F451525

General Info

Members Datasets Scaffolds Average Seq Length
476 333 950 253

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10012272|Ga0157378_100122726
Length 308
Sequence MLASCLHGVGDSGSESGSATGTGSVIWITVAYCARDAADAKCGAVRGNSDMASQRGRSTNLQAPYLRRVWLDAERVSDPEAYPFCLPFLRDEFELEFDSAVTIVVGENGTGKSTLLEGIAVLAGYHDSGGGKGYTTVDDTWAMEKTGAELSKALRASWLPKVTNGWFFRAESFFSVARYLDQMAQQYPMGGGPPPDYLSHSHGEGFLRFFEERCRKQGIFIFDEPESALSPSRQIEFLKLLRRMDQSGICQVIMATHSPMLMAYPNARLLRLSKYGLEQVTVRETDHYKVMREFCEDPDGFVQAAIEE

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
281 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
294 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
298 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
299 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
300 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
301 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
302 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
303 2643221733 Bosea sp. Root381 Isolate Unclassified
304 2643221736 Bosea sp. Root483D1 Isolate Unclassified
305 2791355199
306 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
307 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
308 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
309 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
310 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
311 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
312 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
313 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
314 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
315 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
316 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
317 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
318 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
319 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
320 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
321 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
322 2851182111 Bosea sp. Tri-44 Isolate Nodule
323 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
324 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
325 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
326 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
327 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
328 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
329 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
330 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
331 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
332 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
333 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 0
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.03
Nodule 5.67
Rhizoplane 1.68
Rhizosphere 65.76
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10012272 3300013297 Bacteria 7500
2 RicEn_C3328 2010549000 Bacteria 1820
3 JGI25159J45721_1003651 3300002987 Bacteria 5349
4 JGI25153J46596_10001368 3300003215 Bacteria 14592
5 JGI25153J46596_10055339 3300003215 Bacteria 1110
6 rootH1_10105374 3300003316 Bacteria 1426
7 rootL2_10217417 3300003322 Bacteria 1288
8 JGI25160J50197_1002759 3300003354 Bacteria 8049
9 Ga0065165_1043635 3300005262 Bacteria 1315
10 Ga0070658_10162266 3300005327 Bacteria 1875
11 Ga0070683_100020570 3300005329 Bacteria 5872
12 Ga0068869_100218203 3300005334 Bacteria 1510
13 Ga0070680_100004196 3300005336 Bacteria 10806
14 Ga0070680_100006163 3300005336 Bacteria 9091
15 Ga0070680_100200286 3300005336 Bacteria 1684
16 Ga0070680_100244539 3300005336 Bacteria 1517
17 Ga0070682_100517002 3300005337 Bacteria 928
18 Ga0070660_100162801 3300005339 Bacteria 1798
19 Ga0070661_100223521 3300005344 Bacteria 1445
20 Ga0070661_100343477 3300005344 Bacteria 1170
21 Ga0070675_100674737 3300005354 Bacteria 940
22 Ga0070659_100079520 3300005366 Bacteria 2617
23 Ga0070659_100185679 3300005366 Bacteria 1707
24 Ga0070667_100075019 3300005367 Bacteria 2886
25 Ga0070667_100729316 3300005367 Unclassified 918
26 Ga0070709_10004552 3300005434 Bacteria 7487
27 Ga0070714_100009562 3300005435 Bacteria 7629
28 Ga0070713_100132925 3300005436 Bacteria 2196
29 Ga0070713_100473060 3300005436 Bacteria 1180
30 Ga0070710_10000370 3300005437 Bacteria 21096
31 Ga0070711_100011526 3300005439 Bacteria 5494
32 Ga0070705_100080260 3300005440 Bacteria 2001
33 Ga0070663_100093294 3300005455 Bacteria 2233
34 Ga0070663_100113575 3300005455 Bacteria 2039
35 Ga0070681_10000001 3300005458 Bacteria 946857
36 Ga0070681_10132950 3300005458 Bacteria 2419
37 Ga0070681_10146732 3300005458 Bacteria 2288
38 Ga0070685_10191109 3300005466 Bacteria 1325
39 Ga0070706_100485968 3300005467 Bacteria 1149
40 Ga0070679_100220543 3300005530 Bacteria 1857
41 Ga0070684_100012263 3300005535 Bacteria 6864
42 Ga0070684_100097677 3300005535 Bacteria 2620
43 Ga0070697_100123650 3300005536 Bacteria 2166
44 Ga0068853_100026902 3300005539 Bacteria 4833
45 Ga0068853_100072121 3300005539 Bacteria 3009
46 Ga0068853_100341798 3300005539 Bacteria 1391
47 Ga0068853_100386289 3300005539 Bacteria 1308
48 Ga0070695_100026786 3300005545 Bacteria 3568
49 Ga0070665_100016084 3300005548 Bacteria 7508
50 Ga0070665_100043107 3300005548 Bacteria 4536
51 Ga0070665_100099072 3300005548 Bacteria 2919
52 Ga0068855_100072955 3300005563 Bacteria 3989
53 Ga0068855_100241849 3300005563 Bacteria 2016
54 Ga0068855_100363622 3300005563 Bacteria 1592
55 Ga0068857_100060263 3300005577 Bacteria 3372
56 Ga0068852_100010479 3300005616 Bacteria 6931
57 Ga0068852_100333349 3300005616 Bacteria 1477
58 Ga0068863_100468653 3300005841 Bacteria 1238
59 Ga0068858_100017135 3300005842 Bacteria 6798
60 Ga0068860_100560133 3300005843 Bacteria 1146
61 Ga0081540_1006213 3300005983 Bacteria 8758
62 Ga0070717_10070713 3300006028 Bacteria 2909
63 Ga0075365_10067920 3300006038 Bacteria 2394
64 Ga0075364_10026317 3300006051 Bacteria 3710
65 Ga0070716_100017444 3300006173 Bacteria 3722
66 Ga0070712_100050167 3300006175 Bacteria 2902
67 Ga0070712_100340915 3300006175 Bacteria 1224
68 Ga0075367_10077158 3300006178 Bacteria 2011
69 Ga0075370_10025241 3300006353 Bacteria 3285
70 Ga0075370_10286392 3300006353 Bacteria 979
71 Ga0068865_100446190 3300006881 Bacteria 1069
72 Ga0075436_100020894 3300006914 Bacteria 4491
73 Ga0099794_10007561 3300007265 Bacteria 4471
74 Ga0099795_10017419 3300007788 Bacteria 2290
75 Ga0105251_10077971 3300009011 Bacteria 1535
76 Ga0105240_10042490 3300009093 Bacteria 5791
77 Ga0105240_10046512 3300009093 Bacteria 5498
78 Ga0105240_10258200 3300009093 Bacteria 2011
79 Ga0111539_10263360 3300009094 Bacteria 2007
80 Ga0105247_10251281 3300009101 Bacteria 1209
81 Ga0114129_10191011 3300009147 Bacteria 2781
82 Ga0105243_10682791 3300009148 Bacteria 999
83 Ga0105241_10509067 3300009174 Bacteria 1075
84 Ga0105248_10219284 3300009177 Bacteria 2142
85 Ga0105237_10072348 3300009545 Bacteria 3442
86 Ga0105237_10236651 3300009545 Bacteria 1827
87 Ga0105238_10445755 3300009551 Bacteria 1291
88 Ga0105249_10353513 3300009553 Bacteria 1489
89 Ga0099796_10167300 3300010159 Bacteria 875
90 Ga0105239_10290706 3300010375 Unclassified 1840
91 Ga0105239_10415210 3300010375 Bacteria 1524
92 Ga0105239_10443204 3300010375 Bacteria 1473
93 Ga0105246_10205305 3300011119 Bacteria 1535
94 Ga0157373_10103057 3300013100 Bacteria 2007
95 Ga0157370_10062680 3300013104 Bacteria 3525
96 Ga0157370_10150443 3300013104 Bacteria 2166
97 Ga0157370_10183896 3300013104 Bacteria 1941
98 Ga0157369_10005972 3300013105 Bacteria 14140
99 Ga0157369_10014893 3300013105 Bacteria 8777
100 Ga0157369_10028039 3300013105 Bacteria 6236
101 Ga0157369_10413740 3300013105 Unclassified 1398
102 Ga0157374_10073514 3300013296 Bacteria 3227
103 Ga0157378_10743839 3300013297 Bacteria 1003
104 Ga0157372_10026107 3300013307 Bacteria 6356
105 Ga0157375_10149037 3300013308 Bacteria 2473
106 Ga0157375_10503389 3300013308 Bacteria 1375
107 Ga0157380_10282193 3300014326 Bacteria 1520
108 Ga0157379_10048842 3300014968 Bacteria 3777
109 Ga0157379_10098754 3300014968 Bacteria 2621
110 Ga0157379_10185213 3300014968 Bacteria 1881
111 Ga0163161_10051835 3300017792 Bacteria 2974
112 Ga0214544_1000051 3300021320 Bacteria 134645
113 Ga0214544_1033822 3300021320 Bacteria 1476
114 Ga0214542_1000149 3300021321 Bacteria 102700
115 Ga0214545_1000126 3300021324 Bacteria 91489
116 Ga0214545_1030987 3300021324 Bacteria 2211
117 Ga0214543_1000148 3300021327 Bacteria 98370
118 Ga0213872_10127273 3300021361 Bacteria 1124
119 Ga0209563_104496 3300025230 Bacteria 2655
120 Ga0209677_101509 3300025253 Bacteria 9980
121 Ga0209233_1006843 3300025261 Bacteria 3646
122 Ga0209758_1001544 3300025297 Bacteria 26459
123 Ga0209758_1002693 3300025297 Bacteria 17518
124 Ga0209758_1004869 3300025297 Bacteria 10814
125 Ga0209758_1017628 3300025297 Bacteria 3542
126 Ga0207426_1010863 3300025302 Bacteria 3506
127 Ga0207426_1025467 3300025302 Bacteria 1992
128 Ga0207692_10003300 3300025898 Bacteria 6286
129 Ga0207642_10070411 3300025899 Bacteria 1662
130 Ga0207688_10330872 3300025901 Bacteria 936
131 Ga0207647_10099236 3300025904 Bacteria 1730
132 Ga0207647_10185631 3300025904 Bacteria 1206
133 Ga0207647_10244043 3300025904 Bacteria 1031
134 Ga0207699_10000878 3300025906 Bacteria 14349
135 Ga0207705_10187880 3300025909 Bacteria 1561
136 Ga0207684_10437719 3300025910 Bacteria 1123
137 Ga0207707_10000048 3300025912 Bacteria 117799
138 Ga0207707_10039803 3300025912 Bacteria 4108
139 Ga0207695_10064854 3300025913 Bacteria 3758
140 Ga0207695_10083444 3300025913 Bacteria 3228
141 Ga0207671_10087172 3300025914 Bacteria 2347
142 Ga0207693_10068574 3300025915 Bacteria 2776
143 Ga0207663_10001692 3300025916 Bacteria 10367
144 Ga0207660_10000122 3300025917 Bacteria 45383
145 Ga0207652_10000502 3300025921 Bacteria 39810
146 Ga0207652_10081607 3300025921 Bacteria 2829
147 Ga0207694_10088625 3300025924 Bacteria 2439
148 Ga0207694_10161221 3300025924 Bacteria 1811
149 Ga0207650_10314059 3300025925 Bacteria 1282
150 Ga0207700_10112247 3300025928 Bacteria 2196
151 Ga0207664_10021532 3300025929 Bacteria 4797
152 Ga0207665_10002517 3300025939 Bacteria 12320
153 Ga0207665_10057486 3300025939 Bacteria 2628
154 Ga0207691_10074405 3300025940 Bacteria 3064
155 Ga0207711_10496770 3300025941 Bacteria 1137
156 Ga0207661_10528098 3300025944 Bacteria 1080
157 Ga0207667_10132132 3300025949 Bacteria 2571
158 Ga0207667_10315728 3300025949 Bacteria 1596
159 Ga0207658_10021844 3300025986 Bacteria 4448
160 Ga0207658_10100343 3300025986 Bacteria 2266
161 Ga0207703_10041281 3300026035 Bacteria 3695
162 Ga0207639_10116023 3300026041 Bacteria 2191
163 Ga0207639_10523044 3300026041 Bacteria 1086
164 Ga0207678_10022155 3300026067 Bacteria 5567
165 Ga0207678_10070309 3300026067 Bacteria 3001
166 Ga0207702_10266605 3300026078 Bacteria 1614
167 Ga0207702_10615052 3300026078 Bacteria 1067
168 Ga0207641_10126622 3300026088 Bacteria 2287
169 Ga0207674_10099911 3300026116 Bacteria 2883
170 Ga0207683_10232019 3300026121 Bacteria 1683
171 Ga0207683_10463848 3300026121 Bacteria 1168
172 Ga0209588_1001956 3300027671 Bacteria 5521
173 Ga0209813_10094067 3300027866 Bacteria 1010
174 Ga0268266_10007595 3300028379 Bacteria 9763
175 Ga0268266_10137138 3300028379 Bacteria 2192
176 Ga0307515_10011321 3300028794 Bacteria 16930
177 Ga0307515_10129114 3300028794 Bacteria 2798
178 Ga0307511_10084273 3300030521 Bacteria 2208
179 Ga0265330_10036070 3300031235 Bacteria 2205
180 Ga0265325_10028296 3300031241 Bacteria 3022
181 Ga0265340_10044435 3300031247 Bacteria 2173
182 Ga0265331_10008154 3300031250 Bacteria 5980
183 Ga0265331_10088778 3300031250 Bacteria 1430
184 Ga0307513_10153790 3300031456 Bacteria 2204
185 Ga0307513_10517152 3300031456 Bacteria 909
186 Ga0307509_10020383 3300031507 Bacteria 7521
187 Ga0307509_10116487 3300031507 Bacteria 2661
188 Ga0307509_10151080 3300031507 Bacteria 2238
189 Ga0265313_10000427 3300031595 Bacteria 44927
190 Ga0307508_10000001 3300031616 Bacteria 553635
191 Ga0307516_10018819 3300031730 Bacteria 7169
192 Ga0307516_10048236 3300031730 Bacteria 4191
193 Ga0307516_10058886 3300031730 Bacteria 3737
194 Ga0307516_10296677 3300031730 Bacteria 1293
195 Ga0307405_10202977 3300031731 Bacteria 1441
196 Ga0307410_10058586 3300031852 Bacteria 2626
197 Ga0307406_10087732 3300031901 Bacteria 2086
198 Ga0307409_100321911 3300031995 Bacteria 1447
199 Ga0307416_100197262 3300032002 Bacteria 1906
200 Ga0307411_10373337 3300032005 Bacteria 1170
201 Ga0307415_100057916 3300032126 Bacteria 2665
202 Ga0307415_100206509 3300032126 Bacteria 1563
203 Ga0307507_10018394 3300033179 Bacteria 7947
204 Ga0307510_10021555 3300033180 Bacteria 7508
205 Ga0373926_0014809 3300035083 Bacteria 2655
206 Ga0373936_0020693 3300035113 Bacteria 2557
207 Ga0373936_0050322 3300035113 Bacteria 1685
208 Ga0373954_0096411 3300035118 Bacteria 1424
209 Ga0373943_0000075 3300035170 Bacteria 34975
210 Ga0373955_0010745 3300035172 Bacteria 4336
211 Ga0373924_0014115 3300035410 Bacteria 3013
212 Ga0373924_0021929 3300035410 Bacteria 2493
213 Ga0373935_0002382 3300035692 Bacteria 10743
214 Ga0373935_0061240 3300035692 Bacteria 2409
215 Ga0373935_0444941 3300035692 Bacteria 935
216 Ga0373927_0001971 3300035695 Bacteria 15141
217 Ga0373927_0012510 3300035695 Bacteria 5651
218 Ga0373927_0019574 3300035695 Bacteria 4437
219 Ga0373927_0033244 3300035695 Bacteria 3358
220 Ga0373947_0000620 3300035725 Bacteria 20963
221 Ga0373947_0174088 3300035725 Bacteria 1398
222 Ga0373937_0008910 3300036401 Bacteria 8710
223 Ga0373937_0154510 3300036401 Bacteria 2150
224 Ga0373937_0254415 3300036401 Bacteria 1656
225 Ga0373925_0000631 3300037068 Bacteria 33279
226 Ga0373925_0235009 3300037068 Bacteria 1466
227 Ga0395900_0047393 3300037418 Bacteria 4425
228 Ga0395900_0151303 3300037418 Bacteria 2371
229 Ga0395898_0030079 3300037466 Bacteria 5438
230 Ga0436364_0194407 3300037853 Bacteria 6508
231 Ga0436364_0857559 3300037853 Bacteria 858
232 Ga0395901_0021708 3300038443 Bacteria 6578
233 Ga0395901_0360572 3300038443 Bacteria 1499
234 Ga0395901_0397243 3300038443 Bacteria 1417
235 Ga0400487_20385 3300039110 Bacteria 1421
236 Ga0436365_0601496 3300039437 Bacteria 2519
237 Ga0436365_1340325 3300039437 Bacteria 1182
238 Ga0436360_0334801 3300039438 Bacteria 1033
239 Ga0436360_1040629 3300039438 Bacteria 2439
240 Ga0436363_0188861 3300039450 Bacteria 888
241 Ga0436362_0644465 3300039453 Bacteria 2779
242 Ga0451791_1488532 3300041451 Bacteria 994
243 Ga0451837_0811423 3300041494 Bacteria 919
244 Ga0439462_0010609 3300042015 Bacteria 2335
245 Ga0466969_0190089 3300044656 Bacteria 938
246 Ga0466963_0248092 3300044694 Bacteria 1249
247 Ga0466964_0076001 3300044706 Bacteria 1431
248 Ga0466957_0370431 3300044842 Bacteria 975
249 Ga0466960_0328458 3300044901 Bacteria 868
250 Ga0466959_0043159 3300045049 Bacteria 3326
251 Ga0466959_0076880 3300045049 Bacteria 2410
252 Ga0466958_0141420 3300045836 Bacteria 1515
253 Ga0466967_0374758 3300045976 Bacteria 1381
254 Ga0466967_1060594 3300045976 Bacteria 807
255 Ga0495592_0003207 3300046454 Bacteria 11722
256 Ga0495592_0106350 3300046454 Bacteria 1992
257 Ga0495592_0344885 3300046454 Bacteria 956
258 Ga0495603_0030446 3300046455 Bacteria 3250
259 Ga0495629_0001343 3300046459 Bacteria 19368
260 Ga0495629_0049405 3300046459 Bacteria 2948
261 Ga0495638_0081301 3300046460 Bacteria 1967
262 Ga0495638_0081432 3300046460 Bacteria 1965
263 Ga0495651_0007546 3300046462 Bacteria 8320
264 Ga0495651_0021524 3300046462 Bacteria 5012
265 Ga0495653_0003251 3300046463 Bacteria 13038
266 Ga0495580_0007061 3300046472 Bacteria 9052
267 Ga0495662_0140550 3300046476 Bacteria 1188
268 Ga0495664_0011804 3300046477 Bacteria 4933
269 Ga0495585_0063037 3300046492 Bacteria 2035
270 Ga0495585_0072108 3300046492 Bacteria 1882
271 Ga0495596_0038731 3300046500 Bacteria 1884
272 Ga0495608_0003162 3300046511 Bacteria 11774
273 Ga0495610_0059109 3300046512 Bacteria 1831
274 Ga0495616_0082380 3300046513 Bacteria 1537
275 Ga0495618_0000901 3300046514 Bacteria 20426
276 Ga0495618_0003888 3300046514 Bacteria 9231
277 Ga0495630_0002797 3300046517 Bacteria 12114
278 Ga0495630_0007209 3300046517 Bacteria 7926
279 Ga0495643_0227248 3300046522 Bacteria 882
280 Ga0495644_0008473 3300046523 Bacteria 3960
281 Ga0495648_0002172 3300046524 Bacteria 18452
282 Ga0495663_0032392 3300046525 Bacteria 1557
283 Ga0495666_0223866 3300046526 Bacteria 861
284 Ga0495652_0089041 3300046529 Bacteria 2528
285 Ga0495665_0088513 3300046531 Bacteria 1627
286 Ga0495640_0002575 3300046533 Bacteria 14577
287 Ga0495640_0009803 3300046533 Bacteria 7438
288 Ga0495640_0155397 3300046533 Bacteria 1468
289 Ga0495587_0014503 3300046536 Bacteria 4941
290 Ga0495645_0045968 3300046543 Bacteria 3184
291 Ga0495645_0069693 3300046543 Bacteria 2538
292 Ga0495645_0223186 3300046543 Bacteria 1266
293 Ga0495622_0045144 3300046557 Bacteria 2048
294 Ga0495667_0003548 3300046559 Bacteria 10479
295 Ga0495656_0011893 3300046615 Bacteria 3201
296 Ga0495668_0053748 3300046616 Bacteria 2226
297 Ga0495668_0313067 3300046616 Bacteria 861
298 Ga0495634_0041229 3300046642 Bacteria 3135
299 Ga0495625_0308892 3300046660 Bacteria 1010
300 Ga0495635_0000230 3300046663 Bacteria 35642
301 Ga0495635_0000813 3300046663 Bacteria 20461
302 Ga0495635_0143591 3300046663 Bacteria 1625
303 Ga0495659_0031288 3300046664 Bacteria 1856
304 Ga0495661_0060643 3300046665 Bacteria 2247
305 Ga0495588_0010100 3300046674 Bacteria 4379
306 Ga0495657_0009686 3300046675 Bacteria 7288
307 Ga0495599_0000807 3300046678 Bacteria 17610
308 Ga0495599_0206658 3300046678 Bacteria 1205
309 Ga0495623_0112056 3300046679 Bacteria 1652
310 Ga0495647_0250040 3300046681 Bacteria 789
311 Ga0495658_0052021 3300046683 Bacteria 2321
312 Ga0495613_0071326 3300046689 Bacteria 2532
313 Ga0495624_0003531 3300046690 Bacteria 11588
314 Ga0495624_0055171 3300046690 Bacteria 2504
315 Ga0495649_0097651 3300046694 Bacteria 1563
316 Ga0495600_0001064 3300046809 Bacteria 14886
317 Ga0495581_0070889 3300047315 Bacteria 2016
318 Ga0495581_0081899 3300047315 Bacteria 1869
319 Ga0495604_0004194 3300047317 Bacteria 11424
320 Ga0495674_0012101 3300047319 Bacteria 8131
321 Ga0495672_0023345 3300047320 Bacteria 4003
322 Ga0495676_0019647 3300047321 Bacteria 5940
323 Ga0495676_0100129 3300047321 Bacteria 2146
324 Ga0495683_0128714 3300047323 Bacteria 1196
325 Ga0495675_0001005 3300047444 Bacteria 17160
326 Ga0495673_0034158 3300047469 Bacteria 2353
327 Ga0495684_0000320 3300047471 Bacteria 38898
328 Ga0495684_0009257 3300047471 Bacteria 7606
329 Ga0495593_0002091 3300047673 Bacteria 11943
330 Ga0495593_0035122 3300047673 Bacteria 2723
331 Ga0495602_0019045 3300048088 Bacteria 6828
332 Ga0496100_0145093 3300048903 Bacteria 1687
333 Ga0496106_0005442 3300048909 Bacteria 9422
334 Ga0496106_0351927 3300048909 Bacteria 1183
335 Ga0496109_0122393 3300048912 Bacteria 2424
336 Ga0496110_0103978 3300048913 Bacteria 2548
337 Ga0496115_0024966 3300048918 Bacteria 4650
338 Ga0496115_0197597 3300048918 Bacteria 1662
339 Ga0496116_0085839 3300048919 Bacteria 1933
340 Ga0496117_0014824 3300048920 Bacteria 6689
341 Ga0496118_0008043 3300048921 Bacteria 11011
342 Ga0496119_0149869 3300048922 Bacteria 1251
343 Ga0496121_0000529 3300048924 Bacteria 72533
344 Ga0496121_0000864 3300048924 Bacteria 54785
345 Ga0496121_0003622 3300048924 Bacteria 21784
346 Ga0496121_0090755 3300048924 Bacteria 2387
347 Ga0496121_0094134 3300048924 Bacteria 2331
348 Ga0496122_0040835 3300048925 Bacteria 3680
349 Ga0496122_0199154 3300048925 Bacteria 1173
350 Ga0496124_0001167 3300048927 Bacteria 41138
351 Ga0496125_0003560 3300048928 Bacteria 18764
352 Ga0496125_0011234 3300048928 Bacteria 8976
353 Ga0496126_0003918 3300048929 Bacteria 18248
354 Ga0496126_0011720 3300048929 Bacteria 9035
355 Ga0496126_0016798 3300048929 Bacteria 7306
356 Ga0496126_0018029 3300048929 Bacteria 7014
357 Ga0496126_0019316 3300048929 Bacteria 6712
358 Ga0496126_0035315 3300048929 Bacteria 4687
359 Ga0496126_0048701 3300048929 Bacteria 3871
360 Ga0496126_0112399 3300048929 Bacteria 2372
361 Ga0496126_0550968 3300048929 Bacteria 915
362 Ga0496126_0662685 3300048929 Bacteria 815
363 Ga0495682_0080030 3300049460 Bacteria 1175
364 Ga0501031_0307989 3300049568 Bacteria 1026
365 Ga0501032_0219786 3300049569 Bacteria 1237
366 Ga0501033_0016655 3300049570 Bacteria 5559
367 Ga0501034_0282534 3300049571 Bacteria 1599
368 Ga0501034_0356131 3300049571 Bacteria 1391
369 Ga0501034_0406508 3300049571 Bacteria 1284
370 Ga0501036_0514821 3300049572 Bacteria 995
371 Ga0501037_0175332 3300049573 Bacteria 1523
372 Ga0501037_0192074 3300049573 Bacteria 1445
373 Ga0501038_0090107 3300049574 Bacteria 2571
374 Ga0501043_0160251 3300049579 Bacteria 1758
375 Ga0501043_0284146 3300049579 Bacteria 1268
376 Ga0501047_0042743 3300049581 Bacteria 4378
377 Ga0501047_0277446 3300049581 Bacteria 1521
378 Ga0501069_0064070 3300049585 Bacteria 2054
379 Ga0501080_0319407 3300049742 Bacteria 1406
380 Ga0501035_0208183 3300049822 Bacteria 1674
381 Ga0501044_0100554 3300049823 Bacteria 2910
382 Ga0501044_0194118 3300049823 Bacteria 1991
383 nmdc:mga03n38_31206_c1 3300050490 Bacteria 2246
384 nmdc:mga00v17_18439_c1 3300050491 Bacteria 3964
385 nmdc:mga0yw44_7571_c1 3300050492 Bacteria 5352
386 nmdc:mga06z11_173302_c1 3300050494 Bacteria 1240
387 nmdc:mga04h51_111209_c1 3300050495 Bacteria 1010
388 nmdc:mga07m45_35330_c1 3300050496 Bacteria 2779
389 nmdc:mga05p37_411145_c1 3300050507 Bacteria 1577
390 nmdc:mga09592_213586_c1 3300050508 Bacteria 1671
391 nmdc:mga0n895_117326_c1 3300050512 Bacteria 2681
392 nmdc:mga0n895_171914_c1 3300050512 Bacteria 2199
393 nmdc:mga0rr50_63338_c1 3300050513 Bacteria 2792
394 nmdc:mga08x19_319750_c1 3300050514 Bacteria 1080
395 nmdc:mga08x19_50640_c1 3300050514 Bacteria 2665
396 nmdc:mga0sz30_16517_c1 3300050516 Bacteria 2933
397 Ga0495601_0070183 3300053077 Bacteria 2236
398 Ga0495612_0093515 3300053078 Bacteria 1275
399 Ga0500635_0023109 3300053080 Bacteria 1936
400 Ga0495595_0001005 3300053084 Bacteria 10865
401 Ga0495619_0002499 3300053085 Bacteria 12040
402 Ga0495619_0018102 3300053085 Bacteria 4467
403 Ga0500644_0000477 3300053088 Bacteria 17595
404 Ga0500646_0043707 3300053090 Bacteria 1269
405 Ga0500583_0188239 3300053092 Bacteria 1027
406 Ga0500651_0061364 3300053093 Bacteria 2349
407 Ga0500651_0235960 3300053093 Bacteria 1068
408 Ga0500566_0121173 3300053094 Bacteria 1410
409 Ga0500641_0012491 3300053096 Bacteria 3103
410 Ga0500641_0038823 3300053096 Bacteria 1915
411 Ga0500641_0115838 3300053096 Bacteria 1154
412 Ga0500557_000061 3300053105 Bacteria 44319
413 Ga0500562_073173 3300053108 Bacteria 925
414 Ga0500592_011239 3300053116 Bacteria 1431
415 Ga0500593_000373 3300053117 Bacteria 18007
416 Ga0500595_001340 3300053119 Bacteria 13316
417 Ga0500595_007250 3300053119 Bacteria 4608
418 Ga0500642_0006544 3300053130 Bacteria 3846
419 Ga0500642_0059042 3300053130 Bacteria 1716
420 Ga0500642_0181447 3300053130 Bacteria 984
421 Ga0500559_0004536 3300053136 Bacteria 6569
422 Ga0500559_0129475 3300053136 Unclassified 1178
423 Ga0500568_0093456 3300053139 Bacteria 1133
424 Ga0500577_0034781 3300053142 Bacteria 1792
425 Ga0500577_0035771 3300053142 Bacteria 1774
426 Ga0500590_189579 3300053148 Bacteria 883
427 Ga0500604_0050688 3300053151 Bacteria 1280
428 Ga0500616_0000006 3300053153 Bacteria 944738
429 Ga0500616_0018244 3300053153 Bacteria 3970
430 Ga0500616_0105155 3300053153 Bacteria 1373
431 Ga0500638_073513 3300053162 Bacteria 1631
432 Ga0500636_0030507 3300053177 Bacteria 3188
433 Ga0500637_0000077 3300053178 Bacteria 35359
434 Ga0500570_026145 3300053724 Bacteria 3203
435 Ga0500661_000100 3300055283 Bacteria 13873
436 Ga0501082_0864995 3300060353 Bacteria 791
437 Ga0466962_0089555 3300061719 Bacteria 1474
438 2513675497 2513237098 Bacteria 9902361
439 2513892871 2513237141 Bacteria 8496279
440 2514014008 2513237161 Bacteria 8871253
441 2524470597 2524023210 Bacteria 9029266
442 2617351319 2617270735 Bacteria 9163226
443 2617376269 2617270741 Bacteria 8201522
444 2644729106 2643221733 Bacteria 5690728
445 2644745609 2643221736 Bacteria 6608466
446 2793080749
447 2824605026 2824600985 Bacteria 8488197
448 2824613902 2824609381 Bacteria 8672835
449 2824665108 2824661429 Bacteria 9877870
450 2824679460 2824671348 Bacteria 8369588
451 2824695596 2824687955 Bacteria 8360029
452 2824737476 2824732956 Bacteria 7810675
453 2824750070 2824746037 Bacteria 7911610
454 2824779213 2824773399 Bacteria 8360218
455 2838126319 2838122688 Bacteria 8803140
456 2841943602 2841941048 Bacteria 8688029
457 2841950447 2841949485 Bacteria 8680857
458 2841966761 2841966195 Bacteria 8673214
459 2841975517 2841974524 Bacteria 8931498
460 2841988343 2841983080 Bacteria 8395090
461 2842039567 2842038055 Bacteria 8002051
462 2849079819 2849076700 Bacteria 7039503
463 2851184367 2851182111 Bacteria 6047226
464 2885371994 2885366525 Bacteria 8326213
465 2885411020 2885409591 Bacteria 9235467
466 2888423964 2888419890 Bacteria 7857137
467 2903772640 2903768456 Bacteria 9749579
468 2903772641 2903768456 Bacteria 9749579
469 2908779609 2908775508 Bacteria 8092255
470 2929617468 2929615660 Bacteria 9193770
471 2929627173 2929624759 Bacteria 9339455
472 2933579424 2933577622 Bacteria 9116884
473 2935682377 2935675223 Bacteria 9928132
474 8055746917 8055742211 Bacteria 9226248
475 8056683247 8056681323 Bacteria 8472857
476 Ga0157378_10012272
477 RicEn_C3328
478 JGI25159J45721_1003651
479 JGI25153J46596_10001368
480 JGI25153J46596_10055339
481 rootH1_10105374
482 rootL2_10217417
483 JGI25160J50197_1002759
484 Ga0065165_1043635
485 Ga0070658_10162266
486 Ga0070683_100020570
487 Ga0068869_100218203
488 Ga0070680_100004196
489 Ga0070680_100006163
490 Ga0070680_100200286
491 Ga0070680_100244539
492 Ga0070682_100517002
493 Ga0070660_100162801
494 Ga0070661_100223521
495 Ga0070661_100343477
496 Ga0070675_100674737
497 Ga0070659_100079520
498 Ga0070659_100185679
499 Ga0070667_100075019
500 Ga0070667_100729316
501 Ga0070709_10004552
502 Ga0070714_100009562
503 Ga0070713_100132925
504 Ga0070713_100473060
505 Ga0070710_10000370
506 Ga0070711_100011526
507 Ga0070705_100080260
508 Ga0070663_100093294
509 Ga0070663_100113575
510 Ga0070681_10000001
511 Ga0070681_10132950
512 Ga0070681_10146732
513 Ga0070685_10191109
514 Ga0070706_100485968
515 Ga0070679_100220543
516 Ga0070684_100012263
517 Ga0070684_100097677
518 Ga0070697_100123650
519 Ga0068853_100026902
520 Ga0068853_100072121
521 Ga0068853_100341798
522 Ga0068853_100386289
523 Ga0070695_100026786
524 Ga0070665_100016084
525 Ga0070665_100043107
526 Ga0070665_100099072
527 Ga0068855_100072955
528 Ga0068855_100241849
529 Ga0068855_100363622
530 Ga0068857_100060263
531 Ga0068852_100010479
532 Ga0068852_100333349
533 Ga0068863_100468653
534 Ga0068858_100017135
535 Ga0068860_100560133
536 Ga0081540_1006213
537 Ga0070717_10070713
538 Ga0075365_10067920
539 Ga0075364_10026317
540 Ga0070716_100017444
541 Ga0070712_100050167
542 Ga0070712_100340915
543 Ga0075367_10077158
544 Ga0075370_10025241
545 Ga0075370_10286392
546 Ga0068865_100446190
547 Ga0075436_100020894
548 Ga0099794_10007561
549 Ga0099795_10017419
550 Ga0105251_10077971
551 Ga0105240_10042490
552 Ga0105240_10046512
553 Ga0105240_10258200
554 Ga0111539_10263360
555 Ga0105247_10251281
556 Ga0114129_10191011
557 Ga0105243_10682791
558 Ga0105241_10509067
559 Ga0105248_10219284
560 Ga0105237_10072348
561 Ga0105237_10236651
562 Ga0105238_10445755
563 Ga0105249_10353513
564 Ga0099796_10167300
565 Ga0105239_10290706
566 Ga0105239_10415210
567 Ga0105239_10443204
568 Ga0105246_10205305
569 Ga0157373_10103057
570 Ga0157370_10062680
571 Ga0157370_10150443
572 Ga0157370_10183896
573 Ga0157369_10005972
574 Ga0157369_10014893
575 Ga0157369_10028039
576 Ga0157369_10413740
577 Ga0157374_10073514
578 Ga0157378_10743839
579 Ga0157372_10026107
580 Ga0157375_10149037
581 Ga0157375_10503389
582 Ga0157380_10282193
583 Ga0157379_10048842
584 Ga0157379_10098754
585 Ga0157379_10185213
586 Ga0163161_10051835
587 Ga0214544_1000051
588 Ga0214544_1033822
589 Ga0214542_1000149
590 Ga0214545_1000126
591 Ga0214545_1030987
592 Ga0214543_1000148
593 Ga0213872_10127273
594 Ga0209563_104496
595 Ga0209677_101509
596 Ga0209233_1006843
597 Ga0209758_1001544
598 Ga0209758_1002693
599 Ga0209758_1004869
600 Ga0209758_1017628
601 Ga0207426_1010863
602 Ga0207426_1025467
603 Ga0207692_10003300
604 Ga0207642_10070411
605 Ga0207688_10330872
606 Ga0207647_10099236
607 Ga0207647_10185631
608 Ga0207647_10244043
609 Ga0207699_10000878
610 Ga0207705_10187880
611 Ga0207684_10437719
612 Ga0207707_10000048
613 Ga0207707_10039803
614 Ga0207695_10064854
615 Ga0207695_10083444
616 Ga0207671_10087172
617 Ga0207693_10068574
618 Ga0207663_10001692
619 Ga0207660_10000122
620 Ga0207652_10000502
621 Ga0207652_10081607
622 Ga0207694_10088625
623 Ga0207694_10161221
624 Ga0207650_10314059
625 Ga0207700_10112247
626 Ga0207664_10021532
627 Ga0207665_10002517
628 Ga0207665_10057486
629 Ga0207691_10074405
630 Ga0207711_10496770
631 Ga0207661_10528098
632 Ga0207667_10132132
633 Ga0207667_10315728
634 Ga0207658_10021844
635 Ga0207658_10100343
636 Ga0207703_10041281
637 Ga0207639_10116023
638 Ga0207639_10523044
639 Ga0207678_10022155
640 Ga0207678_10070309
641 Ga0207702_10266605
642 Ga0207702_10615052
643 Ga0207641_10126622
644 Ga0207674_10099911
645 Ga0207683_10232019
646 Ga0207683_10463848
647 Ga0209588_1001956
648 Ga0209813_10094067
649 Ga0268266_10007595
650 Ga0268266_10137138
651 Ga0307515_10011321
652 Ga0307515_10129114
653 Ga0307511_10084273
654 Ga0265330_10036070
655 Ga0265325_10028296
656 Ga0265340_10044435
657 Ga0265331_10008154
658 Ga0265331_10088778
659 Ga0307513_10153790
660 Ga0307513_10517152
661 Ga0307509_10020383
662 Ga0307509_10116487
663 Ga0307509_10151080
664 Ga0265313_10000427
665 Ga0307508_10000001
666 Ga0307516_10018819
667 Ga0307516_10048236
668 Ga0307516_10058886
669 Ga0307516_10296677
670 Ga0307405_10202977
671 Ga0307410_10058586
672 Ga0307406_10087732
673 Ga0307409_100321911
674 Ga0307416_100197262
675 Ga0307411_10373337
676 Ga0307415_100057916
677 Ga0307415_100206509
678 Ga0307507_10018394
679 Ga0307510_10021555
680 Ga0373926_0014809
681 Ga0373936_0020693
682 Ga0373936_0050322
683 Ga0373954_0096411
684 Ga0373943_0000075
685 Ga0373955_0010745
686 Ga0373924_0014115
687 Ga0373924_0021929
688 Ga0373935_0002382
689 Ga0373935_0061240
690 Ga0373935_0444941
691 Ga0373927_0001971
692 Ga0373927_0012510
693 Ga0373927_0019574
694 Ga0373927_0033244
695 Ga0373947_0000620
696 Ga0373947_0174088
697 Ga0373937_0008910
698 Ga0373937_0154510
699 Ga0373937_0254415
700 Ga0373925_0000631
701 Ga0373925_0235009
702 Ga0395900_0047393
703 Ga0395900_0151303
704 Ga0395898_0030079
705 Ga0436364_0194407
706 Ga0436364_0857559
707 Ga0395901_0021708
708 Ga0395901_0360572
709 Ga0395901_0397243
710 Ga0400487_20385
711 Ga0436365_0601496
712 Ga0436365_1340325
713 Ga0436360_0334801
714 Ga0436360_1040629
715 Ga0436363_0188861
716 Ga0436362_0644465
717 Ga0451791_1488532
718 Ga0451837_0811423
719 Ga0439462_0010609
720 Ga0466969_0190089
721 Ga0466963_0248092
722 Ga0466964_0076001
723 Ga0466957_0370431
724 Ga0466960_0328458
725 Ga0466959_0043159
726 Ga0466959_0076880
727 Ga0466958_0141420
728 Ga0466967_0374758
729 Ga0466967_1060594
730 Ga0495592_0003207
731 Ga0495592_0106350
732 Ga0495592_0344885
733 Ga0495603_0030446
734 Ga0495629_0001343
735 Ga0495629_0049405
736 Ga0495638_0081301
737 Ga0495638_0081432
738 Ga0495651_0007546
739 Ga0495651_0021524
740 Ga0495653_0003251
741 Ga0495580_0007061
742 Ga0495662_0140550
743 Ga0495664_0011804
744 Ga0495585_0063037
745 Ga0495585_0072108
746 Ga0495596_0038731
747 Ga0495608_0003162
748 Ga0495610_0059109
749 Ga0495616_0082380
750 Ga0495618_0000901
751 Ga0495618_0003888
752 Ga0495630_0002797
753 Ga0495630_0007209
754 Ga0495643_0227248
755 Ga0495644_0008473
756 Ga0495648_0002172
757 Ga0495663_0032392
758 Ga0495666_0223866
759 Ga0495652_0089041
760 Ga0495665_0088513
761 Ga0495640_0002575
762 Ga0495640_0009803
763 Ga0495640_0155397
764 Ga0495587_0014503
765 Ga0495645_0045968
766 Ga0495645_0069693
767 Ga0495645_0223186
768 Ga0495622_0045144
769 Ga0495667_0003548
770 Ga0495656_0011893
771 Ga0495668_0053748
772 Ga0495668_0313067
773 Ga0495634_0041229
774 Ga0495625_0308892
775 Ga0495635_0000230
776 Ga0495635_0000813
777 Ga0495635_0143591
778 Ga0495659_0031288
779 Ga0495661_0060643
780 Ga0495588_0010100
781 Ga0495657_0009686
782 Ga0495599_0000807
783 Ga0495599_0206658
784 Ga0495623_0112056
785 Ga0495647_0250040
786 Ga0495658_0052021
787 Ga0495613_0071326
788 Ga0495624_0003531
789 Ga0495624_0055171
790 Ga0495649_0097651
791 Ga0495600_0001064
792 Ga0495581_0070889
793 Ga0495581_0081899
794 Ga0495604_0004194
795 Ga0495674_0012101
796 Ga0495672_0023345
797 Ga0495676_0019647
798 Ga0495676_0100129
799 Ga0495683_0128714
800 Ga0495675_0001005
801 Ga0495673_0034158
802 Ga0495684_0000320
803 Ga0495684_0009257
804 Ga0495593_0002091
805 Ga0495593_0035122
806 Ga0495602_0019045
807 Ga0496100_0145093
808 Ga0496106_0005442
809 Ga0496106_0351927
810 Ga0496109_0122393
811 Ga0496110_0103978
812 Ga0496115_0024966
813 Ga0496115_0197597
814 Ga0496116_0085839
815 Ga0496117_0014824
816 Ga0496118_0008043
817 Ga0496119_0149869
818 Ga0496121_0000529
819 Ga0496121_0000864
820 Ga0496121_0003622
821 Ga0496121_0090755
822 Ga0496121_0094134
823 Ga0496122_0040835
824 Ga0496122_0199154
825 Ga0496124_0001167
826 Ga0496125_0003560
827 Ga0496125_0011234
828 Ga0496126_0003918
829 Ga0496126_0011720
830 Ga0496126_0016798
831 Ga0496126_0018029
832 Ga0496126_0019316
833 Ga0496126_0035315
834 Ga0496126_0048701
835 Ga0496126_0112399
836 Ga0496126_0550968
837 Ga0496126_0662685
838 Ga0495682_0080030
839 Ga0501031_0307989
840 Ga0501032_0219786
841 Ga0501033_0016655
842 Ga0501034_0282534
843 Ga0501034_0356131
844 Ga0501034_0406508
845 Ga0501036_0514821
846 Ga0501037_0175332
847 Ga0501037_0192074
848 Ga0501038_0090107
849 Ga0501043_0160251
850 Ga0501043_0284146
851 Ga0501047_0042743
852 Ga0501047_0277446
853 Ga0501069_0064070
854 Ga0501080_0319407
855 Ga0501035_0208183
856 Ga0501044_0100554
857 Ga0501044_0194118
858 nmdc:mga03n38_31206_c1
859 nmdc:mga00v17_18439_c1
860 nmdc:mga0yw44_7571_c1
861 nmdc:mga06z11_173302_c1
862 nmdc:mga04h51_111209_c1
863 nmdc:mga07m45_35330_c1
864 nmdc:mga05p37_411145_c1
865 nmdc:mga09592_213586_c1
866 nmdc:mga0n895_117326_c1
867 nmdc:mga0n895_171914_c1
868 nmdc:mga0rr50_63338_c1
869 nmdc:mga08x19_319750_c1
870 nmdc:mga08x19_50640_c1
871 nmdc:mga0sz30_16517_c1
872 Ga0495601_0070183
873 Ga0495612_0093515
874 Ga0500635_0023109
875 Ga0495595_0001005
876 Ga0495619_0002499
877 Ga0495619_0018102
878 Ga0500644_0000477
879 Ga0500646_0043707
880 Ga0500583_0188239
881 Ga0500651_0061364
882 Ga0500651_0235960
883 Ga0500566_0121173
884 Ga0500641_0012491
885 Ga0500641_0038823
886 Ga0500641_0115838
887 Ga0500557_000061
888 Ga0500562_073173
889 Ga0500592_011239
890 Ga0500593_000373
891 Ga0500595_001340
892 Ga0500595_007250
893 Ga0500642_0006544
894 Ga0500642_0059042
895 Ga0500642_0181447
896 Ga0500559_0004536
897 Ga0500559_0129475
898 Ga0500568_0093456
899 Ga0500577_0034781
900 Ga0500577_0035771
901 Ga0500590_189579
902 Ga0500604_0050688
903 Ga0500616_0000006
904 Ga0500616_0018244
905 Ga0500616_0105155
906 Ga0500638_073513
907 Ga0500636_0030507
908 Ga0500637_0000077
909 Ga0500570_026145
910 Ga0500661_000100
911 Ga0501082_0864995
912 Ga0466962_0089555
913 2513675497
914 2513892871
915 2514014008
916 2524470597
917 2617351319
918 2617376269
919 2644729106
920 2644745609
921 2793080749
922 2824605026
923 2824613902
924 2824665108
925 2824679460
926 2824695596
927 2824737476
928 2824750070
929 2824779213
930 2838126319
931 2841943602
932 2841950447
933 2841966761
934 2841975517
935 2841988343
936 2842039567
937 2849079819
938 2851184367
939 2885371994
940 2885411020
941 2888423964
942 2903772640
943 2903772641
944 2908779609
945 2929617468
946 2929627173
947 2933579424
948 2935682377
949 8055746917
950 8056683247

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13175

AAA_15

AAA ATPase domain

204

262

0.88

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

194

263

0.88

PF13476

AAA_23

AAA domain

85

149

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wge-assembly1.cif.gz_B cryo-em structure of human cohesin-nipbl-dna complex without stag1 0.757 159 235
8dk3-assembly1.cif.gz_B cryoem structure of pseudomonas aeruginosa pa14 jetc atpase domain bound to dna and cwhd domain of jeta 0.7373 16 72
6yuf-assembly1.cif.gz_A cohesin complex with loader gripping dna 0.7308 152 232
7q2y-assembly1.cif.gz_A cryo-em structure of clamped s.cerevisiae condensin-dna complex (form ii) 0.73 166 227
5dac-assembly1.cif.gz_B atp-gamma-s bound rad50 from chaetomium thermophilum in complex with dna 0.7196 14 73
ID Description Score Start End Superfamily
af_Q60273_1_105_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8611 150 211 3.40.50.300
af_P9WGF3_1013_1197_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7895 152 212 3.40.50.300
af_Q95Y73_20_307_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7445 52 74 3.40.50.300
3bosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7359 154 203 3.40.50.300
af_A4HZD1_1304_1480_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7337 147 212 3.40.50.300

Map