029698 Ga0081540_10296983 323
293 3300005983 Ga0081540_1038766 Ga0081540_10387662 323
294 3300005985 Ga0081539_10071747 Ga0081539_100717472 323
295 3300044693 Ga0466961_0177773 Ga0466961_0177773_233_1216 323
296 3300045836 Ga0466958_0029379 Ga0466958_0029379_217_1197 323
297 3300046455 Ga0495603_0054895 Ga0495603_0054895_961_1932 323
298 3300061719 Ga0466962_0031493 Ga0466962_0031493_1346_2326 323
299 3300006051 Ga0075364_10180736 Ga0075364_101807362 324
300 3300006353 Ga0075370_10036860 Ga0075370_100368602 324
301 3300009147 Ga0114129_10444827 Ga0114129_104448272 324
302 3300010159 Ga0099796_10040397 Ga0099796_100403972 324
303 3300031241 Ga0265325_10018825 Ga0265325_100188252 324
304 3300031712 Ga0265342_10005221 Ga0265342_100052216 324
305 3300050496 nmdc:mga07m45_104347_c1 nmdc:mga07m45_104347_c1_527_1531 324
306 3300050507 nmdc:mga05p37_297643_c1 nmdc:mga05p37_297643_c1_23_1024 324
307 3300053108 Ga0500562_024810 Ga0500562_024810_507_1502 324
308 3300005364 Ga0070673_100180064 Ga0070673_1001800642 325
309 3300005530 Ga0070679_100039433 Ga0070679_1000394333 325
310 3300025921 Ga0207652_10023104 Ga0207652_100231043 325
311 3300037312 Ga0395899_0054057 Ga0395899_0054057_971_1972 325
312 3300037418 Ga0395900_0001761 Ga0395900_0001761_6586_7587 325
313 3300037418 Ga0395900_0054321 Ga0395900_0054321_176_1264 325
314 3300037418 Ga0395900_0377578 Ga0395900_0377578_195_1196 325
315 3300037466 Ga0395898_0011123 Ga0395898_0011123_1677_2678 325
316 3300037466 Ga0395898_0038411 Ga0395898_0038411_909_1997 325
317 3300037466 Ga0395898_0082048 Ga0395898_0082048_310_1311 325
318 3300038443 Ga0395901_0008259 Ga0395901_0008259_6108_7109 325
319 3300038443 Ga0395901_0026202 Ga0395901_0026202_437_1438 325
320 3300001989 JGI24739J22299_10000103 JGI24739J22299_1000010319 326
321 3300001990 JGI24737J22298_10001126 JGI24737J22298_100011269 326
322 3300002070 JGI24750J21931_1000146 JGI24750J21931_10001465 326
323 3300002073 JGI24745J21846_1000206 JGI24745J21846_10002067 326
324 3300002074 JGI24748J21848_1001081 JGI24748J21848_10010813 326
325 3300002076 JGI24749J21850_1001451 JGI24749J21850_10014512 326
326 3300002126 JGI24035J26624_1000077 JGI24035J26624_10000773 326
327 3300002244 JGI24742J22300_10000066 JGI24742J22300_1000006617 326
328 3300002459 JGI24751J29686_10016809 JGI24751J29686_100168092 326
329 3300005293 Ga0065715_10089784 Ga0065715_100897848 326
330 3300005328 Ga0070676_10014685 Ga0070676_100146854 326
331 3300005329 Ga0070683_100010341 Ga0070683_1000103419 326
332 3300005330 Ga0070690_100013073 Ga0070690_1000130734 326
333 3300005331 Ga0070670_100035000 Ga0070670_1000350003 326
334 3300005334 Ga0068869_100000236 Ga0068869_10000023624 326
335 3300005335 Ga0070666_10009878 Ga0070666_100098785 326
336 3300005336 Ga0070680_100056705 Ga0070680_1000567052 326
337 3300005337 Ga0070682_100002602 Ga0070682_10000260211 326
338 3300005339 Ga0070660_100003492 Ga0070660_10000349211 326
339 3300005340 Ga0070689_100000466 Ga0070689_1000004662 326
340 3300005344 Ga0070661_100000827 Ga0070661_10000082713 326
341 3300005345 Ga0070692_10002292 Ga0070692_100022924 326
342 3300005353 Ga0070669_100002399 Ga0070669_10000239911 326
343 3300005354 Ga0070675_100005703 Ga0070675_1000057034 326
344 3300005355 Ga0070671_100000736 Ga0070671_1000007369 326
345 3300005364 Ga0070673_100000302 Ga0070673_1000003029 326
346 3300005365 Ga0070688_100004878 Ga0070688_1000048786 326
347 3300005366 Ga0070659_100001555 Ga0070659_1000015554 326
348 3300005367 Ga0070667_100002272 Ga0070667_1000022726 326
349 3300005440 Ga0070705_100001212 Ga0070705_10000121214 326
350 3300005441 Ga0070700_100001313 Ga0070700_1000013134 326
351 3300005444 Ga0070694_100003865 Ga0070694_10000386510 326
352 3300005456 Ga0070678_100046577 Ga0070678_1000465774 326
353 3300005458 Ga0070681_10034348 Ga0070681_100343484 326
354 3300005459 Ga0068867_100001495 Ga0068867_10000149517 326
355 3300005466 Ga0070685_10008541 Ga0070685_100085412 326
356 3300005530 Ga0070679_100169447 Ga0070679_1001694471 326
357 3300005535 Ga0070684_100005932 Ga0070684_10000593210 326
358 3300005539 Ga0068853_100000919 Ga0068853_1000009195 326
359 3300005543 Ga0070672_100004500 Ga0070672_10000450011 326
360 3300005544 Ga0070686_100000488 Ga0070686_1000004882 326
361 3300005545 Ga0070695_100046428 Ga0070695_1000464283 326
362 3300005546 Ga0070696_100011190 Ga0070696_1000111903 326
363 3300005547 Ga0070693_100002155 Ga0070693_10000215510 326
364 3300005548 Ga0070665_100055383 Ga0070665_1000553832 326
365 3300005549 Ga0070704_100037444 Ga0070704_1000374443 326
366 3300005564 Ga0070664_100002753 Ga0070664_1000027539 326
367 3300005577 Ga0068857_100001539 Ga0068857_10000153919 326
368 3300005578 Ga0068854_100002718 Ga0068854_10000271811 326
369 3300005614 Ga0068856_100001722 Ga0068856_1000017228 326
370 3300005615 Ga0070702_100005389 Ga0070702_1000053899 326
371 3300005616 Ga0068852_100001817 Ga0068852_10000181710 326
372 3300005617 Ga0068859_100010286 Ga0068859_1000102864 326
373 3300005618 Ga0068864_100002498 Ga0068864_1000024986 326
374 3300005718 Ga0068866_10050277 Ga0068866_100502772 326
375 3300005840 Ga0068870_10000676 Ga0068870_100006769 326
376 3300005842 Ga0068858_100008130 Ga0068858_1000081309 326
377 3300005843 Ga0068860_100007431 Ga0068860_10000743111 326
378 3300006852 Ga0075433_10025232 Ga0075433_100252322 326
379 3300006881 Ga0068865_100000452 Ga0068865_10000045222 326
380 3300006931 Ga0097620_100010289 Ga0097620_10001028910 326
381 3300009011 Ga0105251_10036852 Ga0105251_100368522 326
382 3300009094 Ga0111539_10002712 Ga0111539_1000271222 326
383 3300009098 Ga0105245_10000380 Ga0105245_1000038036 326
384 3300009101 Ga0105247_10007787 Ga0105247_100077875 326
385 3300009148 Ga0105243_10002254 Ga0105243_1000225418 326
386 3300009174 Ga0105241_10000342 Ga0105241_1000034222 326
387 3300009176 Ga0105242_10000855 Ga0105242_1000085520 326
388 3300009177 Ga0105248_10012394 Ga0105248_100123943 326
389 3300009553 Ga0105249_10001982 Ga0105249_100019829 326
390 3300010375 Ga0105239_10012830 Ga0105239_100128302 326
391 3300013100 Ga0157373_10130306 Ga0157373_101303062 326
392 3300013102 Ga0157371_10011566 Ga0157371_100115666 326
393 3300013296 Ga0157374_10001986 Ga0157374_1000198618 326
394 3300013297 Ga0157378_10001729 Ga0157378_1000172910 326
395 3300013306 Ga0163162_10012026 Ga0163162_1001202610 326
396 3300013307 Ga0157372_10024601 Ga0157372_100246012 326
397 3300013308 Ga0157375_10001883 Ga0157375_100018834 326
398 3300014325 Ga0163163_10010785 Ga0163163_100107852 326
399 3300014326 Ga0157380_10034105 Ga0157380_100341054 326
400 3300014745 Ga0157377_10000643 Ga0157377_1000064318 326
401 3300014968 Ga0157379_10027375 Ga0157379_100273754 326
402 3300014969 Ga0157376_10000920 Ga0157376_1000092019 326
403 3300017792 Ga0163161_10000379 Ga0163161_100003794 326
404 3300025271 Ga0207666_1000046 Ga0207666_10000467 326
405 3300025290 Ga0207673_1000260 Ga0207673_10002606 326
406 3300025315 Ga0207697_10000714 Ga0207697_100007144 326
407 3300025893 Ga0207682_10002945 Ga0207682_100029459 326
408 3300025900 Ga0207710_10007775 Ga0207710_100077752 326
409 3300025901 Ga0207688_10000083 Ga0207688_1000008335 326
410 3300025903 Ga0207680_10122670 Ga0207680_101226702 326
411 3300025904 Ga0207647_10029321 Ga0207647_100293213 326
412 3300025907 Ga0207645_10002954 Ga0207645_100029544 326
413 3300025908 Ga0207643_10000128 Ga0207643_1000012846 326
414 3300025911 Ga0207654_10001559 Ga0207654_100015597 326
415 3300025917 Ga0207660_10001486 Ga0207660_100014869 326
416 3300025918 Ga0207662_10000301 Ga0207662_1000030122 326
417 3300025919 Ga0207657_10001859 Ga0207657_1000185922 326
418 3300025920 Ga0207649_10003562 Ga0207649_1000356210 326
419 3300025921 Ga0207652_10067763 Ga0207652_100677632 326
420 3300025923 Ga0207681_10039680 Ga0207681_100396804 326
421 3300025925 Ga0207650_10015442 Ga0207650_100154423 326
422 3300025926 Ga0207659_10000142 Ga0207659_100001423 326
423 3300025927 Ga0207687_10000667 Ga0207687_1000066713 326
424 3300025931 Ga0207644_10005279 Ga0207644_1000527910 326
425 3300025932 Ga0207690_10002854 Ga0207690_100028542 326
426 3300025933 Ga0207706_10004082 Ga0207706_1000408214 326
427 3300025934 Ga0207686_10000579 Ga0207686_1000057913 326
428 3300025935 Ga0207709_10000551 Ga0207709_1000055131 326
429 3300025936 Ga0207670_10000556 Ga0207670_1000055620 326
430 3300025937 Ga0207669_10000675 Ga0207669_100006756 326
431 3300025940 Ga0207691_10000599 Ga0207691_1000059935 326
432 3300025942 Ga0207689_10000165 Ga0207689_1000016553 326
433 3300025944 Ga0207661_10000744 Ga0207661_100007445 326
434 3300025945 Ga0207679_10000112 Ga0207679_1000011253 326
435 3300025960 Ga0207651_10000099 Ga0207651_100000994 326
436 3300025961 Ga0207712_10003302 Ga0207712_100033024 326
437 3300025972 Ga0207668_10144131 Ga0207668_101441312 326
438 3300025981 Ga0207640_10000320 Ga0207640_100003202 326
439 3300026035 Ga0207703_10014270 Ga0207703_100142709 326
440 3300026041 Ga0207639_10002883 Ga0207639_100028837 326
441 3300026067 Ga0207678_10001329 Ga0207678_100013294 326
442 3300026075 Ga0207708_10000862 Ga0207708_100008624 326
443 3300026088 Ga0207641_10001462 Ga0207641_100014622 326
444 3300026089 Ga0207648_10001891 Ga0207648_100018914 326
445 3300026095 Ga0207676_10001459 Ga0207676_1000145919 326
446 3300026116 Ga0207674_10006899 Ga0207674_100068994 326
447 3300026118 Ga0207675_100001575 Ga0207675_1000015754 326
448 3300026121 Ga0207683_10001273 Ga0207683_100012734 326
449 3300027717 Ga0209998_10009034 Ga0209998_100090342 326
450 3300027876 Ga0209974_10000708 Ga0209974_100007089 326
451 3300027907 Ga0207428_10000064 Ga0207428_1000006424 326
452 3300028379 Ga0268266_10040521 Ga0268266_100405212 326
453 3300028380 Ga0268265_10003386 Ga0268265_1000338612 326
454 3300028381 Ga0268264_10003086 Ga0268264_1000308616 326
455 3300034816 Ga0373930_0006202 Ga0373930_0006202_577_1557 326
456 3300034819 Ga0373958_0001446 Ga0373958_0001446_1803_2783 326
457 3300034957 Ga0373938_0031072 Ga0373938_0031072_101_1081 326
458 3300035084 Ga0373928_0003314 Ga0373928_0003314_359_1339 326
459 3300035090 Ga0373949_0001191 Ga0373949_0001191_6417_7397 326
460 3300035114 Ga0373939_0003074 Ga0373939_0003074_2664_3644 326
461 3300035115 Ga0373941_0001129 Ga0373941_0001129_389_1369 326
462 3300035121 Ga0373960_0001925 Ga0373960_0001925_1098_2078 326
463 3300035171 Ga0373946_0153969 Ga0373946_0153969_29_1027 326
464 3300035207 Ga0373942_0001663 Ga0373942_0001663_2800_3780 326
465 3300035241 Ga0373961_0009354 Ga0373961_0009354_1005_1985 326
466 3300035242 Ga0373962_0003305 Ga0373962_0003305_11_991 326
467 3300035695 Ga0373927_0086550 Ga0373927_0086550_830_1828 326
468 3300035725 Ga0373947_0037818 Ga0373947_0037818_1472_2470 326
469 3300046455 Ga0495603_0092736 Ga0495603_0092736_61_1059 326
470 3300048903 Ga0496100_0025612 Ga0496100_0025612_837_1817 326
471 3300048904 Ga0496101_0192699 Ga0496101_0192699_367_1347 326
472 3300048905 Ga0496102_0002938 Ga0496102_0002938_5361_6341 326
473 3300048906 Ga0496103_0077578 Ga0496103_0077578_589_1569 326
474 3300048907 Ga0496104_0066997 Ga0496104_0066997_1869_2849 326
475 3300048908 Ga0496105_0328864 Ga0496105_0328864_218_1198 326
476 3300048909 Ga0496106_0084266 Ga0496106_0084266_1199_2179 326
477 3300048912 Ga0496109_0000526 Ga0496109_0000526_7013_7993 326
478 3300048913 Ga0496110_0061140 Ga0496110_0061140_917_1897 326
479 3300048916 Ga0496113_0006619 Ga0496113_0006619_2503_3483 326
480 3300048917 Ga0496114_0017211 Ga0496114_0017211_2010_2990 326
481 3300048918 Ga0496115_0017888 Ga0496115_0017888_3931_4911 326
482 3300050515 nmdc:mga0a205_267834_c1 nmdc:mga0a205_267834_c1_300_1280 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

86

359

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9633 31 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9569 31 325
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.956 34 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.951 30 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9478 30 325
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9459 128 244 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9256 30 325 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9245 30 325 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9203 30 325 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9163 128 249 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536SFT4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.975 57 325
AF-A0A4Q7NEM1-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9727 30 325
AF-A0A7D4HSB6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9723 31 324
AF-A0A537VTQ8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9703 42 325
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9703 55 325

Feature Viewer

pLDDT pTM Quality
91.58 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map