F451525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 476 | 333 | 950 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10012272|Ga0157378_100122726 |
| Length | 308 |
| Sequence | MLASCLHGVGDSGSESGSATGTGSVIWITVAYCARDAADAKCGAVRGNSDMASQRGRSTNLQAPYLRRVWLDAERVSDPEAYPFCLPFLRDEFELEFDSAVTIVVGENGTGKSTLLEGIAVLAGYHDSGGGKGYTTVDDTWAMEKTGAELSKALRASWLPKVTNGWFFRAESFFSVARYLDQMAQQYPMGGGPPPDYLSHSHGEGFLRFFEERCRKQGIFIFDEPESALSPSRQIEFLKLLRRMDQSGICQVIMATHSPMLMAYPNARLLRLSKYGLEQVTVRETDHYKVMREFCEDPDGFVQAAIEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 52 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 77 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 78 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 79 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 80 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 81 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 139 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 140 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 141 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 158 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 162 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 260 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 274 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 277 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 279 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 280 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 282 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 287 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 291 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 293 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 294 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 297 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 298 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 299 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 300 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 301 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 302 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 303 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 304 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 305 | 2791355199 | |||
| 306 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 307 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 308 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 309 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 310 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 311 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 312 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 313 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 314 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 315 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 316 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 317 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 318 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 319 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 320 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 321 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 322 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 323 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 324 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 325 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 326 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 327 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 328 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 329 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 330 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 331 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 332 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 333 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.21 |
| Metatranscriptomes | 0 |
| Isolates | 7.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.03 |
| Nodule | 5.67 |
| Rhizoplane | 1.68 |
| Rhizosphere | 65.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10012272 | 3300013297 | Bacteria | 7500 |
| 2 | RicEn_C3328 | 2010549000 | Bacteria | 1820 |
| 3 | JGI25159J45721_1003651 | 3300002987 | Bacteria | 5349 |
| 4 | JGI25153J46596_10001368 | 3300003215 | Bacteria | 14592 |
| 5 | JGI25153J46596_10055339 | 3300003215 | Bacteria | 1110 |
| 6 | rootH1_10105374 | 3300003316 | Bacteria | 1426 |
| 7 | rootL2_10217417 | 3300003322 | Bacteria | 1288 |
| 8 | JGI25160J50197_1002759 | 3300003354 | Bacteria | 8049 |
| 9 | Ga0065165_1043635 | 3300005262 | Bacteria | 1315 |
| 10 | Ga0070658_10162266 | 3300005327 | Bacteria | 1875 |
| 11 | Ga0070683_100020570 | 3300005329 | Bacteria | 5872 |
| 12 | Ga0068869_100218203 | 3300005334 | Bacteria | 1510 |
| 13 | Ga0070680_100004196 | 3300005336 | Bacteria | 10806 |
| 14 | Ga0070680_100006163 | 3300005336 | Bacteria | 9091 |
| 15 | Ga0070680_100200286 | 3300005336 | Bacteria | 1684 |
| 16 | Ga0070680_100244539 | 3300005336 | Bacteria | 1517 |
| 17 | Ga0070682_100517002 | 3300005337 | Bacteria | 928 |
| 18 | Ga0070660_100162801 | 3300005339 | Bacteria | 1798 |
| 19 | Ga0070661_100223521 | 3300005344 | Bacteria | 1445 |
| 20 | Ga0070661_100343477 | 3300005344 | Bacteria | 1170 |
| 21 | Ga0070675_100674737 | 3300005354 | Bacteria | 940 |
| 22 | Ga0070659_100079520 | 3300005366 | Bacteria | 2617 |
| 23 | Ga0070659_100185679 | 3300005366 | Bacteria | 1707 |
| 24 | Ga0070667_100075019 | 3300005367 | Bacteria | 2886 |
| 25 | Ga0070667_100729316 | 3300005367 | Unclassified | 918 |
| 26 | Ga0070709_10004552 | 3300005434 | Bacteria | 7487 |
| 27 | Ga0070714_100009562 | 3300005435 | Bacteria | 7629 |
| 28 | Ga0070713_100132925 | 3300005436 | Bacteria | 2196 |
| 29 | Ga0070713_100473060 | 3300005436 | Bacteria | 1180 |
| 30 | Ga0070710_10000370 | 3300005437 | Bacteria | 21096 |
| 31 | Ga0070711_100011526 | 3300005439 | Bacteria | 5494 |
| 32 | Ga0070705_100080260 | 3300005440 | Bacteria | 2001 |
| 33 | Ga0070663_100093294 | 3300005455 | Bacteria | 2233 |
| 34 | Ga0070663_100113575 | 3300005455 | Bacteria | 2039 |
| 35 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 36 | Ga0070681_10132950 | 3300005458 | Bacteria | 2419 |
| 37 | Ga0070681_10146732 | 3300005458 | Bacteria | 2288 |
| 38 | Ga0070685_10191109 | 3300005466 | Bacteria | 1325 |
| 39 | Ga0070706_100485968 | 3300005467 | Bacteria | 1149 |
| 40 | Ga0070679_100220543 | 3300005530 | Bacteria | 1857 |
| 41 | Ga0070684_100012263 | 3300005535 | Bacteria | 6864 |
| 42 | Ga0070684_100097677 | 3300005535 | Bacteria | 2620 |
| 43 | Ga0070697_100123650 | 3300005536 | Bacteria | 2166 |
| 44 | Ga0068853_100026902 | 3300005539 | Bacteria | 4833 |
| 45 | Ga0068853_100072121 | 3300005539 | Bacteria | 3009 |
| 46 | Ga0068853_100341798 | 3300005539 | Bacteria | 1391 |
| 47 | Ga0068853_100386289 | 3300005539 | Bacteria | 1308 |
| 48 | Ga0070695_100026786 | 3300005545 | Bacteria | 3568 |
| 49 | Ga0070665_100016084 | 3300005548 | Bacteria | 7508 |
| 50 | Ga0070665_100043107 | 3300005548 | Bacteria | 4536 |
| 51 | Ga0070665_100099072 | 3300005548 | Bacteria | 2919 |
| 52 | Ga0068855_100072955 | 3300005563 | Bacteria | 3989 |
| 53 | Ga0068855_100241849 | 3300005563 | Bacteria | 2016 |
| 54 | Ga0068855_100363622 | 3300005563 | Bacteria | 1592 |
| 55 | Ga0068857_100060263 | 3300005577 | Bacteria | 3372 |
| 56 | Ga0068852_100010479 | 3300005616 | Bacteria | 6931 |
| 57 | Ga0068852_100333349 | 3300005616 | Bacteria | 1477 |
| 58 | Ga0068863_100468653 | 3300005841 | Bacteria | 1238 |
| 59 | Ga0068858_100017135 | 3300005842 | Bacteria | 6798 |
| 60 | Ga0068860_100560133 | 3300005843 | Bacteria | 1146 |
| 61 | Ga0081540_1006213 | 3300005983 | Bacteria | 8758 |
| 62 | Ga0070717_10070713 | 3300006028 | Bacteria | 2909 |
| 63 | Ga0075365_10067920 | 3300006038 | Bacteria | 2394 |
| 64 | Ga0075364_10026317 | 3300006051 | Bacteria | 3710 |
| 65 | Ga0070716_100017444 | 3300006173 | Bacteria | 3722 |
| 66 | Ga0070712_100050167 | 3300006175 | Bacteria | 2902 |
| 67 | Ga0070712_100340915 | 3300006175 | Bacteria | 1224 |
| 68 | Ga0075367_10077158 | 3300006178 | Bacteria | 2011 |
| 69 | Ga0075370_10025241 | 3300006353 | Bacteria | 3285 |
| 70 | Ga0075370_10286392 | 3300006353 | Bacteria | 979 |
| 71 | Ga0068865_100446190 | 3300006881 | Bacteria | 1069 |
| 72 | Ga0075436_100020894 | 3300006914 | Bacteria | 4491 |
| 73 | Ga0099794_10007561 | 3300007265 | Bacteria | 4471 |
| 74 | Ga0099795_10017419 | 3300007788 | Bacteria | 2290 |
| 75 | Ga0105251_10077971 | 3300009011 | Bacteria | 1535 |
| 76 | Ga0105240_10042490 | 3300009093 | Bacteria | 5791 |
| 77 | Ga0105240_10046512 | 3300009093 | Bacteria | 5498 |
| 78 | Ga0105240_10258200 | 3300009093 | Bacteria | 2011 |
| 79 | Ga0111539_10263360 | 3300009094 | Bacteria | 2007 |
| 80 | Ga0105247_10251281 | 3300009101 | Bacteria | 1209 |
| 81 | Ga0114129_10191011 | 3300009147 | Bacteria | 2781 |
| 82 | Ga0105243_10682791 | 3300009148 | Bacteria | 999 |
| 83 | Ga0105241_10509067 | 3300009174 | Bacteria | 1075 |
| 84 | Ga0105248_10219284 | 3300009177 | Bacteria | 2142 |
| 85 | Ga0105237_10072348 | 3300009545 | Bacteria | 3442 |
| 86 | Ga0105237_10236651 | 3300009545 | Bacteria | 1827 |
| 87 | Ga0105238_10445755 | 3300009551 | Bacteria | 1291 |
| 88 | Ga0105249_10353513 | 3300009553 | Bacteria | 1489 |
| 89 | Ga0099796_10167300 | 3300010159 | Bacteria | 875 |
| 90 | Ga0105239_10290706 | 3300010375 | Unclassified | 1840 |
| 91 | Ga0105239_10415210 | 3300010375 | Bacteria | 1524 |
| 92 | Ga0105239_10443204 | 3300010375 | Bacteria | 1473 |
| 93 | Ga0105246_10205305 | 3300011119 | Bacteria | 1535 |
| 94 | Ga0157373_10103057 | 3300013100 | Bacteria | 2007 |
| 95 | Ga0157370_10062680 | 3300013104 | Bacteria | 3525 |
| 96 | Ga0157370_10150443 | 3300013104 | Bacteria | 2166 |
| 97 | Ga0157370_10183896 | 3300013104 | Bacteria | 1941 |
| 98 | Ga0157369_10005972 | 3300013105 | Bacteria | 14140 |
| 99 | Ga0157369_10014893 | 3300013105 | Bacteria | 8777 |
| 100 | Ga0157369_10028039 | 3300013105 | Bacteria | 6236 |
| 101 | Ga0157369_10413740 | 3300013105 | Unclassified | 1398 |
| 102 | Ga0157374_10073514 | 3300013296 | Bacteria | 3227 |
| 103 | Ga0157378_10743839 | 3300013297 | Bacteria | 1003 |
| 104 | Ga0157372_10026107 | 3300013307 | Bacteria | 6356 |
| 105 | Ga0157375_10149037 | 3300013308 | Bacteria | 2473 |
| 106 | Ga0157375_10503389 | 3300013308 | Bacteria | 1375 |
| 107 | Ga0157380_10282193 | 3300014326 | Bacteria | 1520 |
| 108 | Ga0157379_10048842 | 3300014968 | Bacteria | 3777 |
| 109 | Ga0157379_10098754 | 3300014968 | Bacteria | 2621 |
| 110 | Ga0157379_10185213 | 3300014968 | Bacteria | 1881 |
| 111 | Ga0163161_10051835 | 3300017792 | Bacteria | 2974 |
| 112 | Ga0214544_1000051 | 3300021320 | Bacteria | 134645 |
| 113 | Ga0214544_1033822 | 3300021320 | Bacteria | 1476 |
| 114 | Ga0214542_1000149 | 3300021321 | Bacteria | 102700 |
| 115 | Ga0214545_1000126 | 3300021324 | Bacteria | 91489 |
| 116 | Ga0214545_1030987 | 3300021324 | Bacteria | 2211 |
| 117 | Ga0214543_1000148 | 3300021327 | Bacteria | 98370 |
| 118 | Ga0213872_10127273 | 3300021361 | Bacteria | 1124 |
| 119 | Ga0209563_104496 | 3300025230 | Bacteria | 2655 |
| 120 | Ga0209677_101509 | 3300025253 | Bacteria | 9980 |
| 121 | Ga0209233_1006843 | 3300025261 | Bacteria | 3646 |
| 122 | Ga0209758_1001544 | 3300025297 | Bacteria | 26459 |
| 123 | Ga0209758_1002693 | 3300025297 | Bacteria | 17518 |
| 124 | Ga0209758_1004869 | 3300025297 | Bacteria | 10814 |
| 125 | Ga0209758_1017628 | 3300025297 | Bacteria | 3542 |
| 126 | Ga0207426_1010863 | 3300025302 | Bacteria | 3506 |
| 127 | Ga0207426_1025467 | 3300025302 | Bacteria | 1992 |
| 128 | Ga0207692_10003300 | 3300025898 | Bacteria | 6286 |
| 129 | Ga0207642_10070411 | 3300025899 | Bacteria | 1662 |
| 130 | Ga0207688_10330872 | 3300025901 | Bacteria | 936 |
| 131 | Ga0207647_10099236 | 3300025904 | Bacteria | 1730 |
| 132 | Ga0207647_10185631 | 3300025904 | Bacteria | 1206 |
| 133 | Ga0207647_10244043 | 3300025904 | Bacteria | 1031 |
| 134 | Ga0207699_10000878 | 3300025906 | Bacteria | 14349 |
| 135 | Ga0207705_10187880 | 3300025909 | Bacteria | 1561 |
| 136 | Ga0207684_10437719 | 3300025910 | Bacteria | 1123 |
| 137 | Ga0207707_10000048 | 3300025912 | Bacteria | 117799 |
| 138 | Ga0207707_10039803 | 3300025912 | Bacteria | 4108 |
| 139 | Ga0207695_10064854 | 3300025913 | Bacteria | 3758 |
| 140 | Ga0207695_10083444 | 3300025913 | Bacteria | 3228 |
| 141 | Ga0207671_10087172 | 3300025914 | Bacteria | 2347 |
| 142 | Ga0207693_10068574 | 3300025915 | Bacteria | 2776 |
| 143 | Ga0207663_10001692 | 3300025916 | Bacteria | 10367 |
| 144 | Ga0207660_10000122 | 3300025917 | Bacteria | 45383 |
| 145 | Ga0207652_10000502 | 3300025921 | Bacteria | 39810 |
| 146 | Ga0207652_10081607 | 3300025921 | Bacteria | 2829 |
| 147 | Ga0207694_10088625 | 3300025924 | Bacteria | 2439 |
| 148 | Ga0207694_10161221 | 3300025924 | Bacteria | 1811 |
| 149 | Ga0207650_10314059 | 3300025925 | Bacteria | 1282 |
| 150 | Ga0207700_10112247 | 3300025928 | Bacteria | 2196 |
| 151 | Ga0207664_10021532 | 3300025929 | Bacteria | 4797 |
| 152 | Ga0207665_10002517 | 3300025939 | Bacteria | 12320 |
| 153 | Ga0207665_10057486 | 3300025939 | Bacteria | 2628 |
| 154 | Ga0207691_10074405 | 3300025940 | Bacteria | 3064 |
| 155 | Ga0207711_10496770 | 3300025941 | Bacteria | 1137 |
| 156 | Ga0207661_10528098 | 3300025944 | Bacteria | 1080 |
| 157 | Ga0207667_10132132 | 3300025949 | Bacteria | 2571 |
| 158 | Ga0207667_10315728 | 3300025949 | Bacteria | 1596 |
| 159 | Ga0207658_10021844 | 3300025986 | Bacteria | 4448 |
| 160 | Ga0207658_10100343 | 3300025986 | Bacteria | 2266 |
| 161 | Ga0207703_10041281 | 3300026035 | Bacteria | 3695 |
| 162 | Ga0207639_10116023 | 3300026041 | Bacteria | 2191 |
| 163 | Ga0207639_10523044 | 3300026041 | Bacteria | 1086 |
| 164 | Ga0207678_10022155 | 3300026067 | Bacteria | 5567 |
| 165 | Ga0207678_10070309 | 3300026067 | Bacteria | 3001 |
| 166 | Ga0207702_10266605 | 3300026078 | Bacteria | 1614 |
| 167 | Ga0207702_10615052 | 3300026078 | Bacteria | 1067 |
| 168 | Ga0207641_10126622 | 3300026088 | Bacteria | 2287 |
| 169 | Ga0207674_10099911 | 3300026116 | Bacteria | 2883 |
| 170 | Ga0207683_10232019 | 3300026121 | Bacteria | 1683 |
| 171 | Ga0207683_10463848 | 3300026121 | Bacteria | 1168 |
| 172 | Ga0209588_1001956 | 3300027671 | Bacteria | 5521 |
| 173 | Ga0209813_10094067 | 3300027866 | Bacteria | 1010 |
| 174 | Ga0268266_10007595 | 3300028379 | Bacteria | 9763 |
| 175 | Ga0268266_10137138 | 3300028379 | Bacteria | 2192 |
| 176 | Ga0307515_10011321 | 3300028794 | Bacteria | 16930 |
| 177 | Ga0307515_10129114 | 3300028794 | Bacteria | 2798 |
| 178 | Ga0307511_10084273 | 3300030521 | Bacteria | 2208 |
| 179 | Ga0265330_10036070 | 3300031235 | Bacteria | 2205 |
| 180 | Ga0265325_10028296 | 3300031241 | Bacteria | 3022 |
| 181 | Ga0265340_10044435 | 3300031247 | Bacteria | 2173 |
| 182 | Ga0265331_10008154 | 3300031250 | Bacteria | 5980 |
| 183 | Ga0265331_10088778 | 3300031250 | Bacteria | 1430 |
| 184 | Ga0307513_10153790 | 3300031456 | Bacteria | 2204 |
| 185 | Ga0307513_10517152 | 3300031456 | Bacteria | 909 |
| 186 | Ga0307509_10020383 | 3300031507 | Bacteria | 7521 |
| 187 | Ga0307509_10116487 | 3300031507 | Bacteria | 2661 |
| 188 | Ga0307509_10151080 | 3300031507 | Bacteria | 2238 |
| 189 | Ga0265313_10000427 | 3300031595 | Bacteria | 44927 |
| 190 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 191 | Ga0307516_10018819 | 3300031730 | Bacteria | 7169 |
| 192 | Ga0307516_10048236 | 3300031730 | Bacteria | 4191 |
| 193 | Ga0307516_10058886 | 3300031730 | Bacteria | 3737 |
| 194 | Ga0307516_10296677 | 3300031730 | Bacteria | 1293 |
| 195 | Ga0307405_10202977 | 3300031731 | Bacteria | 1441 |
| 196 | Ga0307410_10058586 | 3300031852 | Bacteria | 2626 |
| 197 | Ga0307406_10087732 | 3300031901 | Bacteria | 2086 |
| 198 | Ga0307409_100321911 | 3300031995 | Bacteria | 1447 |
| 199 | Ga0307416_100197262 | 3300032002 | Bacteria | 1906 |
| 200 | Ga0307411_10373337 | 3300032005 | Bacteria | 1170 |
| 201 | Ga0307415_100057916 | 3300032126 | Bacteria | 2665 |
| 202 | Ga0307415_100206509 | 3300032126 | Bacteria | 1563 |
| 203 | Ga0307507_10018394 | 3300033179 | Bacteria | 7947 |
| 204 | Ga0307510_10021555 | 3300033180 | Bacteria | 7508 |
| 205 | Ga0373926_0014809 | 3300035083 | Bacteria | 2655 |
| 206 | Ga0373936_0020693 | 3300035113 | Bacteria | 2557 |
| 207 | Ga0373936_0050322 | 3300035113 | Bacteria | 1685 |
| 208 | Ga0373954_0096411 | 3300035118 | Bacteria | 1424 |
| 209 | Ga0373943_0000075 | 3300035170 | Bacteria | 34975 |
| 210 | Ga0373955_0010745 | 3300035172 | Bacteria | 4336 |
| 211 | Ga0373924_0014115 | 3300035410 | Bacteria | 3013 |
| 212 | Ga0373924_0021929 | 3300035410 | Bacteria | 2493 |
| 213 | Ga0373935_0002382 | 3300035692 | Bacteria | 10743 |
| 214 | Ga0373935_0061240 | 3300035692 | Bacteria | 2409 |
| 215 | Ga0373935_0444941 | 3300035692 | Bacteria | 935 |
| 216 | Ga0373927_0001971 | 3300035695 | Bacteria | 15141 |
| 217 | Ga0373927_0012510 | 3300035695 | Bacteria | 5651 |
| 218 | Ga0373927_0019574 | 3300035695 | Bacteria | 4437 |
| 219 | Ga0373927_0033244 | 3300035695 | Bacteria | 3358 |
| 220 | Ga0373947_0000620 | 3300035725 | Bacteria | 20963 |
| 221 | Ga0373947_0174088 | 3300035725 | Bacteria | 1398 |
| 222 | Ga0373937_0008910 | 3300036401 | Bacteria | 8710 |
| 223 | Ga0373937_0154510 | 3300036401 | Bacteria | 2150 |
| 224 | Ga0373937_0254415 | 3300036401 | Bacteria | 1656 |
| 225 | Ga0373925_0000631 | 3300037068 | Bacteria | 33279 |
| 226 | Ga0373925_0235009 | 3300037068 | Bacteria | 1466 |
| 227 | Ga0395900_0047393 | 3300037418 | Bacteria | 4425 |
| 228 | Ga0395900_0151303 | 3300037418 | Bacteria | 2371 |
| 229 | Ga0395898_0030079 | 3300037466 | Bacteria | 5438 |
| 230 | Ga0436364_0194407 | 3300037853 | Bacteria | 6508 |
| 231 | Ga0436364_0857559 | 3300037853 | Bacteria | 858 |
| 232 | Ga0395901_0021708 | 3300038443 | Bacteria | 6578 |
| 233 | Ga0395901_0360572 | 3300038443 | Bacteria | 1499 |
| 234 | Ga0395901_0397243 | 3300038443 | Bacteria | 1417 |
| 235 | Ga0400487_20385 | 3300039110 | Bacteria | 1421 |
| 236 | Ga0436365_0601496 | 3300039437 | Bacteria | 2519 |
| 237 | Ga0436365_1340325 | 3300039437 | Bacteria | 1182 |
| 238 | Ga0436360_0334801 | 3300039438 | Bacteria | 1033 |
| 239 | Ga0436360_1040629 | 3300039438 | Bacteria | 2439 |
| 240 | Ga0436363_0188861 | 3300039450 | Bacteria | 888 |
| 241 | Ga0436362_0644465 | 3300039453 | Bacteria | 2779 |
| 242 | Ga0451791_1488532 | 3300041451 | Bacteria | 994 |
| 243 | Ga0451837_0811423 | 3300041494 | Bacteria | 919 |
| 244 | Ga0439462_0010609 | 3300042015 | Bacteria | 2335 |
| 245 | Ga0466969_0190089 | 3300044656 | Bacteria | 938 |
| 246 | Ga0466963_0248092 | 3300044694 | Bacteria | 1249 |
| 247 | Ga0466964_0076001 | 3300044706 | Bacteria | 1431 |
| 248 | Ga0466957_0370431 | 3300044842 | Bacteria | 975 |
| 249 | Ga0466960_0328458 | 3300044901 | Bacteria | 868 |
| 250 | Ga0466959_0043159 | 3300045049 | Bacteria | 3326 |
| 251 | Ga0466959_0076880 | 3300045049 | Bacteria | 2410 |
| 252 | Ga0466958_0141420 | 3300045836 | Bacteria | 1515 |
| 253 | Ga0466967_0374758 | 3300045976 | Bacteria | 1381 |
| 254 | Ga0466967_1060594 | 3300045976 | Bacteria | 807 |
| 255 | Ga0495592_0003207 | 3300046454 | Bacteria | 11722 |
| 256 | Ga0495592_0106350 | 3300046454 | Bacteria | 1992 |
| 257 | Ga0495592_0344885 | 3300046454 | Bacteria | 956 |
| 258 | Ga0495603_0030446 | 3300046455 | Bacteria | 3250 |
| 259 | Ga0495629_0001343 | 3300046459 | Bacteria | 19368 |
| 260 | Ga0495629_0049405 | 3300046459 | Bacteria | 2948 |
| 261 | Ga0495638_0081301 | 3300046460 | Bacteria | 1967 |
| 262 | Ga0495638_0081432 | 3300046460 | Bacteria | 1965 |
| 263 | Ga0495651_0007546 | 3300046462 | Bacteria | 8320 |
| 264 | Ga0495651_0021524 | 3300046462 | Bacteria | 5012 |
| 265 | Ga0495653_0003251 | 3300046463 | Bacteria | 13038 |
| 266 | Ga0495580_0007061 | 3300046472 | Bacteria | 9052 |
| 267 | Ga0495662_0140550 | 3300046476 | Bacteria | 1188 |
| 268 | Ga0495664_0011804 | 3300046477 | Bacteria | 4933 |
| 269 | Ga0495585_0063037 | 3300046492 | Bacteria | 2035 |
| 270 | Ga0495585_0072108 | 3300046492 | Bacteria | 1882 |
| 271 | Ga0495596_0038731 | 3300046500 | Bacteria | 1884 |
| 272 | Ga0495608_0003162 | 3300046511 | Bacteria | 11774 |
| 273 | Ga0495610_0059109 | 3300046512 | Bacteria | 1831 |
| 274 | Ga0495616_0082380 | 3300046513 | Bacteria | 1537 |
| 275 | Ga0495618_0000901 | 3300046514 | Bacteria | 20426 |
| 276 | Ga0495618_0003888 | 3300046514 | Bacteria | 9231 |
| 277 | Ga0495630_0002797 | 3300046517 | Bacteria | 12114 |
| 278 | Ga0495630_0007209 | 3300046517 | Bacteria | 7926 |
| 279 | Ga0495643_0227248 | 3300046522 | Bacteria | 882 |
| 280 | Ga0495644_0008473 | 3300046523 | Bacteria | 3960 |
| 281 | Ga0495648_0002172 | 3300046524 | Bacteria | 18452 |
| 282 | Ga0495663_0032392 | 3300046525 | Bacteria | 1557 |
| 283 | Ga0495666_0223866 | 3300046526 | Bacteria | 861 |
| 284 | Ga0495652_0089041 | 3300046529 | Bacteria | 2528 |
| 285 | Ga0495665_0088513 | 3300046531 | Bacteria | 1627 |
| 286 | Ga0495640_0002575 | 3300046533 | Bacteria | 14577 |
| 287 | Ga0495640_0009803 | 3300046533 | Bacteria | 7438 |
| 288 | Ga0495640_0155397 | 3300046533 | Bacteria | 1468 |
| 289 | Ga0495587_0014503 | 3300046536 | Bacteria | 4941 |
| 290 | Ga0495645_0045968 | 3300046543 | Bacteria | 3184 |
| 291 | Ga0495645_0069693 | 3300046543 | Bacteria | 2538 |
| 292 | Ga0495645_0223186 | 3300046543 | Bacteria | 1266 |
| 293 | Ga0495622_0045144 | 3300046557 | Bacteria | 2048 |
| 294 | Ga0495667_0003548 | 3300046559 | Bacteria | 10479 |
| 295 | Ga0495656_0011893 | 3300046615 | Bacteria | 3201 |
| 296 | Ga0495668_0053748 | 3300046616 | Bacteria | 2226 |
| 297 | Ga0495668_0313067 | 3300046616 | Bacteria | 861 |
| 298 | Ga0495634_0041229 | 3300046642 | Bacteria | 3135 |
| 299 | Ga0495625_0308892 | 3300046660 | Bacteria | 1010 |
| 300 | Ga0495635_0000230 | 3300046663 | Bacteria | 35642 |
| 301 | Ga0495635_0000813 | 3300046663 | Bacteria | 20461 |
| 302 | Ga0495635_0143591 | 3300046663 | Bacteria | 1625 |
| 303 | Ga0495659_0031288 | 3300046664 | Bacteria | 1856 |
| 304 | Ga0495661_0060643 | 3300046665 | Bacteria | 2247 |
| 305 | Ga0495588_0010100 | 3300046674 | Bacteria | 4379 |
| 306 | Ga0495657_0009686 | 3300046675 | Bacteria | 7288 |
| 307 | Ga0495599_0000807 | 3300046678 | Bacteria | 17610 |
| 308 | Ga0495599_0206658 | 3300046678 | Bacteria | 1205 |
| 309 | Ga0495623_0112056 | 3300046679 | Bacteria | 1652 |
| 310 | Ga0495647_0250040 | 3300046681 | Bacteria | 789 |
| 311 | Ga0495658_0052021 | 3300046683 | Bacteria | 2321 |
| 312 | Ga0495613_0071326 | 3300046689 | Bacteria | 2532 |
| 313 | Ga0495624_0003531 | 3300046690 | Bacteria | 11588 |
| 314 | Ga0495624_0055171 | 3300046690 | Bacteria | 2504 |
| 315 | Ga0495649_0097651 | 3300046694 | Bacteria | 1563 |
| 316 | Ga0495600_0001064 | 3300046809 | Bacteria | 14886 |
| 317 | Ga0495581_0070889 | 3300047315 | Bacteria | 2016 |
| 318 | Ga0495581_0081899 | 3300047315 | Bacteria | 1869 |
| 319 | Ga0495604_0004194 | 3300047317 | Bacteria | 11424 |
| 320 | Ga0495674_0012101 | 3300047319 | Bacteria | 8131 |
| 321 | Ga0495672_0023345 | 3300047320 | Bacteria | 4003 |
| 322 | Ga0495676_0019647 | 3300047321 | Bacteria | 5940 |
| 323 | Ga0495676_0100129 | 3300047321 | Bacteria | 2146 |
| 324 | Ga0495683_0128714 | 3300047323 | Bacteria | 1196 |
| 325 | Ga0495675_0001005 | 3300047444 | Bacteria | 17160 |
| 326 | Ga0495673_0034158 | 3300047469 | Bacteria | 2353 |
| 327 | Ga0495684_0000320 | 3300047471 | Bacteria | 38898 |
| 328 | Ga0495684_0009257 | 3300047471 | Bacteria | 7606 |
| 329 | Ga0495593_0002091 | 3300047673 | Bacteria | 11943 |
| 330 | Ga0495593_0035122 | 3300047673 | Bacteria | 2723 |
| 331 | Ga0495602_0019045 | 3300048088 | Bacteria | 6828 |
| 332 | Ga0496100_0145093 | 3300048903 | Bacteria | 1687 |
| 333 | Ga0496106_0005442 | 3300048909 | Bacteria | 9422 |
| 334 | Ga0496106_0351927 | 3300048909 | Bacteria | 1183 |
| 335 | Ga0496109_0122393 | 3300048912 | Bacteria | 2424 |
| 336 | Ga0496110_0103978 | 3300048913 | Bacteria | 2548 |
| 337 | Ga0496115_0024966 | 3300048918 | Bacteria | 4650 |
| 338 | Ga0496115_0197597 | 3300048918 | Bacteria | 1662 |
| 339 | Ga0496116_0085839 | 3300048919 | Bacteria | 1933 |
| 340 | Ga0496117_0014824 | 3300048920 | Bacteria | 6689 |
| 341 | Ga0496118_0008043 | 3300048921 | Bacteria | 11011 |
| 342 | Ga0496119_0149869 | 3300048922 | Bacteria | 1251 |
| 343 | Ga0496121_0000529 | 3300048924 | Bacteria | 72533 |
| 344 | Ga0496121_0000864 | 3300048924 | Bacteria | 54785 |
| 345 | Ga0496121_0003622 | 3300048924 | Bacteria | 21784 |
| 346 | Ga0496121_0090755 | 3300048924 | Bacteria | 2387 |
| 347 | Ga0496121_0094134 | 3300048924 | Bacteria | 2331 |
| 348 | Ga0496122_0040835 | 3300048925 | Bacteria | 3680 |
| 349 | Ga0496122_0199154 | 3300048925 | Bacteria | 1173 |
| 350 | Ga0496124_0001167 | 3300048927 | Bacteria | 41138 |
| 351 | Ga0496125_0003560 | 3300048928 | Bacteria | 18764 |
| 352 | Ga0496125_0011234 | 3300048928 | Bacteria | 8976 |
| 353 | Ga0496126_0003918 | 3300048929 | Bacteria | 18248 |
| 354 | Ga0496126_0011720 | 3300048929 | Bacteria | 9035 |
| 355 | Ga0496126_0016798 | 3300048929 | Bacteria | 7306 |
| 356 | Ga0496126_0018029 | 3300048929 | Bacteria | 7014 |
| 357 | Ga0496126_0019316 | 3300048929 | Bacteria | 6712 |
| 358 | Ga0496126_0035315 | 3300048929 | Bacteria | 4687 |
| 359 | Ga0496126_0048701 | 3300048929 | Bacteria | 3871 |
| 360 | Ga0496126_0112399 | 3300048929 | Bacteria | 2372 |
| 361 | Ga0496126_0550968 | 3300048929 | Bacteria | 915 |
| 362 | Ga0496126_0662685 | 3300048929 | Bacteria | 815 |
| 363 | Ga0495682_0080030 | 3300049460 | Bacteria | 1175 |
| 364 | Ga0501031_0307989 | 3300049568 | Bacteria | 1026 |
| 365 | Ga0501032_0219786 | 3300049569 | Bacteria | 1237 |
| 366 | Ga0501033_0016655 | 3300049570 | Bacteria | 5559 |
| 367 | Ga0501034_0282534 | 3300049571 | Bacteria | 1599 |
| 368 | Ga0501034_0356131 | 3300049571 | Bacteria | 1391 |
| 369 | Ga0501034_0406508 | 3300049571 | Bacteria | 1284 |
| 370 | Ga0501036_0514821 | 3300049572 | Bacteria | 995 |
| 371 | Ga0501037_0175332 | 3300049573 | Bacteria | 1523 |
| 372 | Ga0501037_0192074 | 3300049573 | Bacteria | 1445 |
| 373 | Ga0501038_0090107 | 3300049574 | Bacteria | 2571 |
| 374 | Ga0501043_0160251 | 3300049579 | Bacteria | 1758 |
| 375 | Ga0501043_0284146 | 3300049579 | Bacteria | 1268 |
| 376 | Ga0501047_0042743 | 3300049581 | Bacteria | 4378 |
| 377 | Ga0501047_0277446 | 3300049581 | Bacteria | 1521 |
| 378 | Ga0501069_0064070 | 3300049585 | Bacteria | 2054 |
| 379 | Ga0501080_0319407 | 3300049742 | Bacteria | 1406 |
| 380 | Ga0501035_0208183 | 3300049822 | Bacteria | 1674 |
| 381 | Ga0501044_0100554 | 3300049823 | Bacteria | 2910 |
| 382 | Ga0501044_0194118 | 3300049823 | Bacteria | 1991 |
| 383 | nmdc:mga03n38_31206_c1 | 3300050490 | Bacteria | 2246 |
| 384 | nmdc:mga00v17_18439_c1 | 3300050491 | Bacteria | 3964 |
| 385 | nmdc:mga0yw44_7571_c1 | 3300050492 | Bacteria | 5352 |
| 386 | nmdc:mga06z11_173302_c1 | 3300050494 | Bacteria | 1240 |
| 387 | nmdc:mga04h51_111209_c1 | 3300050495 | Bacteria | 1010 |
| 388 | nmdc:mga07m45_35330_c1 | 3300050496 | Bacteria | 2779 |
| 389 | nmdc:mga05p37_411145_c1 | 3300050507 | Bacteria | 1577 |
| 390 | nmdc:mga09592_213586_c1 | 3300050508 | Bacteria | 1671 |
| 391 | nmdc:mga0n895_117326_c1 | 3300050512 | Bacteria | 2681 |
| 392 | nmdc:mga0n895_171914_c1 | 3300050512 | Bacteria | 2199 |
| 393 | nmdc:mga0rr50_63338_c1 | 3300050513 | Bacteria | 2792 |
| 394 | nmdc:mga08x19_319750_c1 | 3300050514 | Bacteria | 1080 |
| 395 | nmdc:mga08x19_50640_c1 | 3300050514 | Bacteria | 2665 |
| 396 | nmdc:mga0sz30_16517_c1 | 3300050516 | Bacteria | 2933 |
| 397 | Ga0495601_0070183 | 3300053077 | Bacteria | 2236 |
| 398 | Ga0495612_0093515 | 3300053078 | Bacteria | 1275 |
| 399 | Ga0500635_0023109 | 3300053080 | Bacteria | 1936 |
| 400 | Ga0495595_0001005 | 3300053084 | Bacteria | 10865 |
| 401 | Ga0495619_0002499 | 3300053085 | Bacteria | 12040 |
| 402 | Ga0495619_0018102 | 3300053085 | Bacteria | 4467 |
| 403 | Ga0500644_0000477 | 3300053088 | Bacteria | 17595 |
| 404 | Ga0500646_0043707 | 3300053090 | Bacteria | 1269 |
| 405 | Ga0500583_0188239 | 3300053092 | Bacteria | 1027 |
| 406 | Ga0500651_0061364 | 3300053093 | Bacteria | 2349 |
| 407 | Ga0500651_0235960 | 3300053093 | Bacteria | 1068 |
| 408 | Ga0500566_0121173 | 3300053094 | Bacteria | 1410 |
| 409 | Ga0500641_0012491 | 3300053096 | Bacteria | 3103 |
| 410 | Ga0500641_0038823 | 3300053096 | Bacteria | 1915 |
| 411 | Ga0500641_0115838 | 3300053096 | Bacteria | 1154 |
| 412 | Ga0500557_000061 | 3300053105 | Bacteria | 44319 |
| 413 | Ga0500562_073173 | 3300053108 | Bacteria | 925 |
| 414 | Ga0500592_011239 | 3300053116 | Bacteria | 1431 |
| 415 | Ga0500593_000373 | 3300053117 | Bacteria | 18007 |
| 416 | Ga0500595_001340 | 3300053119 | Bacteria | 13316 |
| 417 | Ga0500595_007250 | 3300053119 | Bacteria | 4608 |
| 418 | Ga0500642_0006544 | 3300053130 | Bacteria | 3846 |
| 419 | Ga0500642_0059042 | 3300053130 | Bacteria | 1716 |
| 420 | Ga0500642_0181447 | 3300053130 | Bacteria | 984 |
| 421 | Ga0500559_0004536 | 3300053136 | Bacteria | 6569 |
| 422 | Ga0500559_0129475 | 3300053136 | Unclassified | 1178 |
| 423 | Ga0500568_0093456 | 3300053139 | Bacteria | 1133 |
| 424 | Ga0500577_0034781 | 3300053142 | Bacteria | 1792 |
| 425 | Ga0500577_0035771 | 3300053142 | Bacteria | 1774 |
| 426 | Ga0500590_189579 | 3300053148 | Bacteria | 883 |
| 427 | Ga0500604_0050688 | 3300053151 | Bacteria | 1280 |
| 428 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 429 | Ga0500616_0018244 | 3300053153 | Bacteria | 3970 |
| 430 | Ga0500616_0105155 | 3300053153 | Bacteria | 1373 |
| 431 | Ga0500638_073513 | 3300053162 | Bacteria | 1631 |
| 432 | Ga0500636_0030507 | 3300053177 | Bacteria | 3188 |
| 433 | Ga0500637_0000077 | 3300053178 | Bacteria | 35359 |
| 434 | Ga0500570_026145 | 3300053724 | Bacteria | 3203 |
| 435 | Ga0500661_000100 | 3300055283 | Bacteria | 13873 |
| 436 | Ga0501082_0864995 | 3300060353 | Bacteria | 791 |
| 437 | Ga0466962_0089555 | 3300061719 | Bacteria | 1474 |
| 438 | 2513675497 | 2513237098 | Bacteria | 9902361 |
| 439 | 2513892871 | 2513237141 | Bacteria | 8496279 |
| 440 | 2514014008 | 2513237161 | Bacteria | 8871253 |
| 441 | 2524470597 | 2524023210 | Bacteria | 9029266 |
| 442 | 2617351319 | 2617270735 | Bacteria | 9163226 |
| 443 | 2617376269 | 2617270741 | Bacteria | 8201522 |
| 444 | 2644729106 | 2643221733 | Bacteria | 5690728 |
| 445 | 2644745609 | 2643221736 | Bacteria | 6608466 |
| 446 | 2793080749 | |||
| 447 | 2824605026 | 2824600985 | Bacteria | 8488197 |
| 448 | 2824613902 | 2824609381 | Bacteria | 8672835 |
| 449 | 2824665108 | 2824661429 | Bacteria | 9877870 |
| 450 | 2824679460 | 2824671348 | Bacteria | 8369588 |
| 451 | 2824695596 | 2824687955 | Bacteria | 8360029 |
| 452 | 2824737476 | 2824732956 | Bacteria | 7810675 |
| 453 | 2824750070 | 2824746037 | Bacteria | 7911610 |
| 454 | 2824779213 | 2824773399 | Bacteria | 8360218 |
| 455 | 2838126319 | 2838122688 | Bacteria | 8803140 |
| 456 | 2841943602 | 2841941048 | Bacteria | 8688029 |
| 457 | 2841950447 | 2841949485 | Bacteria | 8680857 |
| 458 | 2841966761 | 2841966195 | Bacteria | 8673214 |
| 459 | 2841975517 | 2841974524 | Bacteria | 8931498 |
| 460 | 2841988343 | 2841983080 | Bacteria | 8395090 |
| 461 | 2842039567 | 2842038055 | Bacteria | 8002051 |
| 462 | 2849079819 | 2849076700 | Bacteria | 7039503 |
| 463 | 2851184367 | 2851182111 | Bacteria | 6047226 |
| 464 | 2885371994 | 2885366525 | Bacteria | 8326213 |
| 465 | 2885411020 | 2885409591 | Bacteria | 9235467 |
| 466 | 2888423964 | 2888419890 | Bacteria | 7857137 |
| 467 | 2903772640 | 2903768456 | Bacteria | 9749579 |
| 468 | 2903772641 | 2903768456 | Bacteria | 9749579 |
| 469 | 2908779609 | 2908775508 | Bacteria | 8092255 |
| 470 | 2929617468 | 2929615660 | Bacteria | 9193770 |
| 471 | 2929627173 | 2929624759 | Bacteria | 9339455 |
| 472 | 2933579424 | 2933577622 | Bacteria | 9116884 |
| 473 | 2935682377 | 2935675223 | Bacteria | 9928132 |
| 474 | 8055746917 | 8055742211 | Bacteria | 9226248 |
| 475 | 8056683247 | 8056681323 | Bacteria | 8472857 |
| 476 | Ga0157378_10012272 | |||
| 477 | RicEn_C3328 | |||
| 478 | JGI25159J45721_1003651 | |||
| 479 | JGI25153J46596_10001368 | |||
| 480 | JGI25153J46596_10055339 | |||
| 481 | rootH1_10105374 | |||
| 482 | rootL2_10217417 | |||
| 483 | JGI25160J50197_1002759 | |||
| 484 | Ga0065165_1043635 | |||
| 485 | Ga0070658_10162266 | |||
| 486 | Ga0070683_100020570 | |||
| 487 | Ga0068869_100218203 | |||
| 488 | Ga0070680_100004196 | |||
| 489 | Ga0070680_100006163 | |||
| 490 | Ga0070680_100200286 | |||
| 491 | Ga0070680_100244539 | |||
| 492 | Ga0070682_100517002 | |||
| 493 | Ga0070660_100162801 | |||
| 494 | Ga0070661_100223521 | |||
| 495 | Ga0070661_100343477 | |||
| 496 | Ga0070675_100674737 | |||
| 497 | Ga0070659_100079520 | |||
| 498 | Ga0070659_100185679 | |||
| 499 | Ga0070667_100075019 | |||
| 500 | Ga0070667_100729316 | |||
| 501 | Ga0070709_10004552 | |||
| 502 | Ga0070714_100009562 | |||
| 503 | Ga0070713_100132925 | |||
| 504 | Ga0070713_100473060 | |||
| 505 | Ga0070710_10000370 | |||
| 506 | Ga0070711_100011526 | |||
| 507 | Ga0070705_100080260 | |||
| 508 | Ga0070663_100093294 | |||
| 509 | Ga0070663_100113575 | |||
| 510 | Ga0070681_10000001 | |||
| 511 | Ga0070681_10132950 | |||
| 512 | Ga0070681_10146732 | |||
| 513 | Ga0070685_10191109 | |||
| 514 | Ga0070706_100485968 | |||
| 515 | Ga0070679_100220543 | |||
| 516 | Ga0070684_100012263 | |||
| 517 | Ga0070684_100097677 | |||
| 518 | Ga0070697_100123650 | |||
| 519 | Ga0068853_100026902 | |||
| 520 | Ga0068853_100072121 | |||
| 521 | Ga0068853_100341798 | |||
| 522 | Ga0068853_100386289 | |||
| 523 | Ga0070695_100026786 | |||
| 524 | Ga0070665_100016084 | |||
| 525 | Ga0070665_100043107 | |||
| 526 | Ga0070665_100099072 | |||
| 527 | Ga0068855_100072955 | |||
| 528 | Ga0068855_100241849 | |||
| 529 | Ga0068855_100363622 | |||
| 530 | Ga0068857_100060263 | |||
| 531 | Ga0068852_100010479 | |||
| 532 | Ga0068852_100333349 | |||
| 533 | Ga0068863_100468653 | |||
| 534 | Ga0068858_100017135 | |||
| 535 | Ga0068860_100560133 | |||
| 536 | Ga0081540_1006213 | |||
| 537 | Ga0070717_10070713 | |||
| 538 | Ga0075365_10067920 | |||
| 539 | Ga0075364_10026317 | |||
| 540 | Ga0070716_100017444 | |||
| 541 | Ga0070712_100050167 | |||
| 542 | Ga0070712_100340915 | |||
| 543 | Ga0075367_10077158 | |||
| 544 | Ga0075370_10025241 | |||
| 545 | Ga0075370_10286392 | |||
| 546 | Ga0068865_100446190 | |||
| 547 | Ga0075436_100020894 | |||
| 548 | Ga0099794_10007561 | |||
| 549 | Ga0099795_10017419 | |||
| 550 | Ga0105251_10077971 | |||
| 551 | Ga0105240_10042490 | |||
| 552 | Ga0105240_10046512 | |||
| 553 | Ga0105240_10258200 | |||
| 554 | Ga0111539_10263360 | |||
| 555 | Ga0105247_10251281 | |||
| 556 | Ga0114129_10191011 | |||
| 557 | Ga0105243_10682791 | |||
| 558 | Ga0105241_10509067 | |||
| 559 | Ga0105248_10219284 | |||
| 560 | Ga0105237_10072348 | |||
| 561 | Ga0105237_10236651 | |||
| 562 | Ga0105238_10445755 | |||
| 563 | Ga0105249_10353513 | |||
| 564 | Ga0099796_10167300 | |||
| 565 | Ga0105239_10290706 | |||
| 566 | Ga0105239_10415210 | |||
| 567 | Ga0105239_10443204 | |||
| 568 | Ga0105246_10205305 | |||
| 569 | Ga0157373_10103057 | |||
| 570 | Ga0157370_10062680 | |||
| 571 | Ga0157370_10150443 | |||
| 572 | Ga0157370_10183896 | |||
| 573 | Ga0157369_10005972 | |||
| 574 | Ga0157369_10014893 | |||
| 575 | Ga0157369_10028039 | |||
| 576 | Ga0157369_10413740 | |||
| 577 | Ga0157374_10073514 | |||
| 578 | Ga0157378_10743839 | |||
| 579 | Ga0157372_10026107 | |||
| 580 | Ga0157375_10149037 | |||
| 581 | Ga0157375_10503389 | |||
| 582 | Ga0157380_10282193 | |||
| 583 | Ga0157379_10048842 | |||
| 584 | Ga0157379_10098754 | |||
| 585 | Ga0157379_10185213 | |||
| 586 | Ga0163161_10051835 | |||
| 587 | Ga0214544_1000051 | |||
| 588 | Ga0214544_1033822 | |||
| 589 | Ga0214542_1000149 | |||
| 590 | Ga0214545_1000126 | |||
| 591 | Ga0214545_1030987 | |||
| 592 | Ga0214543_1000148 | |||
| 593 | Ga0213872_10127273 | |||
| 594 | Ga0209563_104496 | |||
| 595 | Ga0209677_101509 | |||
| 596 | Ga0209233_1006843 | |||
| 597 | Ga0209758_1001544 | |||
| 598 | Ga0209758_1002693 | |||
| 599 | Ga0209758_1004869 | |||
| 600 | Ga0209758_1017628 | |||
| 601 | Ga0207426_1010863 | |||
| 602 | Ga0207426_1025467 | |||
| 603 | Ga0207692_10003300 | |||
| 604 | Ga0207642_10070411 | |||
| 605 | Ga0207688_10330872 | |||
| 606 | Ga0207647_10099236 | |||
| 607 | Ga0207647_10185631 | |||
| 608 | Ga0207647_10244043 | |||
| 609 | Ga0207699_10000878 | |||
| 610 | Ga0207705_10187880 | |||
| 611 | Ga0207684_10437719 | |||
| 612 | Ga0207707_10000048 | |||
| 613 | Ga0207707_10039803 | |||
| 614 | Ga0207695_10064854 | |||
| 615 | Ga0207695_10083444 | |||
| 616 | Ga0207671_10087172 | |||
| 617 | Ga0207693_10068574 | |||
| 618 | Ga0207663_10001692 | |||
| 619 | Ga0207660_10000122 | |||
| 620 | Ga0207652_10000502 | |||
| 621 | Ga0207652_10081607 | |||
| 622 | Ga0207694_10088625 | |||
| 623 | Ga0207694_10161221 | |||
| 624 | Ga0207650_10314059 | |||
| 625 | Ga0207700_10112247 | |||
| 626 | Ga0207664_10021532 | |||
| 627 | Ga0207665_10002517 | |||
| 628 | Ga0207665_10057486 | |||
| 629 | Ga0207691_10074405 | |||
| 630 | Ga0207711_10496770 | |||
| 631 | Ga0207661_10528098 | |||
| 632 | Ga0207667_10132132 | |||
| 633 | Ga0207667_10315728 | |||
| 634 | Ga0207658_10021844 | |||
| 635 | Ga0207658_10100343 | |||
| 636 | Ga0207703_10041281 | |||
| 637 | Ga0207639_10116023 | |||
| 638 | Ga0207639_10523044 | |||
| 639 | Ga0207678_10022155 | |||
| 640 | Ga0207678_10070309 | |||
| 641 | Ga0207702_10266605 | |||
| 642 | Ga0207702_10615052 | |||
| 643 | Ga0207641_10126622 | |||
| 644 | Ga0207674_10099911 | |||
| 645 | Ga0207683_10232019 | |||
| 646 | Ga0207683_10463848 | |||
| 647 | Ga0209588_1001956 | |||
| 648 | Ga0209813_10094067 | |||
| 649 | Ga0268266_10007595 | |||
| 650 | Ga0268266_10137138 | |||
| 651 | Ga0307515_10011321 | |||
| 652 | Ga0307515_10129114 | |||
| 653 | Ga0307511_10084273 | |||
| 654 | Ga0265330_10036070 | |||
| 655 | Ga0265325_10028296 | |||
| 656 | Ga0265340_10044435 | |||
| 657 | Ga0265331_10008154 | |||
| 658 | Ga0265331_10088778 | |||
| 659 | Ga0307513_10153790 | |||
| 660 | Ga0307513_10517152 | |||
| 661 | Ga0307509_10020383 | |||
| 662 | Ga0307509_10116487 | |||
| 663 | Ga0307509_10151080 | |||
| 664 | Ga0265313_10000427 | |||
| 665 | Ga0307508_10000001 | |||
| 666 | Ga0307516_10018819 | |||
| 667 | Ga0307516_10048236 | |||
| 668 | Ga0307516_10058886 | |||
| 669 | Ga0307516_10296677 | |||
| 670 | Ga0307405_10202977 | |||
| 671 | Ga0307410_10058586 | |||
| 672 | Ga0307406_10087732 | |||
| 673 | Ga0307409_100321911 | |||
| 674 | Ga0307416_100197262 | |||
| 675 | Ga0307411_10373337 | |||
| 676 | Ga0307415_100057916 | |||
| 677 | Ga0307415_100206509 | |||
| 678 | Ga0307507_10018394 | |||
| 679 | Ga0307510_10021555 | |||
| 680 | Ga0373926_0014809 | |||
| 681 | Ga0373936_0020693 | |||
| 682 | Ga0373936_0050322 | |||
| 683 | Ga0373954_0096411 | |||
| 684 | Ga0373943_0000075 | |||
| 685 | Ga0373955_0010745 | |||
| 686 | Ga0373924_0014115 | |||
| 687 | Ga0373924_0021929 | |||
| 688 | Ga0373935_0002382 | |||
| 689 | Ga0373935_0061240 | |||
| 690 | Ga0373935_0444941 | |||
| 691 | Ga0373927_0001971 | |||
| 692 | Ga0373927_0012510 | |||
| 693 | Ga0373927_0019574 | |||
| 694 | Ga0373927_0033244 | |||
| 695 | Ga0373947_0000620 | |||
| 696 | Ga0373947_0174088 | |||
| 697 | Ga0373937_0008910 | |||
| 698 | Ga0373937_0154510 | |||
| 699 | Ga0373937_0254415 | |||
| 700 | Ga0373925_0000631 | |||
| 701 | Ga0373925_0235009 | |||
| 702 | Ga0395900_0047393 | |||
| 703 | Ga0395900_0151303 | |||
| 704 | Ga0395898_0030079 | |||
| 705 | Ga0436364_0194407 | |||
| 706 | Ga0436364_0857559 | |||
| 707 | Ga0395901_0021708 | |||
| 708 | Ga0395901_0360572 | |||
| 709 | Ga0395901_0397243 | |||
| 710 | Ga0400487_20385 | |||
| 711 | Ga0436365_0601496 | |||
| 712 | Ga0436365_1340325 | |||
| 713 | Ga0436360_0334801 | |||
| 714 | Ga0436360_1040629 | |||
| 715 | Ga0436363_0188861 | |||
| 716 | Ga0436362_0644465 | |||
| 717 | Ga0451791_1488532 | |||
| 718 | Ga0451837_0811423 | |||
| 719 | Ga0439462_0010609 | |||
| 720 | Ga0466969_0190089 | |||
| 721 | Ga0466963_0248092 | |||
| 722 | Ga0466964_0076001 | |||
| 723 | Ga0466957_0370431 | |||
| 724 | Ga0466960_0328458 | |||
| 725 | Ga0466959_0043159 | |||
| 726 | Ga0466959_0076880 | |||
| 727 | Ga0466958_0141420 | |||
| 728 | Ga0466967_0374758 | |||
| 729 | Ga0466967_1060594 | |||
| 730 | Ga0495592_0003207 | |||
| 731 | Ga0495592_0106350 | |||
| 732 | Ga0495592_0344885 | |||
| 733 | Ga0495603_0030446 | |||
| 734 | Ga0495629_0001343 | |||
| 735 | Ga0495629_0049405 | |||
| 736 | Ga0495638_0081301 | |||
| 737 | Ga0495638_0081432 | |||
| 738 | Ga0495651_0007546 | |||
| 739 | Ga0495651_0021524 | |||
| 740 | Ga0495653_0003251 | |||
| 741 | Ga0495580_0007061 | |||
| 742 | Ga0495662_0140550 | |||
| 743 | Ga0495664_0011804 | |||
| 744 | Ga0495585_0063037 | |||
| 745 | Ga0495585_0072108 | |||
| 746 | Ga0495596_0038731 | |||
| 747 | Ga0495608_0003162 | |||
| 748 | Ga0495610_0059109 | |||
| 749 | Ga0495616_0082380 | |||
| 750 | Ga0495618_0000901 | |||
| 751 | Ga0495618_0003888 | |||
| 752 | Ga0495630_0002797 | |||
| 753 | Ga0495630_0007209 | |||
| 754 | Ga0495643_0227248 | |||
| 755 | Ga0495644_0008473 | |||
| 756 | Ga0495648_0002172 | |||
| 757 | Ga0495663_0032392 | |||
| 758 | Ga0495666_0223866 | |||
| 759 | Ga0495652_0089041 | |||
| 760 | Ga0495665_0088513 | |||
| 761 | Ga0495640_0002575 | |||
| 762 | Ga0495640_0009803 | |||
| 763 | Ga0495640_0155397 | |||
| 764 | Ga0495587_0014503 | |||
| 765 | Ga0495645_0045968 | |||
| 766 | Ga0495645_0069693 | |||
| 767 | Ga0495645_0223186 | |||
| 768 | Ga0495622_0045144 | |||
| 769 | Ga0495667_0003548 | |||
| 770 | Ga0495656_0011893 | |||
| 771 | Ga0495668_0053748 | |||
| 772 | Ga0495668_0313067 | |||
| 773 | Ga0495634_0041229 | |||
| 774 | Ga0495625_0308892 | |||
| 775 | Ga0495635_0000230 | |||
| 776 | Ga0495635_0000813 | |||
| 777 | Ga0495635_0143591 | |||
| 778 | Ga0495659_0031288 | |||
| 779 | Ga0495661_0060643 | |||
| 780 | Ga0495588_0010100 | |||
| 781 | Ga0495657_0009686 | |||
| 782 | Ga0495599_0000807 | |||
| 783 | Ga0495599_0206658 | |||
| 784 | Ga0495623_0112056 | |||
| 785 | Ga0495647_0250040 | |||
| 786 | Ga0495658_0052021 | |||
| 787 | Ga0495613_0071326 | |||
| 788 | Ga0495624_0003531 | |||
| 789 | Ga0495624_0055171 | |||
| 790 | Ga0495649_0097651 | |||
| 791 | Ga0495600_0001064 | |||
| 792 | Ga0495581_0070889 | |||
| 793 | Ga0495581_0081899 | |||
| 794 | Ga0495604_0004194 | |||
| 795 | Ga0495674_0012101 | |||
| 796 | Ga0495672_0023345 | |||
| 797 | Ga0495676_0019647 | |||
| 798 | Ga0495676_0100129 | |||
| 799 | Ga0495683_0128714 | |||
| 800 | Ga0495675_0001005 | |||
| 801 | Ga0495673_0034158 | |||
| 802 | Ga0495684_0000320 | |||
| 803 | Ga0495684_0009257 | |||
| 804 | Ga0495593_0002091 | |||
| 805 | Ga0495593_0035122 | |||
| 806 | Ga0495602_0019045 | |||
| 807 | Ga0496100_0145093 | |||
| 808 | Ga0496106_0005442 | |||
| 809 | Ga0496106_0351927 | |||
| 810 | Ga0496109_0122393 | |||
| 811 | Ga0496110_0103978 | |||
| 812 | Ga0496115_0024966 | |||
| 813 | Ga0496115_0197597 | |||
| 814 | Ga0496116_0085839 | |||
| 815 | Ga0496117_0014824 | |||
| 816 | Ga0496118_0008043 | |||
| 817 | Ga0496119_0149869 | |||
| 818 | Ga0496121_0000529 | |||
| 819 | Ga0496121_0000864 | |||
| 820 | Ga0496121_0003622 | |||
| 821 | Ga0496121_0090755 | |||
| 822 | Ga0496121_0094134 | |||
| 823 | Ga0496122_0040835 | |||
| 824 | Ga0496122_0199154 | |||
| 825 | Ga0496124_0001167 | |||
| 826 | Ga0496125_0003560 | |||
| 827 | Ga0496125_0011234 | |||
| 828 | Ga0496126_0003918 | |||
| 829 | Ga0496126_0011720 | |||
| 830 | Ga0496126_0016798 | |||
| 831 | Ga0496126_0018029 | |||
| 832 | Ga0496126_0019316 | |||
| 833 | Ga0496126_0035315 | |||
| 834 | Ga0496126_0048701 | |||
| 835 | Ga0496126_0112399 | |||
| 836 | Ga0496126_0550968 | |||
| 837 | Ga0496126_0662685 | |||
| 838 | Ga0495682_0080030 | |||
| 839 | Ga0501031_0307989 | |||
| 840 | Ga0501032_0219786 | |||
| 841 | Ga0501033_0016655 | |||
| 842 | Ga0501034_0282534 | |||
| 843 | Ga0501034_0356131 | |||
| 844 | Ga0501034_0406508 | |||
| 845 | Ga0501036_0514821 | |||
| 846 | Ga0501037_0175332 | |||
| 847 | Ga0501037_0192074 | |||
| 848 | Ga0501038_0090107 | |||
| 849 | Ga0501043_0160251 | |||
| 850 | Ga0501043_0284146 | |||
| 851 | Ga0501047_0042743 | |||
| 852 | Ga0501047_0277446 | |||
| 853 | Ga0501069_0064070 | |||
| 854 | Ga0501080_0319407 | |||
| 855 | Ga0501035_0208183 | |||
| 856 | Ga0501044_0100554 | |||
| 857 | Ga0501044_0194118 | |||
| 858 | nmdc:mga03n38_31206_c1 | |||
| 859 | nmdc:mga00v17_18439_c1 | |||
| 860 | nmdc:mga0yw44_7571_c1 | |||
| 861 | nmdc:mga06z11_173302_c1 | |||
| 862 | nmdc:mga04h51_111209_c1 | |||
| 863 | nmdc:mga07m45_35330_c1 | |||
| 864 | nmdc:mga05p37_411145_c1 | |||
| 865 | nmdc:mga09592_213586_c1 | |||
| 866 | nmdc:mga0n895_117326_c1 | |||
| 867 | nmdc:mga0n895_171914_c1 | |||
| 868 | nmdc:mga0rr50_63338_c1 | |||
| 869 | nmdc:mga08x19_319750_c1 | |||
| 870 | nmdc:mga08x19_50640_c1 | |||
| 871 | nmdc:mga0sz30_16517_c1 | |||
| 872 | Ga0495601_0070183 | |||
| 873 | Ga0495612_0093515 | |||
| 874 | Ga0500635_0023109 | |||
| 875 | Ga0495595_0001005 | |||
| 876 | Ga0495619_0002499 | |||
| 877 | Ga0495619_0018102 | |||
| 878 | Ga0500644_0000477 | |||
| 879 | Ga0500646_0043707 | |||
| 880 | Ga0500583_0188239 | |||
| 881 | Ga0500651_0061364 | |||
| 882 | Ga0500651_0235960 | |||
| 883 | Ga0500566_0121173 | |||
| 884 | Ga0500641_0012491 | |||
| 885 | Ga0500641_0038823 | |||
| 886 | Ga0500641_0115838 | |||
| 887 | Ga0500557_000061 | |||
| 888 | Ga0500562_073173 | |||
| 889 | Ga0500592_011239 | |||
| 890 | Ga0500593_000373 | |||
| 891 | Ga0500595_001340 | |||
| 892 | Ga0500595_007250 | |||
| 893 | Ga0500642_0006544 | |||
| 894 | Ga0500642_0059042 | |||
| 895 | Ga0500642_0181447 | |||
| 896 | Ga0500559_0004536 | |||
| 897 | Ga0500559_0129475 | |||
| 898 | Ga0500568_0093456 | |||
| 899 | Ga0500577_0034781 | |||
| 900 | Ga0500577_0035771 | |||
| 901 | Ga0500590_189579 | |||
| 902 | Ga0500604_0050688 | |||
| 903 | Ga0500616_0000006 | |||
| 904 | Ga0500616_0018244 | |||
| 905 | Ga0500616_0105155 | |||
| 906 | Ga0500638_073513 | |||
| 907 | Ga0500636_0030507 | |||
| 908 | Ga0500637_0000077 | |||
| 909 | Ga0500570_026145 | |||
| 910 | Ga0500661_000100 | |||
| 911 | Ga0501082_0864995 | |||
| 912 | Ga0466962_0089555 | |||
| 913 | 2513675497 | |||
| 914 | 2513892871 | |||
| 915 | 2514014008 | |||
| 916 | 2524470597 | |||
| 917 | 2617351319 | |||
| 918 | 2617376269 | |||
| 919 | 2644729106 | |||
| 920 | 2644745609 | |||
| 921 | 2793080749 | |||
| 922 | 2824605026 | |||
| 923 | 2824613902 | |||
| 924 | 2824665108 | |||
| 925 | 2824679460 | |||
| 926 | 2824695596 | |||
| 927 | 2824737476 | |||
| 928 | 2824750070 | |||
| 929 | 2824779213 | |||
| 930 | 2838126319 | |||
| 931 | 2841943602 | |||
| 932 | 2841950447 | |||
| 933 | 2841966761 | |||
| 934 | 2841975517 | |||
| 935 | 2841988343 | |||
| 936 | 2842039567 | |||
| 937 | 2849079819 | |||
| 938 | 2851184367 | |||
| 939 | 2885371994 | |||
| 940 | 2885411020 | |||
| 941 | 2888423964 | |||
| 942 | 2903772640 | |||
| 943 | 2903772641 | |||
| 944 | 2908779609 | |||
| 945 | 2929617468 | |||
| 946 | 2929627173 | |||
| 947 | 2933579424 | |||
| 948 | 2935682377 | |||
| 949 | 8055746917 | |||
| 950 | 8056683247 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wge-assembly1.cif.gz_B | cryo-em structure of human cohesin-nipbl-dna complex without stag1 | 0.757 | 159 | 235 |
| 8dk3-assembly1.cif.gz_B | cryoem structure of pseudomonas aeruginosa pa14 jetc atpase domain bound to dna and cwhd domain of jeta | 0.7373 | 16 | 72 |
| 6yuf-assembly1.cif.gz_A | cohesin complex with loader gripping dna | 0.7308 | 152 | 232 |
| 7q2y-assembly1.cif.gz_A | cryo-em structure of clamped s.cerevisiae condensin-dna complex (form ii) | 0.73 | 166 | 227 |
| 5dac-assembly1.cif.gz_B | atp-gamma-s bound rad50 from chaetomium thermophilum in complex with dna | 0.7196 | 14 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60273_1_105_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8611 | 150 | 211 | 3.40.50.300 |
| af_P9WGF3_1013_1197_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7895 | 152 | 212 | 3.40.50.300 |
| af_Q95Y73_20_307_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7445 | 52 | 74 | 3.40.50.300 |
| 3bosA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7359 | 154 | 203 | 3.40.50.300 |
| af_A4HZD1_1304_1480_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7337 | 147 | 212 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1PZW1-F1-model_v4 | Predicted ATPase | 0.9681 | 1 | 255 |
GO:0005524
GO:0005886 GO:0006302 GO:0006826 GO:0016887 |
| AF-A0A5N7MCA2-F1-model_v4 | AAA family ATPase | 0.9675 | 11 | 255 |
GO:0005524
GO:0005886 GO:0006302 GO:0006826 GO:0016887 |
| AF-A0A1H1PZW1-F1-model_v4 | Predicted ATPase | 0.9643 | 1 | 255 |
GO:0005524
GO:0005886 GO:0006302 GO:0006826 GO:0016887 |
| AF-A0A5N7MCA2-F1-model_v4 | AAA family ATPase | 0.9598 | 11 | 255 |
GO:0005524
GO:0005886 GO:0006302 GO:0006826 GO:0016887 |
| AF-A0A529X8Y8-F1-model_v4 | ATP-binding protein | 0.9589 | 143 | 254 |
GO:0005524
GO:0005886 GO:0006811 GO:0016887 |