F452645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 482 | 348 | 480 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0054321|Ga0395900_0054321_176_1264 |
| Length | 362 |
| Sequence | MRLHFSGADRNVPRAKGATNASPEHCGGNMRAFVTRAFHLTRRAAVLAGISALAAASLGAAHAQSYPDHTVKIIVPFPAGGTADAVPRIVADWLSRKWGQPVVIENHTGAAGNIGSEIVYKAAPDGYTLLSAPPXPLVNNQNLYPHLPFDPAKFEPVSIMAEAPSGLFVNPDKIKAKSIPELIAYMKANPGKVLVATQGNGTTAHLTAELFNLMAGVKTQMVPYRGSAPALQGLLAGNVDIMFDNLGVSLPMAKAGKLKLLGVATAHRLKSMPDVPTIAETLPGFLSSAWYAVVAPPKTPKAVVDKINADINGALKDPAVIEKLKKLSCDVVGGTPQQAADFMKQEVKRWGNVIKSAHITLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 2 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 303 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 335 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 336 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 337 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 343 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 345 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 347 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.19 |
| Nodule | 0 |
| Rhizoplane | 2.7 |
| Rhizosphere | 86.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000103 | 3300001989 | Bacteria | 25576 |
| 2 | JGI24737J22298_10001126 | 3300001990 | Bacteria | 9400 |
| 3 | JGI24750J21931_1000146 | 3300002070 | Bacteria | 11547 |
| 4 | JGI24745J21846_1000206 | 3300002073 | Bacteria | 4783 |
| 5 | JGI24748J21848_1001081 | 3300002074 | Bacteria | 2971 |
| 6 | JGI24749J21850_1001451 | 3300002076 | Bacteria | 3350 |
| 7 | JGI24035J26624_1000077 | 3300002126 | Bacteria | 7943 |
| 8 | JGI24742J22300_10000066 | 3300002244 | Bacteria | 15346 |
| 9 | JGI24751J29686_10016809 | 3300002459 | Bacteria | 1510 |
| 10 | rootL2_10019543 | 3300003322 | Bacteria | 2088 |
| 11 | rootL2_10140712 | 3300003322 | Bacteria | 2880 |
| 12 | rootL2_10156181 | 3300003322 | Bacteria | 3780 |
| 13 | Ga0065715_10089784 | 3300005293 | Bacteria | 8534 |
| 14 | Ga0065707_10120544 | 3300005295 | Bacteria | 2132 |
| 15 | Ga0070658_10007426 | 3300005327 | Bacteria | 8848 |
| 16 | Ga0070676_10014685 | 3300005328 | Bacteria | 4307 |
| 17 | Ga0070683_100010341 | 3300005329 | Bacteria | 8025 |
| 18 | Ga0070683_100131057 | 3300005329 | Bacteria | 2373 |
| 19 | Ga0070690_100013073 | 3300005330 | Bacteria | 4897 |
| 20 | Ga0070670_100035000 | 3300005331 | Bacteria | 4323 |
| 21 | Ga0068869_100000236 | 3300005334 | Bacteria | 29097 |
| 22 | Ga0070666_10009878 | 3300005335 | Bacteria | 5960 |
| 23 | Ga0070680_100056705 | 3300005336 | Bacteria | 3202 |
| 24 | Ga0070680_100098670 | 3300005336 | Bacteria | 2423 |
| 25 | Ga0070680_100110307 | 3300005336 | Bacteria | 2290 |
| 26 | Ga0070682_100002602 | 3300005337 | Bacteria | 9963 |
| 27 | Ga0070660_100003492 | 3300005339 | Bacteria | 10828 |
| 28 | Ga0070660_100089523 | 3300005339 | Bacteria | 2425 |
| 29 | Ga0070689_100000466 | 3300005340 | Bacteria | 23849 |
| 30 | Ga0070661_100000827 | 3300005344 | Bacteria | 22257 |
| 31 | Ga0070692_10002292 | 3300005345 | Bacteria | 7364 |
| 32 | Ga0070669_100002399 | 3300005353 | Bacteria | 13560 |
| 33 | Ga0070675_100005703 | 3300005354 | Bacteria | 9530 |
| 34 | Ga0070675_100362631 | 3300005354 | Bacteria | 1287 |
| 35 | Ga0070671_100000736 | 3300005355 | Bacteria | 23441 |
| 36 | Ga0070673_100000302 | 3300005364 | Bacteria | 25831 |
| 37 | Ga0070673_100180064 | 3300005364 | Bacteria | 1809 |
| 38 | Ga0070688_100004878 | 3300005365 | Bacteria | 7018 |
| 39 | Ga0070659_100001555 | 3300005366 | Bacteria | 16548 |
| 40 | Ga0070659_100210918 | 3300005366 | Bacteria | 1601 |
| 41 | Ga0070667_100002272 | 3300005367 | Bacteria | 16919 |
| 42 | Ga0070713_100118313 | 3300005436 | Bacteria | 2320 |
| 43 | Ga0070713_100355796 | 3300005436 | Bacteria | 1359 |
| 44 | Ga0070711_100216314 | 3300005439 | Bacteria | 1487 |
| 45 | Ga0070705_100001212 | 3300005440 | Bacteria | 13972 |
| 46 | Ga0070700_100001313 | 3300005441 | Bacteria | 12331 |
| 47 | Ga0070694_100003865 | 3300005444 | Bacteria | 8952 |
| 48 | Ga0070678_100046577 | 3300005456 | Bacteria | 3110 |
| 49 | Ga0070681_10034348 | 3300005458 | Bacteria | 5091 |
| 50 | Ga0068867_100001495 | 3300005459 | Bacteria | 16179 |
| 51 | Ga0070685_10008541 | 3300005466 | Bacteria | 5268 |
| 52 | Ga0070679_100039433 | 3300005530 | Bacteria | 4694 |
| 53 | Ga0070679_100055816 | 3300005530 | Bacteria | 3934 |
| 54 | Ga0070679_100169447 | 3300005530 | Bacteria | 2156 |
| 55 | Ga0070679_100221413 | 3300005530 | Bacteria | 1853 |
| 56 | Ga0070684_100005932 | 3300005535 | Bacteria | 9408 |
| 57 | Ga0070684_100102246 | 3300005535 | Bacteria | 2562 |
| 58 | Ga0070684_100365875 | 3300005535 | Bacteria | 1327 |
| 59 | Ga0068853_100000919 | 3300005539 | Bacteria | 20601 |
| 60 | Ga0068853_100380224 | 3300005539 | Bacteria | 1318 |
| 61 | Ga0070672_100004500 | 3300005543 | Bacteria | 9131 |
| 62 | Ga0070686_100000488 | 3300005544 | Bacteria | 24002 |
| 63 | Ga0070695_100046428 | 3300005545 | Bacteria | 2771 |
| 64 | Ga0070696_100011190 | 3300005546 | Bacteria | 6005 |
| 65 | Ga0070696_100081624 | 3300005546 | Bacteria | 2291 |
| 66 | Ga0070693_100002155 | 3300005547 | Bacteria | 9028 |
| 67 | Ga0070665_100055383 | 3300005548 | Bacteria | 3977 |
| 68 | Ga0070704_100037444 | 3300005549 | Bacteria | 3314 |
| 69 | Ga0070704_100171379 | 3300005549 | Bacteria | 1727 |
| 70 | Ga0068855_100058537 | 3300005563 | Bacteria | 4512 |
| 71 | Ga0070664_100002753 | 3300005564 | Bacteria | 14191 |
| 72 | Ga0068857_100001539 | 3300005577 | Bacteria | 18457 |
| 73 | Ga0068854_100002718 | 3300005578 | Bacteria | 10971 |
| 74 | Ga0068856_100001722 | 3300005614 | Bacteria | 22877 |
| 75 | Ga0068856_100034102 | 3300005614 | Bacteria | 4985 |
| 76 | Ga0070702_100005389 | 3300005615 | Bacteria | 5951 |
| 77 | Ga0068852_100001817 | 3300005616 | Bacteria | 14500 |
| 78 | Ga0068852_100017529 | 3300005616 | Bacteria | 5621 |
| 79 | Ga0068859_100010286 | 3300005617 | Bacteria | 9417 |
| 80 | Ga0068859_100184370 | 3300005617 | Bacteria | 2170 |
| 81 | Ga0068864_100002498 | 3300005618 | Bacteria | 15204 |
| 82 | Ga0068866_10050277 | 3300005718 | Bacteria | 2116 |
| 83 | Ga0068851_10002190 | 3300005834 | Bacteria | 8596 |
| 84 | Ga0068870_10000676 | 3300005840 | Bacteria | 13010 |
| 85 | Ga0068858_100008130 | 3300005842 | Bacteria | 10087 |
| 86 | Ga0068860_100007431 | 3300005843 | Bacteria | 10959 |
| 87 | Ga0081455_10007525 | 3300005937 | Bacteria | 11455 |
| 88 | Ga0081455_10010928 | 3300005937 | Bacteria | 9158 |
| 89 | Ga0081540_1001581 | 3300005983 | Bacteria | 19462 |
| 90 | Ga0081540_1003471 | 3300005983 | Bacteria | 12440 |
| 91 | Ga0081540_1005915 | 3300005983 | Bacteria | 9026 |
| 92 | Ga0081540_1012461 | 3300005983 | Bacteria | 5596 |
| 93 | Ga0081540_1015842 | 3300005983 | Bacteria | 4752 |
| 94 | Ga0081540_1018222 | 3300005983 | Bacteria | 4316 |
| 95 | Ga0081540_1021249 | 3300005983 | Bacteria | 3873 |
| 96 | Ga0081540_1029698 | 3300005983 | Bacteria | 3041 |
| 97 | Ga0081540_1038766 | 3300005983 | Bacteria | 2507 |
| 98 | Ga0081539_10071747 | 3300005985 | Bacteria | 1853 |
| 99 | Ga0075364_10180736 | 3300006051 | Bacteria | 1427 |
| 100 | Ga0070715_10082869 | 3300006163 | Bacteria | 1459 |
| 101 | Ga0070716_100047325 | 3300006173 | Bacteria | 2425 |
| 102 | Ga0075362_10039145 | 3300006177 | Bacteria | 2084 |
| 103 | Ga0075366_10067932 | 3300006195 | Bacteria | 2121 |
| 104 | Ga0075366_10073217 | 3300006195 | Bacteria | 2042 |
| 105 | Ga0075370_10036860 | 3300006353 | Bacteria | 2748 |
| 106 | Ga0068871_100474222 | 3300006358 | Bacteria | 1125 |
| 107 | Ga0075428_100011535 | 3300006844 | Bacteria | 9828 |
| 108 | Ga0075433_10025232 | 3300006852 | Bacteria | 5024 |
| 109 | Ga0075434_100008346 | 3300006871 | Bacteria | 9627 |
| 110 | Ga0075429_100058668 | 3300006880 | Bacteria | 3352 |
| 111 | Ga0075429_100060201 | 3300006880 | Bacteria | 3308 |
| 112 | Ga0068865_100000452 | 3300006881 | Bacteria | 22857 |
| 113 | Ga0097620_100010289 | 3300006931 | Bacteria | 9417 |
| 114 | Ga0097620_100184370 | 3300006931 | Bacteria | 2170 |
| 115 | Ga0099794_10001140 | 3300007265 | Bacteria | 9116 |
| 116 | Ga0099795_10004330 | 3300007788 | Bacteria | 3649 |
| 117 | Ga0099795_10030630 | 3300007788 | Bacteria | 1848 |
| 118 | Ga0099795_10064183 | 3300007788 | Bacteria | 1370 |
| 119 | Ga0105251_10036852 | 3300009011 | Bacteria | 2403 |
| 120 | Ga0105240_10005557 | 3300009093 | Bacteria | 18763 |
| 121 | Ga0105240_10426285 | 3300009093 | Bacteria | 1489 |
| 122 | Ga0111539_10002712 | 3300009094 | Bacteria | 23487 |
| 123 | Ga0111539_10050272 | 3300009094 | Bacteria | 4966 |
| 124 | Ga0111539_10103863 | 3300009094 | Bacteria | 3335 |
| 125 | Ga0105245_10000380 | 3300009098 | Bacteria | 41293 |
| 126 | Ga0105247_10007787 | 3300009101 | Bacteria | 6553 |
| 127 | Ga0105247_10018268 | 3300009101 | Bacteria | 4207 |
| 128 | Ga0114129_10444827 | 3300009147 | Bacteria | 1701 |
| 129 | Ga0105243_10002254 | 3300009148 | Bacteria | 16204 |
| 130 | Ga0105241_10000342 | 3300009174 | Bacteria | 35383 |
| 131 | Ga0105242_10000855 | 3300009176 | Bacteria | 23621 |
| 132 | Ga0105248_10012394 | 3300009177 | Bacteria | 9405 |
| 133 | Ga0105238_10020559 | 3300009551 | Bacteria | 6721 |
| 134 | Ga0105249_10001982 | 3300009553 | Bacteria | 17778 |
| 135 | Ga0099796_10001257 | 3300010159 | Bacteria | 4976 |
| 136 | Ga0099796_10040397 | 3300010159 | Bacteria | 1575 |
| 137 | Ga0105239_10012830 | 3300010375 | Bacteria | 9320 |
| 138 | Ga0157373_10130306 | 3300013100 | Bacteria | 1769 |
| 139 | Ga0157373_10150466 | 3300013100 | Bacteria | 1637 |
| 140 | Ga0157371_10011566 | 3300013102 | Bacteria | 6786 |
| 141 | Ga0157370_10185261 | 3300013104 | Bacteria | 1933 |
| 142 | Ga0157369_10095818 | 3300013105 | Bacteria | 3166 |
| 143 | Ga0157369_10432819 | 3300013105 | Bacteria | 1363 |
| 144 | Ga0157369_10585536 | 3300013105 | Bacteria | 1152 |
| 145 | Ga0157374_10001986 | 3300013296 | Bacteria | 17156 |
| 146 | Ga0157378_10001729 | 3300013297 | Bacteria | 19618 |
| 147 | Ga0163162_10012026 | 3300013306 | Bacteria | 8439 |
| 148 | Ga0157372_10024601 | 3300013307 | Bacteria | 6544 |
| 149 | Ga0157375_10001883 | 3300013308 | Bacteria | 18038 |
| 150 | Ga0163163_10010785 | 3300014325 | Bacteria | 8246 |
| 151 | Ga0157380_10034105 | 3300014326 | Bacteria | 3924 |
| 152 | Ga0157377_10000643 | 3300014745 | Bacteria | 14554 |
| 153 | Ga0157379_10027375 | 3300014968 | Bacteria | 5076 |
| 154 | Ga0157376_10000920 | 3300014969 | Bacteria | 19113 |
| 155 | Ga0163161_10000379 | 3300017792 | Bacteria | 37281 |
| 156 | Ga0213876_10096403 | 3300021384 | Bacteria | 1567 |
| 157 | Ga0213875_10000074 | 3300021388 | Bacteria | 118349 |
| 158 | Ga0207666_1000046 | 3300025271 | Bacteria | 24194 |
| 159 | Ga0207673_1000260 | 3300025290 | Bacteria | 5398 |
| 160 | Ga0207697_10000714 | 3300025315 | Bacteria | 18891 |
| 161 | Ga0207682_10002945 | 3300025893 | Bacteria | 7495 |
| 162 | Ga0207710_10007775 | 3300025900 | Bacteria | 4538 |
| 163 | Ga0207688_10000083 | 3300025901 | Bacteria | 36050 |
| 164 | Ga0207680_10122670 | 3300025903 | Bacteria | 1701 |
| 165 | Ga0207647_10029321 | 3300025904 | Bacteria | 3563 |
| 166 | Ga0207645_10002954 | 3300025907 | Bacteria | 13126 |
| 167 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 168 | Ga0207654_10001559 | 3300025911 | Bacteria | 12036 |
| 169 | Ga0207654_10052267 | 3300025911 | Bacteria | 2354 |
| 170 | Ga0207707_10007276 | 3300025912 | Bacteria | 9637 |
| 171 | Ga0207695_10264093 | 3300025913 | Bacteria | 1618 |
| 172 | Ga0207671_10059503 | 3300025914 | Bacteria | 2833 |
| 173 | Ga0207693_10004725 | 3300025915 | Bacteria | 11455 |
| 174 | Ga0207660_10001486 | 3300025917 | Bacteria | 15770 |
| 175 | Ga0207660_10003129 | 3300025917 | Bacteria | 10821 |
| 176 | Ga0207660_10186500 | 3300025917 | Bacteria | 1613 |
| 177 | Ga0207662_10000301 | 3300025918 | Bacteria | 22744 |
| 178 | Ga0207657_10001859 | 3300025919 | Bacteria | 22810 |
| 179 | Ga0207657_10003072 | 3300025919 | Bacteria | 17870 |
| 180 | Ga0207649_10003562 | 3300025920 | Bacteria | 8508 |
| 181 | Ga0207652_10007379 | 3300025921 | Bacteria | 8865 |
| 182 | Ga0207652_10023104 | 3300025921 | Bacteria | 5150 |
| 183 | Ga0207652_10047852 | 3300025921 | Bacteria | 3654 |
| 184 | Ga0207652_10067763 | 3300025921 | Bacteria | 3095 |
| 185 | Ga0207681_10039680 | 3300025923 | Bacteria | 3127 |
| 186 | Ga0207694_10048895 | 3300025924 | Bacteria | 3273 |
| 187 | Ga0207650_10015442 | 3300025925 | Bacteria | 5318 |
| 188 | Ga0207650_10443922 | 3300025925 | Unclassified | 1079 |
| 189 | Ga0207659_10000142 | 3300025926 | Bacteria | 42302 |
| 190 | Ga0207687_10000667 | 3300025927 | Bacteria | 23099 |
| 191 | Ga0207664_10304599 | 3300025929 | Bacteria | 1402 |
| 192 | Ga0207664_10407418 | 3300025929 | Bacteria | 1210 |
| 193 | Ga0207644_10005279 | 3300025931 | Bacteria | 8432 |
| 194 | Ga0207690_10002854 | 3300025932 | Bacteria | 10412 |
| 195 | Ga0207690_10169421 | 3300025932 | Bacteria | 1635 |
| 196 | Ga0207706_10004082 | 3300025933 | Bacteria | 13792 |
| 197 | Ga0207686_10000579 | 3300025934 | Bacteria | 22963 |
| 198 | Ga0207709_10000551 | 3300025935 | Bacteria | 32038 |
| 199 | Ga0207670_10000556 | 3300025936 | Bacteria | 20667 |
| 200 | Ga0207669_10000675 | 3300025937 | Bacteria | 14703 |
| 201 | Ga0207665_10046601 | 3300025939 | Bacteria | 2904 |
| 202 | Ga0207665_10144576 | 3300025939 | Bacteria | 1698 |
| 203 | Ga0207691_10000599 | 3300025940 | Bacteria | 35997 |
| 204 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 205 | Ga0207661_10000744 | 3300025944 | Bacteria | 21117 |
| 206 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 207 | Ga0207667_10230191 | 3300025949 | Bacteria | 1898 |
| 208 | Ga0207667_10398860 | 3300025949 | Bacteria | 1401 |
| 209 | Ga0207667_10661937 | 3300025949 | Bacteria | 1049 |
| 210 | Ga0207651_10000099 | 3300025960 | Bacteria | 38059 |
| 211 | Ga0207712_10003302 | 3300025961 | Bacteria | 10231 |
| 212 | Ga0207668_10144131 | 3300025972 | Bacteria | 1835 |
| 213 | Ga0207640_10000320 | 3300025981 | Bacteria | 32131 |
| 214 | Ga0207703_10014270 | 3300026035 | Bacteria | 6196 |
| 215 | Ga0207639_10002883 | 3300026041 | Bacteria | 11555 |
| 216 | Ga0207678_10001329 | 3300026067 | Bacteria | 22814 |
| 217 | Ga0207708_10000862 | 3300026075 | Bacteria | 22870 |
| 218 | Ga0207641_10001462 | 3300026088 | Bacteria | 23160 |
| 219 | Ga0207648_10001891 | 3300026089 | Bacteria | 22870 |
| 220 | Ga0207676_10001459 | 3300026095 | Bacteria | 17574 |
| 221 | Ga0207674_10006899 | 3300026116 | Bacteria | 13310 |
| 222 | Ga0207674_10393574 | 3300026116 | Bacteria | 1339 |
| 223 | Ga0207675_100001575 | 3300026118 | Bacteria | 22801 |
| 224 | Ga0207683_10001273 | 3300026121 | Bacteria | 22829 |
| 225 | Ga0207683_10107760 | 3300026121 | Bacteria | 2493 |
| 226 | Ga0207698_10396613 | 3300026142 | Bacteria | 1317 |
| 227 | Ga0209588_1003420 | 3300027671 | Bacteria | 4407 |
| 228 | Ga0209998_10009034 | 3300027717 | Bacteria | 2064 |
| 229 | Ga0209974_10000708 | 3300027876 | Bacteria | 11387 |
| 230 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 231 | Ga0207428_10007064 | 3300027907 | Bacteria | 10281 |
| 232 | Ga0268266_10040521 | 3300028379 | Bacteria | 3970 |
| 233 | Ga0268265_10003386 | 3300028380 | Bacteria | 11479 |
| 234 | Ga0268264_10003086 | 3300028381 | Bacteria | 14418 |
| 235 | Ga0307517_10128300 | 3300028786 | Bacteria | 1839 |
| 236 | Ga0307511_10081159 | 3300030521 | Bacteria | 2279 |
| 237 | Ga0265325_10018825 | 3300031241 | Bacteria | 3827 |
| 238 | Ga0307509_10072301 | 3300031507 | Bacteria | 3593 |
| 239 | Ga0307509_10082839 | 3300031507 | Bacteria | 3308 |
| 240 | Ga0265313_10000183 | 3300031595 | Bacteria | 66629 |
| 241 | Ga0307508_10000003 | 3300031616 | Bacteria | 321602 |
| 242 | Ga0265314_10000577 | 3300031711 | Bacteria | 46408 |
| 243 | Ga0265342_10005221 | 3300031712 | Bacteria | 9970 |
| 244 | Ga0307516_10003289 | 3300031730 | Bacteria | 20915 |
| 245 | Ga0307516_10009900 | 3300031730 | Bacteria | 10566 |
| 246 | Ga0307516_10023333 | 3300031730 | Bacteria | 6344 |
| 247 | Ga0307507_10023941 | 3300033179 | Bacteria | 6678 |
| 248 | Ga0307510_10018034 | 3300033180 | Bacteria | 8317 |
| 249 | Ga0307510_10188073 | 3300033180 | Unclassified | 1617 |
| 250 | Ga0373930_0006202 | 3300034816 | Bacteria | 2013 |
| 251 | Ga0373948_0016849 | 3300034817 | Bacteria | 1355 |
| 252 | Ga0373950_0021004 | 3300034818 | Bacteria | 1152 |
| 253 | Ga0373950_0024155 | 3300034818 | Bacteria | 1091 |
| 254 | Ga0373958_0001446 | 3300034819 | Bacteria | 3198 |
| 255 | Ga0373938_0031072 | 3300034957 | Bacteria | 1143 |
| 256 | Ga0373928_0003314 | 3300035084 | Bacteria | 3083 |
| 257 | Ga0373934_0033966 | 3300035086 | Bacteria | 2004 |
| 258 | Ga0373944_0005363 | 3300035089 | Bacteria | 3374 |
| 259 | Ga0373949_0001191 | 3300035090 | Bacteria | 7712 |
| 260 | Ga0373923_0016159 | 3300035111 | Bacteria | 2829 |
| 261 | Ga0373923_0042573 | 3300035111 | Bacteria | 1876 |
| 262 | Ga0373939_0003074 | 3300035114 | Bacteria | 3920 |
| 263 | Ga0373941_0001129 | 3300035115 | Bacteria | 5569 |
| 264 | Ga0373954_0000584 | 3300035118 | Bacteria | 13828 |
| 265 | Ga0373954_0116940 | 3300035118 | Bacteria | 1293 |
| 266 | Ga0373956_0002897 | 3300035119 | Bacteria | 6946 |
| 267 | Ga0373957_0007168 | 3300035120 | Bacteria | 3555 |
| 268 | Ga0373960_0001925 | 3300035121 | Bacteria | 4651 |
| 269 | Ga0373943_0011057 | 3300035170 | Bacteria | 4054 |
| 270 | Ga0373946_0153969 | 3300035171 | Bacteria | 1074 |
| 271 | Ga0373955_0012385 | 3300035172 | Bacteria | 4098 |
| 272 | Ga0373942_0001663 | 3300035207 | Bacteria | 5643 |
| 273 | Ga0373961_0009354 | 3300035241 | Bacteria | 2398 |
| 274 | Ga0373962_0003305 | 3300035242 | Bacteria | 3877 |
| 275 | Ga0373935_0005223 | 3300035692 | Bacteria | 7647 |
| 276 | Ga0373935_0040393 | 3300035692 | Bacteria | 2928 |
| 277 | Ga0373935_0170569 | 3300035692 | Bacteria | 1488 |
| 278 | Ga0373927_0007448 | 3300035695 | Bacteria | 7404 |
| 279 | Ga0373927_0010805 | 3300035695 | Bacteria | 6083 |
| 280 | Ga0373927_0012964 | 3300035695 | Bacteria | 5544 |
| 281 | Ga0373927_0086550 | 3300035695 | Bacteria | 2034 |
| 282 | Ga0373933_0019974 | 3300035724 | Bacteria | 3792 |
| 283 | Ga0373933_0264223 | 3300035724 | Bacteria | 1110 |
| 284 | Ga0373947_0037818 | 3300035725 | Bacteria | 2865 |
| 285 | Ga0373937_0003318 | 3300036401 | Bacteria | 13517 |
| 286 | Ga0373937_0014040 | 3300036401 | Bacteria | 7063 |
| 287 | Ga0373937_0019535 | 3300036401 | Bacteria | 6063 |
| 288 | Ga0373937_0058829 | 3300036401 | Bacteria | 3531 |
| 289 | Ga0373925_0014183 | 3300037068 | Bacteria | 5766 |
| 290 | Ga0373925_0040564 | 3300037068 | Bacteria | 3447 |
| 291 | Ga0373925_0118423 | 3300037068 | Bacteria | 2053 |
| 292 | Ga0395899_0054057 | 3300037312 | Bacteria | 2972 |
| 293 | Ga0395900_0001761 | 3300037418 | Bacteria | 24849 |
| 294 | Ga0395900_0054321 | 3300037418 | Bacteria | 4124 |
| 295 | Ga0395900_0215484 | 3300037418 | Bacteria | 1938 |
| 296 | Ga0395900_0377578 | 3300037418 | Bacteria | 1386 |
| 297 | Ga0395898_0011123 | 3300037466 | Bacteria | 9369 |
| 298 | Ga0395898_0038411 | 3300037466 | Bacteria | 4745 |
| 299 | Ga0395898_0082048 | 3300037466 | Bacteria | 3108 |
| 300 | Ga0395905_0006436 | 3300037471 | Bacteria | 11822 |
| 301 | Ga0395905_0010549 | 3300037471 | Bacteria | 8973 |
| 302 | Ga0395905_0023632 | 3300037471 | Bacteria | 5804 |
| 303 | Ga0395905_0040113 | 3300037471 | Bacteria | 4392 |
| 304 | Ga0436364_0090740 | 3300037853 | Bacteria | 19290 |
| 305 | Ga0395901_0008259 | 3300038443 | Bacteria | 10518 |
| 306 | Ga0395901_0017527 | 3300038443 | Bacteria | 7310 |
| 307 | Ga0395901_0026202 | 3300038443 | Bacteria | 5985 |
| 308 | Ga0436365_1057834 | 3300039437 | Bacteria | 10797 |
| 309 | Ga0436365_1840295 | 3300039437 | Bacteria | 4566 |
| 310 | Ga0436360_0643628 | 3300039438 | Bacteria | 1637 |
| 311 | Ga0436362_0590305 | 3300039453 | Bacteria | 2001 |
| 312 | Ga0439441_009775 | 3300042001 | Unclassified | 1596 |
| 313 | Ga0439441_010504 | 3300042001 | Bacteria | 1554 |
| 314 | Ga0439462_0023976 | 3300042015 | Bacteria | 1600 |
| 315 | Ga0466966_0060336 | 3300044684 | Bacteria | 2394 |
| 316 | Ga0466961_0177773 | 3300044693 | Bacteria | 1322 |
| 317 | Ga0466963_0058327 | 3300044694 | Bacteria | 2574 |
| 318 | Ga0466963_0244105 | 3300044694 | Bacteria | 1260 |
| 319 | Ga0466958_0029379 | 3300045836 | Bacteria | 3262 |
| 320 | Ga0495617_019606 | 3300046452 | Bacteria | 2287 |
| 321 | Ga0495592_0017995 | 3300046454 | Bacteria | 5368 |
| 322 | Ga0495592_0040377 | 3300046454 | Bacteria | 3502 |
| 323 | Ga0495592_0050242 | 3300046454 | Bacteria | 3098 |
| 324 | Ga0495603_0000330 | 3300046455 | Bacteria | 25593 |
| 325 | Ga0495603_0005314 | 3300046455 | Bacteria | 7681 |
| 326 | Ga0495603_0054895 | 3300046455 | Bacteria | 2361 |
| 327 | Ga0495603_0092736 | 3300046455 | Bacteria | 1765 |
| 328 | Ga0495590_0001091 | 3300046457 | Bacteria | 11939 |
| 329 | Ga0495629_0000360 | 3300046459 | Bacteria | 38561 |
| 330 | Ga0495629_0002194 | 3300046459 | Bacteria | 15062 |
| 331 | Ga0495629_0039597 | 3300046459 | Bacteria | 3316 |
| 332 | Ga0495638_0001509 | 3300046460 | Bacteria | 20944 |
| 333 | Ga0495638_0022139 | 3300046460 | Bacteria | 4175 |
| 334 | Ga0495641_0005597 | 3300046461 | Bacteria | 8413 |
| 335 | Ga0495651_0001419 | 3300046462 | Bacteria | 18593 |
| 336 | Ga0495651_0018674 | 3300046462 | Bacteria | 5372 |
| 337 | Ga0495653_0002720 | 3300046463 | Bacteria | 14082 |
| 338 | Ga0495653_0061303 | 3300046463 | Bacteria | 2846 |
| 339 | Ga0495580_0001688 | 3300046472 | Bacteria | 19386 |
| 340 | Ga0495580_0048851 | 3300046472 | Bacteria | 2993 |
| 341 | Ga0495582_0000214 | 3300046473 | Bacteria | 32147 |
| 342 | Ga0495639_0000015 | 3300046475 | Bacteria | 80742 |
| 343 | Ga0495662_0004450 | 3300046476 | Bacteria | 7039 |
| 344 | Ga0495664_0006096 | 3300046477 | Bacteria | 6653 |
| 345 | Ga0495664_0016059 | 3300046477 | Bacteria | 4264 |
| 346 | Ga0495584_0006973 | 3300046491 | Bacteria | 5902 |
| 347 | Ga0495585_0013737 | 3300046492 | Bacteria | 4731 |
| 348 | Ga0495594_0001132 | 3300046499 | Bacteria | 13911 |
| 349 | Ga0495607_0023605 | 3300046501 | Bacteria | 3847 |
| 350 | Ga0495608_0002889 | 3300046511 | Bacteria | 12309 |
| 351 | Ga0495618_0037363 | 3300046514 | Bacteria | 3049 |
| 352 | Ga0495618_0085006 | 3300046514 | Bacteria | 2022 |
| 353 | Ga0495618_0147532 | 3300046514 | Bacteria | 1503 |
| 354 | Ga0495628_0005140 | 3300046516 | Bacteria | 11501 |
| 355 | Ga0495628_0049598 | 3300046516 | Bacteria | 3324 |
| 356 | Ga0495666_0034357 | 3300046526 | Bacteria | 2475 |
| 357 | Ga0495652_0022735 | 3300046529 | Bacteria | 5564 |
| 358 | Ga0495652_0025881 | 3300046529 | Bacteria | 5184 |
| 359 | Ga0495652_0026618 | 3300046529 | Bacteria | 5106 |
| 360 | Ga0495665_0030800 | 3300046531 | Bacteria | 2870 |
| 361 | Ga0495665_0067466 | 3300046531 | Bacteria | 1887 |
| 362 | Ga0495640_0005334 | 3300046533 | Bacteria | 10222 |
| 363 | Ga0495640_0012625 | 3300046533 | Bacteria | 6448 |
| 364 | Ga0495587_0022631 | 3300046536 | Bacteria | 3868 |
| 365 | Ga0495645_0016180 | 3300046543 | Bacteria | 5319 |
| 366 | Ga0495622_0002296 | 3300046557 | Bacteria | 9301 |
| 367 | Ga0495622_0084162 | 3300046557 | Unclassified | 1463 |
| 368 | Ga0495633_0002471 | 3300046558 | Bacteria | 13043 |
| 369 | Ga0495667_0066680 | 3300046559 | Bacteria | 2352 |
| 370 | Ga0495656_0038771 | 3300046615 | Bacteria | 1975 |
| 371 | Ga0495634_0000395 | 3300046642 | Bacteria | 42803 |
| 372 | Ga0495634_0053495 | 3300046642 | Bacteria | 2704 |
| 373 | Ga0495611_0003355 | 3300046648 | Bacteria | 7069 |
| 374 | Ga0495635_0001940 | 3300046663 | Bacteria | 14058 |
| 375 | Ga0495635_0004397 | 3300046663 | Bacteria | 9763 |
| 376 | Ga0495588_0016953 | 3300046674 | Bacteria | 3529 |
| 377 | Ga0495599_0012882 | 3300046678 | Bacteria | 5161 |
| 378 | Ga0495623_0011556 | 3300046679 | Bacteria | 5715 |
| 379 | Ga0495646_0015943 | 3300046680 | Bacteria | 4769 |
| 380 | Ga0495647_0004081 | 3300046681 | Bacteria | 4719 |
| 381 | Ga0495647_0006287 | 3300046681 | Bacteria | 3925 |
| 382 | Ga0495658_0000342 | 3300046683 | Bacteria | 26121 |
| 383 | Ga0495658_0034320 | 3300046683 | Bacteria | 2783 |
| 384 | Ga0495669_0017715 | 3300046684 | Bacteria | 3059 |
| 385 | Ga0495624_0004344 | 3300046690 | Bacteria | 10397 |
| 386 | Ga0495670_0000506 | 3300046691 | Bacteria | 18484 |
| 387 | Ga0495600_0002710 | 3300046809 | Bacteria | 10246 |
| 388 | Ga0495600_0033194 | 3300046809 | Bacteria | 3350 |
| 389 | Ga0495660_0026829 | 3300046810 | Bacteria | 3261 |
| 390 | Ga0495581_0000341 | 3300047315 | Bacteria | 23276 |
| 391 | Ga0495581_0062151 | 3300047315 | Bacteria | 2157 |
| 392 | Ga0495604_0039197 | 3300047317 | Bacteria | 3724 |
| 393 | Ga0495604_0124156 | 3300047317 | Bacteria | 1864 |
| 394 | Ga0495674_0000557 | 3300047319 | Bacteria | 34594 |
| 395 | Ga0495676_0140072 | 3300047321 | Bacteria | 1734 |
| 396 | Ga0495680_0026905 | 3300047322 | Bacteria | 4734 |
| 397 | Ga0495680_0036768 | 3300047322 | Bacteria | 3927 |
| 398 | Ga0495675_0004080 | 3300047444 | Bacteria | 8846 |
| 399 | Ga0495684_0003481 | 3300047471 | Bacteria | 12321 |
| 400 | Ga0495593_0000506 | 3300047673 | Bacteria | 22030 |
| 401 | Ga0495593_0008924 | 3300047673 | Bacteria | 5819 |
| 402 | Ga0495602_0140416 | 3300048088 | Bacteria | 1913 |
| 403 | Ga0496100_0025612 | 3300048903 | Bacteria | 3609 |
| 404 | Ga0496101_0192699 | 3300048904 | Bacteria | 1573 |
| 405 | Ga0496102_0002938 | 3300048905 | Bacteria | 14454 |
| 406 | Ga0496103_0077578 | 3300048906 | Bacteria | 2085 |
| 407 | Ga0496104_0066997 | 3300048907 | Bacteria | 3410 |
| 408 | Ga0496105_0328864 | 3300048908 | Bacteria | 1224 |
| 409 | Ga0496106_0005045 | 3300048909 | Bacteria | 9767 |
| 410 | Ga0496106_0084266 | 3300048909 | Bacteria | 2445 |
| 411 | Ga0496109_0000526 | 3300048912 | Bacteria | 32410 |
| 412 | Ga0496110_0061140 | 3300048913 | Bacteria | 3324 |
| 413 | Ga0496113_0006619 | 3300048916 | Bacteria | 7370 |
| 414 | Ga0496114_0017211 | 3300048917 | Bacteria | 5831 |
| 415 | Ga0496115_0017888 | 3300048918 | Bacteria | 5429 |
| 416 | Ga0496118_0010928 | 3300048921 | Bacteria | 8928 |
| 417 | Ga0496121_0003152 | 3300048924 | Bacteria | 23785 |
| 418 | Ga0496124_0055132 | 3300048927 | Bacteria | 3361 |
| 419 | Ga0496125_0057140 | 3300048928 | Bacteria | 3163 |
| 420 | Ga0501292_000864 | 3300049515 | Bacteria | 3675 |
| 421 | Ga0501297_004421 | 3300049520 | Bacteria | 1439 |
| 422 | Ga0501033_0045452 | 3300049570 | Bacteria | 3268 |
| 423 | Ga0501037_0075080 | 3300049573 | Bacteria | 2456 |
| 424 | Ga0501037_0110159 | 3300049573 | Bacteria | 1984 |
| 425 | Ga0501038_0017412 | 3300049574 | Bacteria | 6495 |
| 426 | Ga0501039_0033014 | 3300049575 | Bacteria | 3993 |
| 427 | Ga0501043_0051850 | 3300049579 | Bacteria | 3224 |
| 428 | Ga0501046_0112657 | 3300049580 | Bacteria | 2077 |
| 429 | Ga0501047_0054534 | 3300049581 | Bacteria | 3866 |
| 430 | Ga0501069_0001498 | 3300049585 | Bacteria | 11535 |
| 431 | Ga0501070_0003380 | 3300049586 | Bacteria | 13841 |
| 432 | Ga0501070_0089757 | 3300049586 | Bacteria | 2543 |
| 433 | Ga0501072_0076043 | 3300049588 | Bacteria | 2656 |
| 434 | Ga0501076_0025564 | 3300049592 | Bacteria | 4571 |
| 435 | Ga0501077_0037920 | 3300049593 | Bacteria | 3069 |
| 436 | Ga0501206_001805 | 3300049653 | Bacteria | 2689 |
| 437 | Ga0501080_0121335 | 3300049742 | Bacteria | 2422 |
| 438 | Ga0501080_0437240 | 3300049742 | Bacteria | 1174 |
| 439 | Ga0501035_0043346 | 3300049822 | Bacteria | 4055 |
| 440 | Ga0501044_0008608 | 3300049823 | Bacteria | 11172 |
| 441 | nmdc:mga0yw44_52348_c1 | 3300050492 | Bacteria | 1560 |
| 442 | nmdc:mga07m45_104347_c1 | 3300050496 | Bacteria | 1630 |
| 443 | nmdc:mga05p37_297643_c1 | 3300050507 | Bacteria | 1918 |
| 444 | nmdc:mga05p37_306435_c1 | 3300050507 | Bacteria | 1884 |
| 445 | nmdc:mga09592_45218_c1 | 3300050508 | Bacteria | 3708 |
| 446 | nmdc:mga09592_59208_c1 | 3300050508 | Bacteria | 3238 |
| 447 | nmdc:mga08y16_13657_c1 | 3300050511 | Bacteria | 8551 |
| 448 | nmdc:mga08y16_160037_c1 | 3300050511 | Bacteria | 2339 |
| 449 | nmdc:mga0n895_230371_c1 | 3300050512 | Bacteria | 1880 |
| 450 | nmdc:mga0n895_35890_c1 | 3300050512 | Bacteria | 4784 |
| 451 | nmdc:mga0a205_267834_c1 | 3300050515 | Bacteria | 1586 |
| 452 | Ga0495601_0014495 | 3300053077 | Bacteria | 4751 |
| 453 | Ga0495601_0042533 | 3300053077 | Bacteria | 2850 |
| 454 | Ga0495612_0004598 | 3300053078 | Bacteria | 5719 |
| 455 | Ga0495595_0002007 | 3300053084 | Bacteria | 7907 |
| 456 | Ga0495595_0003084 | 3300053084 | Bacteria | 6589 |
| 457 | Ga0495595_0122718 | 3300053084 | Bacteria | 1266 |
| 458 | Ga0495619_0004943 | 3300053085 | Bacteria | 8466 |
| 459 | Ga0495619_0005997 | 3300053085 | Bacteria | 7693 |
| 460 | Ga0495619_0267305 | 3300053085 | Bacteria | 1185 |
| 461 | Ga0500643_022872 | 3300053087 | Bacteria | 2005 |
| 462 | Ga0500644_0000369 | 3300053088 | Bacteria | 22061 |
| 463 | Ga0500651_0006191 | 3300053093 | Bacteria | 6878 |
| 464 | Ga0500554_000492 | 3300053102 | Bacteria | 8231 |
| 465 | Ga0500562_024810 | 3300053108 | Bacteria | 1568 |
| 466 | Ga0500593_000200 | 3300053117 | Bacteria | 24380 |
| 467 | Ga0500593_001572 | 3300053117 | Bacteria | 8219 |
| 468 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 469 | Ga0500559_0006508 | 3300053136 | Bacteria | 5272 |
| 470 | Ga0500603_002062 | 3300053150 | Bacteria | 4442 |
| 471 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 472 | Ga0500627_0084056 | 3300053158 | Bacteria | 1421 |
| 473 | Ga0500638_135957 | 3300053162 | Bacteria | 1109 |
| 474 | Ga0500636_0119783 | 3300053177 | Bacteria | 1477 |
| 475 | Ga0500636_0139240 | 3300053177 | Bacteria | 1344 |
| 476 | Ga0500637_0012749 | 3300053178 | Bacteria | 4388 |
| 477 | Ga0500645_000143 | 3300053730 | Bacteria | 56081 |
| 478 | Ga0500596_001432 | 3300053735 | Bacteria | 4828 |
| 479 | Ga0466962_0031493 | 3300061719 | Bacteria | 2539 |
| 480 | Ga0530510_0379192 | 3300061734 | Bacteria | 1064 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021388 | Ga0213875_10000074 | Ga0213875_1000007438 | 262 |
| 2 | 3300037853 | Ga0436364_0090740 | Ga0436364_0090740_7253_8044 | 262 |
| 3 | 3300025939 | Ga0207665_10144576 | Ga0207665_101445762 | 268 |
| 4 | 3300050507 | nmdc:mga05p37_306435_c1 | nmdc:mga05p37_306435_c1_958_1860 | 290 |
| 5 | 3300034817 | Ga0373948_0016849 | Ga0373948_0016849_421_1302 | 293 |
| 6 | 3300034818 | Ga0373950_0021004 | Ga0373950_0021004_48_929 | 293 |
| 7 | 3300006195 | Ga0075366_10073217 | Ga0075366_100732172 | 298 |
| 8 | 3300042001 | Ga0439441_010504 | Ga0439441_010504_117_1076 | 300 |
| 9 | 3300034818 | Ga0373950_0024155 | Ga0373950_0024155_85_1056 | 301 |
| 10 | 3300049515 | Ga0501292_000864 | Ga0501292_000864_1660_2619 | 301 |
| 11 | 3300049520 | Ga0501297_004421 | Ga0501297_004421_84_1043 | 301 |
| 12 | 3300049653 | Ga0501206_001805 | Ga0501206_001805_1479_2438 | 301 |
| 13 | 3300046460 | Ga0495638_0022139 | Ga0495638_0022139_110_1087 | 303 |
| 14 | 3300053093 | Ga0500651_0006191 | Ga0500651_0006191_2112_3089 | 303 |
| 15 | 3300053119 | Ga0500595_000029 | Ga0500595_000029_92968_93945 | 303 |
| 16 | 3300009551 | Ga0105238_10020559 | Ga0105238_100205594 | 304 |
| 17 | 3300025924 | Ga0207694_10048895 | Ga0207694_100488952 | 304 |
| 18 | 3300026121 | Ga0207683_10107760 | Ga0207683_101077602 | 304 |
| 19 | 3300039438 | Ga0436360_0643628 | Ga0436360_0643628_138_1067 | 304 |
| 20 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_208113_209156 | 304 |
| 21 | 3300005327 | Ga0070658_10007426 | Ga0070658_100074265 | 305 |
| 22 | 3300028786 | Ga0307517_10128300 | Ga0307517_101283002 | 307 |
| 23 | 3300031730 | Ga0307516_10003289 | Ga0307516_100032892 | 307 |
| 24 | 3300046514 | Ga0495618_0037363 | Ga0495618_0037363_1424_2350 | 308 |
| 25 | 3300037471 | Ga0395905_0040113 | Ga0395905_0040113_2994_3941 | 312 |
| 26 | 3300049585 | Ga0501069_0001498 | Ga0501069_0001498_289_1254 | 312 |
| 27 | 3300049586 | Ga0501070_0089757 | Ga0501070_0089757_1525_2490 | 312 |
| 28 | 3300053087 | Ga0500643_022872 | Ga0500643_022872_68_1129 | 312 |
| 29 | 3300005617 | Ga0068859_100184370 | Ga0068859_1001843702 | 313 |
| 30 | 3300006844 | Ga0075428_100011535 | Ga0075428_1000115355 | 313 |
| 31 | 3300006880 | Ga0075429_100060201 | Ga0075429_1000602013 | 313 |
| 32 | 3300006931 | Ga0097620_100184370 | Ga0097620_1001843702 | 313 |
| 33 | 3300009094 | Ga0111539_10050272 | Ga0111539_100502722 | 313 |
| 34 | 3300009094 | Ga0111539_10103863 | Ga0111539_101038634 | 313 |
| 35 | 3300027907 | Ga0207428_10007064 | Ga0207428_100070645 | 313 |
| 36 | 3300031711 | Ga0265314_10000577 | Ga0265314_1000057745 | 313 |
| 37 | 3300050508 | nmdc:mga09592_45218_c1 | nmdc:mga09592_45218_c1_1856_2821 | 313 |
| 38 | 3300050511 | nmdc:mga08y16_13657_c1 | nmdc:mga08y16_13657_c1_3427_4392 | 313 |
| 39 | 3300053084 | Ga0495595_0122718 | Ga0495595_0122718_142_1083 | 313 |
| 40 | 3300053085 | Ga0495619_0267305 | Ga0495619_0267305_21_962 | 313 |
| 41 | 3300005295 | Ga0065707_10120544 | Ga0065707_101205442 | 314 |
| 42 | 3300007265 | Ga0099794_10001140 | Ga0099794_100011402 | 314 |
| 43 | 3300007788 | Ga0099795_10004330 | Ga0099795_100043303 | 314 |
| 44 | 3300007788 | Ga0099795_10030630 | Ga0099795_100306302 | 314 |
| 45 | 3300007788 | Ga0099795_10064183 | Ga0099795_100641832 | 314 |
| 46 | 3300010159 | Ga0099796_10001257 | Ga0099796_100012572 | 314 |
| 47 | 3300025925 | Ga0207650_10443922 | Ga0207650_104439221 | 314 |
| 48 | 3300042001 | Ga0439441_009775 | Ga0439441_009775_518_1486 | 314 |
| 49 | 3300050512 | nmdc:mga0n895_230371_c1 | nmdc:mga0n895_230371_c1_225_1169 | 314 |
| 50 | 3300006871 | Ga0075434_100008346 | Ga0075434_10000834610 | 315 |
| 51 | 3300026116 | Ga0207674_10393574 | Ga0207674_103935741 | 315 |
| 52 | 3300050512 | nmdc:mga0n895_35890_c1 | nmdc:mga0n895_35890_c1_394_1374 | 315 |
| 53 | 3300053088 | Ga0500644_0000369 | Ga0500644_0000369_10034_11011 | 315 |
| 54 | 3300053730 | Ga0500645_000143 | Ga0500645_000143_18865_19836 | 315 |
| 55 | 3300003322 | rootL2_10140712 | rootL2_101407121 | 316 |
| 56 | 3300003322 | rootL2_10156181 | rootL2_101561813 | 316 |
| 57 | 3300005546 | Ga0070696_100081624 | Ga0070696_1000816243 | 316 |
| 58 | 3300005549 | Ga0070704_100171379 | Ga0070704_1001713791 | 316 |
| 59 | 3300005983 | Ga0081540_1003471 | Ga0081540_10034719 | 316 |
| 60 | 3300006177 | Ga0075362_10039145 | Ga0075362_100391451 | 316 |
| 61 | 3300026142 | Ga0207698_10396613 | Ga0207698_103966132 | 316 |
| 62 | 3300037418 | Ga0395900_0215484 | Ga0395900_0215484_358_1320 | 316 |
| 63 | 3300037471 | Ga0395905_0023632 | Ga0395905_0023632_3300_4262 | 316 |
| 64 | 3300038443 | Ga0395901_0017527 | Ga0395901_0017527_4511_5473 | 316 |
| 65 | 3300042015 | Ga0439462_0023976 | Ga0439462_0023976_161_1120 | 316 |
| 66 | 3300050511 | nmdc:mga08y16_160037_c1 | nmdc:mga08y16_160037_c1_517_1518 | 316 |
| 67 | 3300053117 | Ga0500593_000200 | Ga0500593_000200_15929_16888 | 316 |
| 68 | 3300053158 | Ga0500627_0084056 | Ga0500627_0084056_182_1141 | 316 |
| 69 | 3300005329 | Ga0070683_100131057 | Ga0070683_1001310572 | 317 |
| 70 | 3300005336 | Ga0070680_100110307 | Ga0070680_1001103071 | 317 |
| 71 | 3300005535 | Ga0070684_100365875 | Ga0070684_1003658751 | 317 |
| 72 | 3300006173 | Ga0070716_100047325 | Ga0070716_1000473252 | 317 |
| 73 | 3300006195 | Ga0075366_10067932 | Ga0075366_100679322 | 317 |
| 74 | 3300006880 | Ga0075429_100058668 | Ga0075429_1000586682 | 317 |
| 75 | 3300009093 | Ga0105240_10426285 | Ga0105240_104262851 | 317 |
| 76 | 3300013100 | Ga0157373_10150466 | Ga0157373_101504662 | 317 |
| 77 | 3300013104 | Ga0157370_10185261 | Ga0157370_101852612 | 317 |
| 78 | 3300013105 | Ga0157369_10432819 | Ga0157369_104328191 | 317 |
| 79 | 3300025911 | Ga0207654_10052267 | Ga0207654_100522672 | 317 |
| 80 | 3300025913 | Ga0207695_10264093 | Ga0207695_102640932 | 317 |
| 81 | 3300025915 | Ga0207693_10004725 | Ga0207693_1000472510 | 317 |
| 82 | 3300025917 | Ga0207660_10186500 | Ga0207660_101865001 | 317 |
| 83 | 3300025929 | Ga0207664_10304599 | Ga0207664_103045991 | 317 |
| 84 | 3300025939 | Ga0207665_10046601 | Ga0207665_100466012 | 317 |
| 85 | 3300031595 | Ga0265313_10000183 | Ga0265313_1000018348 | 317 |
| 86 | 3300035086 | Ga0373934_0033966 | Ga0373934_0033966_115_1092 | 317 |
| 87 | 3300035692 | Ga0373935_0170569 | Ga0373935_0170569_231_1208 | 317 |
| 88 | 3300036401 | Ga0373937_0003318 | Ga0373937_0003318_8745_9722 | 317 |
| 89 | 3300037471 | Ga0395905_0010549 | Ga0395905_0010549_4565_5536 | 317 |
| 90 | 3300044684 | Ga0466966_0060336 | Ga0466966_0060336_21_980 | 317 |
| 91 | 3300046457 | Ga0495590_0001091 | Ga0495590_0001091_4047_5018 | 317 |
| 92 | 3300046810 | Ga0495660_0026829 | Ga0495660_0026829_680_1651 | 317 |
| 93 | 3300049570 | Ga0501033_0045452 | Ga0501033_0045452_2160_3131 | 317 |
| 94 | 3300049573 | Ga0501037_0110159 | Ga0501037_0110159_769_1740 | 317 |
| 95 | 3300049574 | Ga0501038_0017412 | Ga0501038_0017412_4118_5089 | 317 |
| 96 | 3300049579 | Ga0501043_0051850 | Ga0501043_0051850_2237_3208 | 317 |
| 97 | 3300049580 | Ga0501046_0112657 | Ga0501046_0112657_32_1003 | 317 |
| 98 | 3300049581 | Ga0501047_0054534 | Ga0501047_0054534_1278_2249 | 317 |
| 99 | 3300049586 | Ga0501070_0003380 | Ga0501070_0003380_11686_12657 | 317 |
| 100 | 3300049742 | Ga0501080_0121335 | Ga0501080_0121335_1185_2156 | 317 |
| 101 | 3300049822 | Ga0501035_0043346 | Ga0501035_0043346_2356_3327 | 317 |
| 102 | 3300049823 | Ga0501044_0008608 | Ga0501044_0008608_4326_5297 | 317 |
| 103 | 3300053117 | Ga0500593_001572 | Ga0500593_001572_5643_6647 | 317 |
| 104 | 3300061734 | Ga0530510_0379192 | Ga0530510_0379192_16_987 | 317 |
| 105 | iso_pu_bacteria | 2643221599 | 2644008058 | 317 |
| 106 | iso_pu_bacteria | 2738541293 | 2738802969 | 317 |
| 107 | 3300044694 | Ga0466963_0058327 | Ga0466963_0058327_1086_2066 | 318 |
| 108 | 3300005354 | Ga0070675_100362631 | Ga0070675_1003626311 | 319 |
| 109 | 3300005834 | Ga0068851_10002190 | Ga0068851_100021906 | 319 |
| 110 | 3300031730 | Ga0307516_10023333 | Ga0307516_100233334 | 319 |
| 111 | 3300035118 | Ga0373954_0116940 | Ga0373954_0116940_166_1125 | 319 |
| 112 | 3300035170 | Ga0373943_0011057 | Ga0373943_0011057_376_1335 | 319 |
| 113 | 3300035692 | Ga0373935_0005223 | Ga0373935_0005223_1740_2699 | 319 |
| 114 | 3300035695 | Ga0373927_0007448 | Ga0373927_0007448_391_1350 | 319 |
| 115 | 3300035724 | Ga0373933_0264223 | Ga0373933_0264223_141_1100 | 319 |
| 116 | 3300036401 | Ga0373937_0058829 | Ga0373937_0058829_252_1211 | 319 |
| 117 | 3300037068 | Ga0373925_0014183 | Ga0373925_0014183_2942_3901 | 319 |
| 118 | 3300046454 | Ga0495592_0040377 | Ga0495592_0040377_202_1161 | 319 |
| 119 | 3300046455 | Ga0495603_0000330 | Ga0495603_0000330_20767_21726 | 319 |
| 120 | 3300046459 | Ga0495629_0000360 | Ga0495629_0000360_20488_21447 | 319 |
| 121 | 3300046461 | Ga0495641_0005597 | Ga0495641_0005597_3600_4559 | 319 |
| 122 | 3300046472 | Ga0495580_0001688 | Ga0495580_0001688_7895_8854 | 319 |
| 123 | 3300046473 | Ga0495582_0000214 | Ga0495582_0000214_17412_18371 | 319 |
| 124 | 3300046475 | Ga0495639_0000015 | Ga0495639_0000015_70299_71258 | 319 |
| 125 | 3300046476 | Ga0495662_0004450 | Ga0495662_0004450_3871_4830 | 319 |
| 126 | 3300046477 | Ga0495664_0016059 | Ga0495664_0016059_3072_4031 | 319 |
| 127 | 3300046499 | Ga0495594_0001132 | Ga0495594_0001132_8447_9406 | 319 |
| 128 | 3300046514 | Ga0495618_0085006 | Ga0495618_0085006_1012_1971 | 319 |
| 129 | 3300046516 | Ga0495628_0049598 | Ga0495628_0049598_355_1314 | 319 |
| 130 | 3300046526 | Ga0495666_0034357 | Ga0495666_0034357_872_1831 | 319 |
| 131 | 3300046529 | Ga0495652_0022735 | Ga0495652_0022735_274_1233 | 319 |
| 132 | 3300046531 | Ga0495665_0067466 | Ga0495665_0067466_750_1709 | 319 |
| 133 | 3300046557 | Ga0495622_0002296 | Ga0495622_0002296_3512_4471 | 319 |
| 134 | 3300046642 | Ga0495634_0000395 | Ga0495634_0000395_20975_21934 | 319 |
| 135 | 3300046663 | Ga0495635_0004397 | Ga0495635_0004397_7182_8141 | 319 |
| 136 | 3300046681 | Ga0495647_0004081 | Ga0495647_0004081_3639_4598 | 319 |
| 137 | 3300046683 | Ga0495658_0000342 | Ga0495658_0000342_17526_18485 | 319 |
| 138 | 3300046690 | Ga0495624_0004344 | Ga0495624_0004344_7095_8054 | 319 |
| 139 | 3300047315 | Ga0495581_0000341 | Ga0495581_0000341_15218_16177 | 319 |
| 140 | 3300047319 | Ga0495674_0000557 | Ga0495674_0000557_18247_19206 | 319 |
| 141 | 3300047673 | Ga0495593_0000506 | Ga0495593_0000506_5818_6777 | 319 |
| 142 | 3300049573 | Ga0501037_0075080 | Ga0501037_0075080_1450_2442 | 319 |
| 143 | 3300049742 | Ga0501080_0437240 | Ga0501080_0437240_76_1068 | 319 |
| 144 | 3300050508 | nmdc:mga09592_59208_c1 | nmdc:mga09592_59208_c1_513_1523 | 319 |
| 145 | 3300005336 | Ga0070680_100098670 | Ga0070680_1000986702 | 320 |
| 146 | 3300005366 | Ga0070659_100210918 | Ga0070659_1002109181 | 320 |
| 147 | 3300005530 | Ga0070679_100221413 | Ga0070679_1002214132 | 320 |
| 148 | 3300005535 | Ga0070684_100102246 | Ga0070684_1001022462 | 320 |
| 149 | 3300005539 | Ga0068853_100380224 | Ga0068853_1003802241 | 320 |
| 150 | 3300006358 | Ga0068871_100474222 | Ga0068871_1004742221 | 320 |
| 151 | 3300009093 | Ga0105240_10005557 | Ga0105240_1000555719 | 320 |
| 152 | 3300009101 | Ga0105247_10018268 | Ga0105247_100182684 | 320 |
| 153 | 3300013105 | Ga0157369_10095818 | Ga0157369_100958181 | 320 |
| 154 | 3300025912 | Ga0207707_10007276 | Ga0207707_100072761 | 320 |
| 155 | 3300025914 | Ga0207671_10059503 | Ga0207671_100595031 | 320 |
| 156 | 3300025917 | Ga0207660_10003129 | Ga0207660_100031292 | 320 |
| 157 | 3300025919 | Ga0207657_10003072 | Ga0207657_1000307210 | 320 |
| 158 | 3300025921 | Ga0207652_10007379 | Ga0207652_1000737910 | 320 |
| 159 | 3300025932 | Ga0207690_10169421 | Ga0207690_101694212 | 320 |
| 160 | 3300025949 | Ga0207667_10230191 | Ga0207667_102301911 | 320 |
| 161 | 3300030521 | Ga0307511_10081159 | Ga0307511_100811592 | 320 |
| 162 | 3300031507 | Ga0307509_10072301 | Ga0307509_100723013 | 320 |
| 163 | 3300031507 | Ga0307509_10082839 | Ga0307509_100828393 | 320 |
| 164 | 3300031730 | Ga0307516_10009900 | Ga0307516_100099007 | 320 |
| 165 | 3300033179 | Ga0307507_10023941 | Ga0307507_100239414 | 320 |
| 166 | 3300033180 | Ga0307510_10188073 | Ga0307510_101880733 | 320 |
| 167 | 3300035089 | Ga0373944_0005363 | Ga0373944_0005363_106_1068 | 320 |
| 168 | 3300035111 | Ga0373923_0016159 | Ga0373923_0016159_211_1173 | 320 |
| 169 | 3300035692 | Ga0373935_0040393 | Ga0373935_0040393_1599_2603 | 320 |
| 170 | 3300035695 | Ga0373927_0012964 | Ga0373927_0012964_1101_2063 | 320 |
| 171 | 3300036401 | Ga0373937_0019535 | Ga0373937_0019535_4498_5460 | 320 |
| 172 | 3300037068 | Ga0373925_0040564 | Ga0373925_0040564_482_1486 | 320 |
| 173 | 3300037068 | Ga0373925_0118423 | Ga0373925_0118423_1018_1980 | 320 |
| 174 | 3300037471 | Ga0395905_0006436 | Ga0395905_0006436_2367_3344 | 320 |
| 175 | 3300039437 | Ga0436365_1057834 | Ga0436365_1057834_2876_3862 | 320 |
| 176 | 3300039453 | Ga0436362_0590305 | Ga0436362_0590305_571_1557 | 320 |
| 177 | 3300044694 | Ga0466963_0244105 | Ga0466963_0244105_253_1242 | 320 |
| 178 | 3300046452 | Ga0495617_019606 | Ga0495617_019606_500_1462 | 320 |
| 179 | 3300046454 | Ga0495592_0050242 | Ga0495592_0050242_1301_2263 | 320 |
| 180 | 3300046455 | Ga0495603_0005314 | Ga0495603_0005314_465_1427 | 320 |
| 181 | 3300046459 | Ga0495629_0039597 | Ga0495629_0039597_672_1634 | 320 |
| 182 | 3300046462 | Ga0495651_0001419 | Ga0495651_0001419_17399_18361 | 320 |
| 183 | 3300046463 | Ga0495653_0002720 | Ga0495653_0002720_13086_14048 | 320 |
| 184 | 3300046472 | Ga0495580_0048851 | Ga0495580_0048851_1571_2533 | 320 |
| 185 | 3300046477 | Ga0495664_0006096 | Ga0495664_0006096_4702_5664 | 320 |
| 186 | 3300046491 | Ga0495584_0006973 | Ga0495584_0006973_873_1835 | 320 |
| 187 | 3300046492 | Ga0495585_0013737 | Ga0495585_0013737_2489_3451 | 320 |
| 188 | 3300046501 | Ga0495607_0023605 | Ga0495607_0023605_2198_3160 | 320 |
| 189 | 3300046529 | Ga0495652_0026618 | Ga0495652_0026618_2265_3227 | 320 |
| 190 | 3300046531 | Ga0495665_0030800 | Ga0495665_0030800_336_1298 | 320 |
| 191 | 3300046533 | Ga0495640_0005334 | Ga0495640_0005334_4881_5843 | 320 |
| 192 | 3300046557 | Ga0495622_0084162 | Ga0495622_0084162_244_1248 | 320 |
| 193 | 3300046558 | Ga0495633_0002471 | Ga0495633_0002471_10270_11232 | 320 |
| 194 | 3300046615 | Ga0495656_0038771 | Ga0495656_0038771_374_1336 | 320 |
| 195 | 3300046648 | Ga0495611_0003355 | Ga0495611_0003355_313_1275 | 320 |
| 196 | 3300046674 | Ga0495588_0016953 | Ga0495588_0016953_2124_3086 | 320 |
| 197 | 3300046681 | Ga0495647_0006287 | Ga0495647_0006287_1855_2817 | 320 |
| 198 | 3300046683 | Ga0495658_0034320 | Ga0495658_0034320_266_1228 | 320 |
| 199 | 3300046684 | Ga0495669_0017715 | Ga0495669_0017715_421_1383 | 320 |
| 200 | 3300046691 | Ga0495670_0000506 | Ga0495670_0000506_16114_17076 | 320 |
| 201 | 3300046809 | Ga0495600_0002710 | Ga0495600_0002710_7483_8445 | 320 |
| 202 | 3300047315 | Ga0495581_0062151 | Ga0495581_0062151_505_1467 | 320 |
| 203 | 3300047317 | Ga0495604_0039197 | Ga0495604_0039197_804_1766 | 320 |
| 204 | 3300047321 | Ga0495676_0140072 | Ga0495676_0140072_99_1061 | 320 |
| 205 | 3300047322 | Ga0495680_0026905 | Ga0495680_0026905_688_1650 | 320 |
| 206 | 3300048088 | Ga0495602_0140416 | Ga0495602_0140416_148_1110 | 320 |
| 207 | 3300048909 | Ga0496106_0005045 | Ga0496106_0005045_3546_4550 | 320 |
| 208 | 3300048921 | Ga0496118_0010928 | Ga0496118_0010928_2901_3905 | 320 |
| 209 | 3300048924 | Ga0496121_0003152 | Ga0496121_0003152_21789_22793 | 320 |
| 210 | 3300048927 | Ga0496124_0055132 | Ga0496124_0055132_368_1372 | 320 |
| 211 | 3300048928 | Ga0496125_0057140 | Ga0496125_0057140_1144_2148 | 320 |
| 212 | 3300053077 | Ga0495601_0042533 | Ga0495601_0042533_715_1677 | 320 |
| 213 | 3300053078 | Ga0495612_0004598 | Ga0495612_0004598_1637_2599 | 320 |
| 214 | 3300053084 | Ga0495595_0003084 | Ga0495595_0003084_2129_3091 | 320 |
| 215 | 3300053085 | Ga0495619_0005997 | Ga0495619_0005997_4930_5892 | 320 |
| 216 | 3300053136 | Ga0500559_0006508 | Ga0500559_0006508_3200_4204 | 320 |
| 217 | 3300053162 | Ga0500638_135957 | Ga0500638_135957_17_1021 | 320 |
| 218 | 3300053177 | Ga0500636_0119783 | Ga0500636_0119783_309_1313 | 320 |
| 219 | 3300053177 | Ga0500636_0139240 | Ga0500636_0139240_133_1137 | 320 |
| 220 | 3300053735 | Ga0500596_001432 | Ga0500596_001432_2756_3760 | 320 |
| 221 | 3300005339 | Ga0070660_100089523 | Ga0070660_1000895232 | 321 |
| 222 | 3300005436 | Ga0070713_100355796 | Ga0070713_1003557962 | 321 |
| 223 | 3300005530 | Ga0070679_100055816 | Ga0070679_1000558165 | 321 |
| 224 | 3300005563 | Ga0068855_100058537 | Ga0068855_1000585374 | 321 |
| 225 | 3300005614 | Ga0068856_100034102 | Ga0068856_1000341022 | 321 |
| 226 | 3300005616 | Ga0068852_100017529 | Ga0068852_1000175293 | 321 |
| 227 | 3300013105 | Ga0157369_10585536 | Ga0157369_105855362 | 321 |
| 228 | 3300025921 | Ga0207652_10047852 | Ga0207652_100478523 | 321 |
| 229 | 3300025949 | Ga0207667_10398860 | Ga0207667_103988601 | 321 |
| 230 | 3300025949 | Ga0207667_10661937 | Ga0207667_106619371 | 321 |
| 231 | 3300027671 | Ga0209588_1003420 | Ga0209588_10034202 | 321 |
| 232 | 3300031616 | Ga0307508_10000003 | Ga0307508_10000003163 | 321 |
| 233 | 3300033180 | Ga0307510_10018034 | Ga0307510_100180342 | 321 |
| 234 | 3300035111 | Ga0373923_0042573 | Ga0373923_0042573_773_1777 | 321 |
| 235 | 3300035118 | Ga0373954_0000584 | Ga0373954_0000584_8063_9067 | 321 |
| 236 | 3300035119 | Ga0373956_0002897 | Ga0373956_0002897_5259_6263 | 321 |
| 237 | 3300035120 | Ga0373957_0007168 | Ga0373957_0007168_1403_2407 | 321 |
| 238 | 3300035172 | Ga0373955_0012385 | Ga0373955_0012385_1670_2674 | 321 |
| 239 | 3300035695 | Ga0373927_0010805 | Ga0373927_0010805_463_1593 | 321 |
| 240 | 3300035724 | Ga0373933_0019974 | Ga0373933_0019974_158_1162 | 321 |
| 241 | 3300036401 | Ga0373937_0014040 | Ga0373937_0014040_3665_4669 | 321 |
| 242 | 3300046454 | Ga0495592_0017995 | Ga0495592_0017995_1812_2816 | 321 |
| 243 | 3300046459 | Ga0495629_0002194 | Ga0495629_0002194_2630_3634 | 321 |
| 244 | 3300046460 | Ga0495638_0001509 | Ga0495638_0001509_9780_10784 | 321 |
| 245 | 3300046462 | Ga0495651_0018674 | Ga0495651_0018674_1469_2473 | 321 |
| 246 | 3300046463 | Ga0495653_0061303 | Ga0495653_0061303_1612_2616 | 321 |
| 247 | 3300046511 | Ga0495608_0002889 | Ga0495608_0002889_1812_2816 | 321 |
| 248 | 3300046514 | Ga0495618_0147532 | Ga0495618_0147532_358_1362 | 321 |
| 249 | 3300046516 | Ga0495628_0005140 | Ga0495628_0005140_7005_8009 | 321 |
| 250 | 3300046529 | Ga0495652_0025881 | Ga0495652_0025881_1281_2285 | 321 |
| 251 | 3300046533 | Ga0495640_0012625 | Ga0495640_0012625_3154_4158 | 321 |
| 252 | 3300046536 | Ga0495587_0022631 | Ga0495587_0022631_1396_2400 | 321 |
| 253 | 3300046543 | Ga0495645_0016180 | Ga0495645_0016180_443_1447 | 321 |
| 254 | 3300046559 | Ga0495667_0066680 | Ga0495667_0066680_139_1143 | 321 |
| 255 | 3300046642 | Ga0495634_0053495 | Ga0495634_0053495_1319_2323 | 321 |
| 256 | 3300046663 | Ga0495635_0001940 | Ga0495635_0001940_9354_10358 | 321 |
| 257 | 3300046678 | Ga0495599_0012882 | Ga0495599_0012882_3473_4477 | 321 |
| 258 | 3300046679 | Ga0495623_0011556 | Ga0495623_0011556_1812_2816 | 321 |
| 259 | 3300046680 | Ga0495646_0015943 | Ga0495646_0015943_3500_4504 | 321 |
| 260 | 3300046809 | Ga0495600_0033194 | Ga0495600_0033194_2116_3120 | 321 |
| 261 | 3300047317 | Ga0495604_0124156 | Ga0495604_0124156_630_1634 | 321 |
| 262 | 3300047322 | Ga0495680_0036768 | Ga0495680_0036768_2069_3073 | 321 |
| 263 | 3300047444 | Ga0495675_0004080 | Ga0495675_0004080_7484_8488 | 321 |
| 264 | 3300047471 | Ga0495684_0003481 | Ga0495684_0003481_7891_8895 | 321 |
| 265 | 3300047673 | Ga0495593_0008924 | Ga0495593_0008924_4661_5665 | 321 |
| 266 | 3300049575 | Ga0501039_0033014 | Ga0501039_0033014_2839_3918 | 321 |
| 267 | 3300049588 | Ga0501072_0076043 | Ga0501072_0076043_289_1368 | 321 |
| 268 | 3300049592 | Ga0501076_0025564 | Ga0501076_0025564_2014_3093 | 321 |
| 269 | 3300049593 | Ga0501077_0037920 | Ga0501077_0037920_528_1607 | 321 |
| 270 | 3300050492 | nmdc:mga0yw44_52348_c1 | nmdc:mga0yw44_52348_c1_266_1270 | 321 |
| 271 | 3300053077 | Ga0495601_0014495 | Ga0495601_0014495_3482_4486 | 321 |
| 272 | 3300053084 | Ga0495595_0002007 | Ga0495595_0002007_4662_5666 | 321 |
| 273 | 3300053085 | Ga0495619_0004943 | Ga0495619_0004943_6811_7815 | 321 |
| 274 | 3300053102 | Ga0500554_000492 | Ga0500554_000492_15_1019 | 321 |
| 275 | 3300053150 | Ga0500603_002062 | Ga0500603_002062_1601_2605 | 321 |
| 276 | 3300053178 | Ga0500637_0012749 | Ga0500637_0012749_892_1896 | 321 |
| 277 | 3300003322 | rootL2_10019543 | rootL2_100195432 | 322 |
| 278 | 3300005436 | Ga0070713_100118313 | Ga0070713_1001183133 | 322 |
| 279 | 3300005439 | Ga0070711_100216314 | Ga0070711_1002163142 | 322 |
| 280 | 3300005937 | Ga0081455_10007525 | Ga0081455_100075259 | 322 |
| 281 | 3300006163 | Ga0070715_10082869 | Ga0070715_100828691 | 322 |
| 282 | 3300021384 | Ga0213876_10096403 | Ga0213876_100964032 | 322 |
| 283 | 3300025929 | Ga0207664_10407418 | Ga0207664_104074181 | 322 |
| 284 | 3300039437 | Ga0436365_1840295 | Ga0436365_1840295_678_1649 | 322 |
| 285 | 3300005937 | Ga0081455_10010928 | Ga0081455_100109287 | 323 |
| 286 | 3300005983 | Ga0081540_1001581 | Ga0081540_100158122 | 323 |
| 287 | 3300005983 | Ga0081540_1005915 | Ga0081540_10059152 | 323 |
| 288 | 3300005983 | Ga0081540_1012461 | Ga0081540_10124613 | 323 |
| 289 | 3300005983 | Ga0081540_1015842 | Ga0081540_10158424 | 323 |
| 290 | 3300005983 | Ga0081540_1018222 | Ga0081540_10182222 | 323 |
| 291 | 3300005983 | Ga0081540_1021249 | Ga0081540_10212494 | 323 |
| 292 | 3300005983 | Ga0081540_1029698 | Ga0081540_10296983 | 323 |
| 293 | 3300005983 | Ga0081540_1038766 | Ga0081540_10387662 | 323 |
| 294 | 3300005985 | Ga0081539_10071747 | Ga0081539_100717472 | 323 |
| 295 | 3300044693 | Ga0466961_0177773 | Ga0466961_0177773_233_1216 | 323 |
| 296 | 3300045836 | Ga0466958_0029379 | Ga0466958_0029379_217_1197 | 323 |
| 297 | 3300046455 | Ga0495603_0054895 | Ga0495603_0054895_961_1932 | 323 |
| 298 | 3300061719 | Ga0466962_0031493 | Ga0466962_0031493_1346_2326 | 323 |
| 299 | 3300006051 | Ga0075364_10180736 | Ga0075364_101807362 | 324 |
| 300 | 3300006353 | Ga0075370_10036860 | Ga0075370_100368602 | 324 |
| 301 | 3300009147 | Ga0114129_10444827 | Ga0114129_104448272 | 324 |
| 302 | 3300010159 | Ga0099796_10040397 | Ga0099796_100403972 | 324 |
| 303 | 3300031241 | Ga0265325_10018825 | Ga0265325_100188252 | 324 |
| 304 | 3300031712 | Ga0265342_10005221 | Ga0265342_100052216 | 324 |
| 305 | 3300050496 | nmdc:mga07m45_104347_c1 | nmdc:mga07m45_104347_c1_527_1531 | 324 |
| 306 | 3300050507 | nmdc:mga05p37_297643_c1 | nmdc:mga05p37_297643_c1_23_1024 | 324 |
| 307 | 3300053108 | Ga0500562_024810 | Ga0500562_024810_507_1502 | 324 |
| 308 | 3300005364 | Ga0070673_100180064 | Ga0070673_1001800642 | 325 |
| 309 | 3300005530 | Ga0070679_100039433 | Ga0070679_1000394333 | 325 |
| 310 | 3300025921 | Ga0207652_10023104 | Ga0207652_100231043 | 325 |
| 311 | 3300037312 | Ga0395899_0054057 | Ga0395899_0054057_971_1972 | 325 |
| 312 | 3300037418 | Ga0395900_0001761 | Ga0395900_0001761_6586_7587 | 325 |
| 313 | 3300037418 | Ga0395900_0054321 | Ga0395900_0054321_176_1264 | 325 |
| 314 | 3300037418 | Ga0395900_0377578 | Ga0395900_0377578_195_1196 | 325 |
| 315 | 3300037466 | Ga0395898_0011123 | Ga0395898_0011123_1677_2678 | 325 |
| 316 | 3300037466 | Ga0395898_0038411 | Ga0395898_0038411_909_1997 | 325 |
| 317 | 3300037466 | Ga0395898_0082048 | Ga0395898_0082048_310_1311 | 325 |
| 318 | 3300038443 | Ga0395901_0008259 | Ga0395901_0008259_6108_7109 | 325 |
| 319 | 3300038443 | Ga0395901_0026202 | Ga0395901_0026202_437_1438 | 325 |
| 320 | 3300001989 | JGI24739J22299_10000103 | JGI24739J22299_1000010319 | 326 |
| 321 | 3300001990 | JGI24737J22298_10001126 | JGI24737J22298_100011269 | 326 |
| 322 | 3300002070 | JGI24750J21931_1000146 | JGI24750J21931_10001465 | 326 |
| 323 | 3300002073 | JGI24745J21846_1000206 | JGI24745J21846_10002067 | 326 |
| 324 | 3300002074 | JGI24748J21848_1001081 | JGI24748J21848_10010813 | 326 |
| 325 | 3300002076 | JGI24749J21850_1001451 | JGI24749J21850_10014512 | 326 |
| 326 | 3300002126 | JGI24035J26624_1000077 | JGI24035J26624_10000773 | 326 |
| 327 | 3300002244 | JGI24742J22300_10000066 | JGI24742J22300_1000006617 | 326 |
| 328 | 3300002459 | JGI24751J29686_10016809 | JGI24751J29686_100168092 | 326 |
| 329 | 3300005293 | Ga0065715_10089784 | Ga0065715_100897848 | 326 |
| 330 | 3300005328 | Ga0070676_10014685 | Ga0070676_100146854 | 326 |
| 331 | 3300005329 | Ga0070683_100010341 | Ga0070683_1000103419 | 326 |
| 332 | 3300005330 | Ga0070690_100013073 | Ga0070690_1000130734 | 326 |
| 333 | 3300005331 | Ga0070670_100035000 | Ga0070670_1000350003 | 326 |
| 334 | 3300005334 | Ga0068869_100000236 | Ga0068869_10000023624 | 326 |
| 335 | 3300005335 | Ga0070666_10009878 | Ga0070666_100098785 | 326 |
| 336 | 3300005336 | Ga0070680_100056705 | Ga0070680_1000567052 | 326 |
| 337 | 3300005337 | Ga0070682_100002602 | Ga0070682_10000260211 | 326 |
| 338 | 3300005339 | Ga0070660_100003492 | Ga0070660_10000349211 | 326 |
| 339 | 3300005340 | Ga0070689_100000466 | Ga0070689_1000004662 | 326 |
| 340 | 3300005344 | Ga0070661_100000827 | Ga0070661_10000082713 | 326 |
| 341 | 3300005345 | Ga0070692_10002292 | Ga0070692_100022924 | 326 |
| 342 | 3300005353 | Ga0070669_100002399 | Ga0070669_10000239911 | 326 |
| 343 | 3300005354 | Ga0070675_100005703 | Ga0070675_1000057034 | 326 |
| 344 | 3300005355 | Ga0070671_100000736 | Ga0070671_1000007369 | 326 |
| 345 | 3300005364 | Ga0070673_100000302 | Ga0070673_1000003029 | 326 |
| 346 | 3300005365 | Ga0070688_100004878 | Ga0070688_1000048786 | 326 |
| 347 | 3300005366 | Ga0070659_100001555 | Ga0070659_1000015554 | 326 |
| 348 | 3300005367 | Ga0070667_100002272 | Ga0070667_1000022726 | 326 |
| 349 | 3300005440 | Ga0070705_100001212 | Ga0070705_10000121214 | 326 |
| 350 | 3300005441 | Ga0070700_100001313 | Ga0070700_1000013134 | 326 |
| 351 | 3300005444 | Ga0070694_100003865 | Ga0070694_10000386510 | 326 |
| 352 | 3300005456 | Ga0070678_100046577 | Ga0070678_1000465774 | 326 |
| 353 | 3300005458 | Ga0070681_10034348 | Ga0070681_100343484 | 326 |
| 354 | 3300005459 | Ga0068867_100001495 | Ga0068867_10000149517 | 326 |
| 355 | 3300005466 | Ga0070685_10008541 | Ga0070685_100085412 | 326 |
| 356 | 3300005530 | Ga0070679_100169447 | Ga0070679_1001694471 | 326 |
| 357 | 3300005535 | Ga0070684_100005932 | Ga0070684_10000593210 | 326 |
| 358 | 3300005539 | Ga0068853_100000919 | Ga0068853_1000009195 | 326 |
| 359 | 3300005543 | Ga0070672_100004500 | Ga0070672_10000450011 | 326 |
| 360 | 3300005544 | Ga0070686_100000488 | Ga0070686_1000004882 | 326 |
| 361 | 3300005545 | Ga0070695_100046428 | Ga0070695_1000464283 | 326 |
| 362 | 3300005546 | Ga0070696_100011190 | Ga0070696_1000111903 | 326 |
| 363 | 3300005547 | Ga0070693_100002155 | Ga0070693_10000215510 | 326 |
| 364 | 3300005548 | Ga0070665_100055383 | Ga0070665_1000553832 | 326 |
| 365 | 3300005549 | Ga0070704_100037444 | Ga0070704_1000374443 | 326 |
| 366 | 3300005564 | Ga0070664_100002753 | Ga0070664_1000027539 | 326 |
| 367 | 3300005577 | Ga0068857_100001539 | Ga0068857_10000153919 | 326 |
| 368 | 3300005578 | Ga0068854_100002718 | Ga0068854_10000271811 | 326 |
| 369 | 3300005614 | Ga0068856_100001722 | Ga0068856_1000017228 | 326 |
| 370 | 3300005615 | Ga0070702_100005389 | Ga0070702_1000053899 | 326 |
| 371 | 3300005616 | Ga0068852_100001817 | Ga0068852_10000181710 | 326 |
| 372 | 3300005617 | Ga0068859_100010286 | Ga0068859_1000102864 | 326 |
| 373 | 3300005618 | Ga0068864_100002498 | Ga0068864_1000024986 | 326 |
| 374 | 3300005718 | Ga0068866_10050277 | Ga0068866_100502772 | 326 |
| 375 | 3300005840 | Ga0068870_10000676 | Ga0068870_100006769 | 326 |
| 376 | 3300005842 | Ga0068858_100008130 | Ga0068858_1000081309 | 326 |
| 377 | 3300005843 | Ga0068860_100007431 | Ga0068860_10000743111 | 326 |
| 378 | 3300006852 | Ga0075433_10025232 | Ga0075433_100252322 | 326 |
| 379 | 3300006881 | Ga0068865_100000452 | Ga0068865_10000045222 | 326 |
| 380 | 3300006931 | Ga0097620_100010289 | Ga0097620_10001028910 | 326 |
| 381 | 3300009011 | Ga0105251_10036852 | Ga0105251_100368522 | 326 |
| 382 | 3300009094 | Ga0111539_10002712 | Ga0111539_1000271222 | 326 |
| 383 | 3300009098 | Ga0105245_10000380 | Ga0105245_1000038036 | 326 |
| 384 | 3300009101 | Ga0105247_10007787 | Ga0105247_100077875 | 326 |
| 385 | 3300009148 | Ga0105243_10002254 | Ga0105243_1000225418 | 326 |
| 386 | 3300009174 | Ga0105241_10000342 | Ga0105241_1000034222 | 326 |
| 387 | 3300009176 | Ga0105242_10000855 | Ga0105242_1000085520 | 326 |
| 388 | 3300009177 | Ga0105248_10012394 | Ga0105248_100123943 | 326 |
| 389 | 3300009553 | Ga0105249_10001982 | Ga0105249_100019829 | 326 |
| 390 | 3300010375 | Ga0105239_10012830 | Ga0105239_100128302 | 326 |
| 391 | 3300013100 | Ga0157373_10130306 | Ga0157373_101303062 | 326 |
| 392 | 3300013102 | Ga0157371_10011566 | Ga0157371_100115666 | 326 |
| 393 | 3300013296 | Ga0157374_10001986 | Ga0157374_1000198618 | 326 |
| 394 | 3300013297 | Ga0157378_10001729 | Ga0157378_1000172910 | 326 |
| 395 | 3300013306 | Ga0163162_10012026 | Ga0163162_1001202610 | 326 |
| 396 | 3300013307 | Ga0157372_10024601 | Ga0157372_100246012 | 326 |
| 397 | 3300013308 | Ga0157375_10001883 | Ga0157375_100018834 | 326 |
| 398 | 3300014325 | Ga0163163_10010785 | Ga0163163_100107852 | 326 |
| 399 | 3300014326 | Ga0157380_10034105 | Ga0157380_100341054 | 326 |
| 400 | 3300014745 | Ga0157377_10000643 | Ga0157377_1000064318 | 326 |
| 401 | 3300014968 | Ga0157379_10027375 | Ga0157379_100273754 | 326 |
| 402 | 3300014969 | Ga0157376_10000920 | Ga0157376_1000092019 | 326 |
| 403 | 3300017792 | Ga0163161_10000379 | Ga0163161_100003794 | 326 |
| 404 | 3300025271 | Ga0207666_1000046 | Ga0207666_10000467 | 326 |
| 405 | 3300025290 | Ga0207673_1000260 | Ga0207673_10002606 | 326 |
| 406 | 3300025315 | Ga0207697_10000714 | Ga0207697_100007144 | 326 |
| 407 | 3300025893 | Ga0207682_10002945 | Ga0207682_100029459 | 326 |
| 408 | 3300025900 | Ga0207710_10007775 | Ga0207710_100077752 | 326 |
| 409 | 3300025901 | Ga0207688_10000083 | Ga0207688_1000008335 | 326 |
| 410 | 3300025903 | Ga0207680_10122670 | Ga0207680_101226702 | 326 |
| 411 | 3300025904 | Ga0207647_10029321 | Ga0207647_100293213 | 326 |
| 412 | 3300025907 | Ga0207645_10002954 | Ga0207645_100029544 | 326 |
| 413 | 3300025908 | Ga0207643_10000128 | Ga0207643_1000012846 | 326 |
| 414 | 3300025911 | Ga0207654_10001559 | Ga0207654_100015597 | 326 |
| 415 | 3300025917 | Ga0207660_10001486 | Ga0207660_100014869 | 326 |
| 416 | 3300025918 | Ga0207662_10000301 | Ga0207662_1000030122 | 326 |
| 417 | 3300025919 | Ga0207657_10001859 | Ga0207657_1000185922 | 326 |
| 418 | 3300025920 | Ga0207649_10003562 | Ga0207649_1000356210 | 326 |
| 419 | 3300025921 | Ga0207652_10067763 | Ga0207652_100677632 | 326 |
| 420 | 3300025923 | Ga0207681_10039680 | Ga0207681_100396804 | 326 |
| 421 | 3300025925 | Ga0207650_10015442 | Ga0207650_100154423 | 326 |
| 422 | 3300025926 | Ga0207659_10000142 | Ga0207659_100001423 | 326 |
| 423 | 3300025927 | Ga0207687_10000667 | Ga0207687_1000066713 | 326 |
| 424 | 3300025931 | Ga0207644_10005279 | Ga0207644_1000527910 | 326 |
| 425 | 3300025932 | Ga0207690_10002854 | Ga0207690_100028542 | 326 |
| 426 | 3300025933 | Ga0207706_10004082 | Ga0207706_1000408214 | 326 |
| 427 | 3300025934 | Ga0207686_10000579 | Ga0207686_1000057913 | 326 |
| 428 | 3300025935 | Ga0207709_10000551 | Ga0207709_1000055131 | 326 |
| 429 | 3300025936 | Ga0207670_10000556 | Ga0207670_1000055620 | 326 |
| 430 | 3300025937 | Ga0207669_10000675 | Ga0207669_100006756 | 326 |
| 431 | 3300025940 | Ga0207691_10000599 | Ga0207691_1000059935 | 326 |
| 432 | 3300025942 | Ga0207689_10000165 | Ga0207689_1000016553 | 326 |
| 433 | 3300025944 | Ga0207661_10000744 | Ga0207661_100007445 | 326 |
| 434 | 3300025945 | Ga0207679_10000112 | Ga0207679_1000011253 | 326 |
| 435 | 3300025960 | Ga0207651_10000099 | Ga0207651_100000994 | 326 |
| 436 | 3300025961 | Ga0207712_10003302 | Ga0207712_100033024 | 326 |
| 437 | 3300025972 | Ga0207668_10144131 | Ga0207668_101441312 | 326 |
| 438 | 3300025981 | Ga0207640_10000320 | Ga0207640_100003202 | 326 |
| 439 | 3300026035 | Ga0207703_10014270 | Ga0207703_100142709 | 326 |
| 440 | 3300026041 | Ga0207639_10002883 | Ga0207639_100028837 | 326 |
| 441 | 3300026067 | Ga0207678_10001329 | Ga0207678_100013294 | 326 |
| 442 | 3300026075 | Ga0207708_10000862 | Ga0207708_100008624 | 326 |
| 443 | 3300026088 | Ga0207641_10001462 | Ga0207641_100014622 | 326 |
| 444 | 3300026089 | Ga0207648_10001891 | Ga0207648_100018914 | 326 |
| 445 | 3300026095 | Ga0207676_10001459 | Ga0207676_1000145919 | 326 |
| 446 | 3300026116 | Ga0207674_10006899 | Ga0207674_100068994 | 326 |
| 447 | 3300026118 | Ga0207675_100001575 | Ga0207675_1000015754 | 326 |
| 448 | 3300026121 | Ga0207683_10001273 | Ga0207683_100012734 | 326 |
| 449 | 3300027717 | Ga0209998_10009034 | Ga0209998_100090342 | 326 |
| 450 | 3300027876 | Ga0209974_10000708 | Ga0209974_100007089 | 326 |
| 451 | 3300027907 | Ga0207428_10000064 | Ga0207428_1000006424 | 326 |
| 452 | 3300028379 | Ga0268266_10040521 | Ga0268266_100405212 | 326 |
| 453 | 3300028380 | Ga0268265_10003386 | Ga0268265_1000338612 | 326 |
| 454 | 3300028381 | Ga0268264_10003086 | Ga0268264_1000308616 | 326 |
| 455 | 3300034816 | Ga0373930_0006202 | Ga0373930_0006202_577_1557 | 326 |
| 456 | 3300034819 | Ga0373958_0001446 | Ga0373958_0001446_1803_2783 | 326 |
| 457 | 3300034957 | Ga0373938_0031072 | Ga0373938_0031072_101_1081 | 326 |
| 458 | 3300035084 | Ga0373928_0003314 | Ga0373928_0003314_359_1339 | 326 |
| 459 | 3300035090 | Ga0373949_0001191 | Ga0373949_0001191_6417_7397 | 326 |
| 460 | 3300035114 | Ga0373939_0003074 | Ga0373939_0003074_2664_3644 | 326 |
| 461 | 3300035115 | Ga0373941_0001129 | Ga0373941_0001129_389_1369 | 326 |
| 462 | 3300035121 | Ga0373960_0001925 | Ga0373960_0001925_1098_2078 | 326 |
| 463 | 3300035171 | Ga0373946_0153969 | Ga0373946_0153969_29_1027 | 326 |
| 464 | 3300035207 | Ga0373942_0001663 | Ga0373942_0001663_2800_3780 | 326 |
| 465 | 3300035241 | Ga0373961_0009354 | Ga0373961_0009354_1005_1985 | 326 |
| 466 | 3300035242 | Ga0373962_0003305 | Ga0373962_0003305_11_991 | 326 |
| 467 | 3300035695 | Ga0373927_0086550 | Ga0373927_0086550_830_1828 | 326 |
| 468 | 3300035725 | Ga0373947_0037818 | Ga0373947_0037818_1472_2470 | 326 |
| 469 | 3300046455 | Ga0495603_0092736 | Ga0495603_0092736_61_1059 | 326 |
| 470 | 3300048903 | Ga0496100_0025612 | Ga0496100_0025612_837_1817 | 326 |
| 471 | 3300048904 | Ga0496101_0192699 | Ga0496101_0192699_367_1347 | 326 |
| 472 | 3300048905 | Ga0496102_0002938 | Ga0496102_0002938_5361_6341 | 326 |
| 473 | 3300048906 | Ga0496103_0077578 | Ga0496103_0077578_589_1569 | 326 |
| 474 | 3300048907 | Ga0496104_0066997 | Ga0496104_0066997_1869_2849 | 326 |
| 475 | 3300048908 | Ga0496105_0328864 | Ga0496105_0328864_218_1198 | 326 |
| 476 | 3300048909 | Ga0496106_0084266 | Ga0496106_0084266_1199_2179 | 326 |
| 477 | 3300048912 | Ga0496109_0000526 | Ga0496109_0000526_7013_7993 | 326 |
| 478 | 3300048913 | Ga0496110_0061140 | Ga0496110_0061140_917_1897 | 326 |
| 479 | 3300048916 | Ga0496113_0006619 | Ga0496113_0006619_2503_3483 | 326 |
| 480 | 3300048917 | Ga0496114_0017211 | Ga0496114_0017211_2010_2990 | 326 |
| 481 | 3300048918 | Ga0496115_0017888 | Ga0496115_0017888_3931_4911 | 326 |
| 482 | 3300050515 | nmdc:mga0a205_267834_c1 | nmdc:mga0a205_267834_c1_300_1280 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9633 | 31 | 325 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9569 | 31 | 325 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.956 | 34 | 322 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.951 | 30 | 325 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9478 | 30 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9459 | 128 | 244 | 3.40.190.10 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9256 | 30 | 325 | 3.40.190.150 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9245 | 30 | 325 | 3.40.190.150 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9203 | 30 | 325 | 3.40.190.150 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9163 | 128 | 249 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536SFT4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.975 | 57 | 325 |
|
| AF-A0A4Q7NEM1-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.9727 | 30 | 325 |
|
| AF-A0A7D4HSB6-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9723 | 31 | 324 |
|
| AF-A0A537VTQ8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9703 | 42 | 325 |
|
| AF-A0A7H0GIP4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9703 | 55 | 325 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar