F451202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 474 | 260 | 474 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10350653|Ga0307410_103506532 |
| Length | 242 |
| Sequence | MNAPDLNRRSFVKLSLAAGAVAATSSAYAQEKPAFSLPDLPYKTVDLEPHIDAKTMEIHHGKHHQAYITNLNTAVGANAALKGKSLEELVTGLPSISEEAVRMTVRNNAGGHWNHTFFWEVMAPAGKGGEPGDKLAAAVKSAFGSLDDFKKLFGEAATKRFGSGWAWLIVKDGKLKVVSTPNQDNPLMKGIVPDSDLGTPILGLDVWEHAYYLHYQNRRPDYITAWWNVVNWSEVEKRFSKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.78 |
| Metatranscriptomes | 4.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 97.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000216 | 3300001977 | Bacteria | 7825 |
| 2 | JGI25406J46586_10000120 | 3300003203 | Bacteria | 34396 |
| 3 | Ga0058859_10030274 | 3300004798 | Bacteria | 1302 |
| 4 | Ga0058861_11957070 | 3300004800 | Bacteria | 660 |
| 5 | Ga0058861_12046156 | 3300004800 | Bacteria | 896 |
| 6 | Ga0058860_12215279 | 3300004801 | Bacteria | 1628 |
| 7 | Ga0058862_10155072 | 3300004803 | Bacteria | 1288 |
| 8 | Ga0065704_10020900 | 3300005289 | Bacteria | 1578 |
| 9 | Ga0065704_10092529 | 3300005289 | Bacteria | 2649 |
| 10 | Ga0065712_10161258 | 3300005290 | Bacteria | 1301 |
| 11 | Ga0065712_10261948 | 3300005290 | Bacteria | 935 |
| 12 | Ga0065715_10106116 | 3300005293 | Bacteria | 2850 |
| 13 | Ga0065707_10010952 | 3300005295 | Bacteria | 3140 |
| 14 | Ga0065707_10101651 | 3300005295 | Bacteria | 2853 |
| 15 | Ga0070676_10358412 | 3300005328 | Bacteria | 1004 |
| 16 | Ga0070683_100634198 | 3300005329 | Bacteria | 1023 |
| 17 | Ga0070683_100983983 | 3300005329 | Bacteria | 810 |
| 18 | Ga0070690_100030459 | 3300005330 | Bacteria | 3353 |
| 19 | Ga0070690_100158349 | 3300005330 | Bacteria | 1550 |
| 20 | Ga0070670_100278490 | 3300005331 | Bacteria | 1461 |
| 21 | Ga0070677_10016002 | 3300005333 | Bacteria | 2664 |
| 22 | Ga0070677_10076713 | 3300005333 | Bacteria | 1420 |
| 23 | Ga0068869_100100537 | 3300005334 | Bacteria | 2187 |
| 24 | Ga0070666_10059625 | 3300005335 | Bacteria | 2581 |
| 25 | Ga0070680_100046713 | 3300005336 | Bacteria | 3523 |
| 26 | Ga0070680_100297965 | 3300005336 | Bacteria | 1367 |
| 27 | Ga0068868_100006212 | 3300005338 | Bacteria | 8449 |
| 28 | Ga0068868_100020138 | 3300005338 | Bacteria | 5006 |
| 29 | Ga0068868_100093087 | 3300005338 | Bacteria | 2430 |
| 30 | Ga0070689_100662638 | 3300005340 | Bacteria | 909 |
| 31 | Ga0070689_100968236 | 3300005340 | Bacteria | 755 |
| 32 | Ga0070687_100400388 | 3300005343 | Bacteria | 900 |
| 33 | Ga0070661_100984510 | 3300005344 | Bacteria | 699 |
| 34 | Ga0070692_10047593 | 3300005345 | Bacteria | 2219 |
| 35 | Ga0070692_10055062 | 3300005345 | Bacteria | 2079 |
| 36 | Ga0070692_10161893 | 3300005345 | Bacteria | 1283 |
| 37 | Ga0070692_10504598 | 3300005345 | Bacteria | 785 |
| 38 | Ga0070668_100113917 | 3300005347 | Bacteria | 2155 |
| 39 | Ga0070669_100007790 | 3300005353 | Bacteria | 7651 |
| 40 | Ga0070669_100015609 | 3300005353 | Bacteria | 5415 |
| 41 | Ga0070669_100110020 | 3300005353 | Bacteria | 2089 |
| 42 | Ga0070675_100004831 | 3300005354 | Bacteria | 10276 |
| 43 | Ga0070675_100062135 | 3300005354 | Bacteria | 3085 |
| 44 | Ga0070675_100164549 | 3300005354 | Bacteria | 1910 |
| 45 | Ga0070675_100387468 | 3300005354 | Bacteria | 1245 |
| 46 | Ga0070674_100056160 | 3300005356 | Bacteria | 2729 |
| 47 | Ga0070673_100024697 | 3300005364 | Bacteria | 4411 |
| 48 | Ga0070673_100262059 | 3300005364 | Bacteria | 1510 |
| 49 | Ga0070688_100347171 | 3300005365 | Bacteria | 1085 |
| 50 | Ga0070659_100141010 | 3300005366 | Bacteria | 1962 |
| 51 | Ga0070667_100016375 | 3300005367 | Bacteria | 6134 |
| 52 | Ga0070703_10041937 | 3300005406 | Bacteria | 1429 |
| 53 | Ga0070714_100021670 | 3300005435 | Bacteria | 5259 |
| 54 | Ga0070713_100042507 | 3300005436 | Bacteria | 3710 |
| 55 | Ga0070713_100962033 | 3300005436 | Bacteria | 823 |
| 56 | Ga0070710_10076476 | 3300005437 | Bacteria | 1943 |
| 57 | Ga0070701_10028489 | 3300005438 | Bacteria | 2745 |
| 58 | Ga0070701_10602705 | 3300005438 | Bacteria | 727 |
| 59 | Ga0070705_100001204 | 3300005440 | Bacteria | 14089 |
| 60 | Ga0070705_100002732 | 3300005440 | Bacteria | 8811 |
| 61 | Ga0070705_100129336 | 3300005440 | Bacteria | 1645 |
| 62 | Ga0070705_100541734 | 3300005440 | Bacteria | 891 |
| 63 | Ga0070700_100241273 | 3300005441 | Bacteria | 1291 |
| 64 | Ga0070700_100625561 | 3300005441 | Bacteria | 847 |
| 65 | Ga0070694_100376813 | 3300005444 | Bacteria | 1106 |
| 66 | Ga0070708_100002251 | 3300005445 | Bacteria | 14917 |
| 67 | Ga0070708_100022156 | 3300005445 | Bacteria | 5385 |
| 68 | Ga0070708_100044907 | 3300005445 | Bacteria | 3889 |
| 69 | Ga0070708_100544612 | 3300005445 | Bacteria | 1095 |
| 70 | Ga0070678_100186668 | 3300005456 | Bacteria | 1701 |
| 71 | Ga0070662_100053793 | 3300005457 | Bacteria | 2915 |
| 72 | Ga0070662_100421014 | 3300005457 | Bacteria | 1105 |
| 73 | Ga0070681_10014519 | 3300005458 | Bacteria | 7838 |
| 74 | Ga0070681_10034808 | 3300005458 | Bacteria | 5058 |
| 75 | Ga0068867_100001191 | 3300005459 | Bacteria | 17832 |
| 76 | Ga0068867_100177437 | 3300005459 | Bacteria | 1691 |
| 77 | Ga0070685_10002440 | 3300005466 | Bacteria | 9559 |
| 78 | Ga0070685_10138645 | 3300005466 | Bacteria | 1529 |
| 79 | Ga0070685_10523171 | 3300005466 | Bacteria | 843 |
| 80 | Ga0070706_100003862 | 3300005467 | Bacteria | 14636 |
| 81 | Ga0070706_100009923 | 3300005467 | Bacteria | 8841 |
| 82 | Ga0070707_100000447 | 3300005468 | Bacteria | 40904 |
| 83 | Ga0070707_100065937 | 3300005468 | Bacteria | 3479 |
| 84 | Ga0070698_100072004 | 3300005471 | Bacteria | 3465 |
| 85 | Ga0070699_100024846 | 3300005518 | Bacteria | 5164 |
| 86 | Ga0070699_100089924 | 3300005518 | Bacteria | 2683 |
| 87 | Ga0070679_100144455 | 3300005530 | Bacteria | 2357 |
| 88 | Ga0070679_100161565 | 3300005530 | Bacteria | 2214 |
| 89 | Ga0070684_100049946 | 3300005535 | Bacteria | 3632 |
| 90 | Ga0070684_100239459 | 3300005535 | Bacteria | 1658 |
| 91 | Ga0070684_100325976 | 3300005535 | Bacteria | 1411 |
| 92 | Ga0070697_100009787 | 3300005536 | Bacteria | 7476 |
| 93 | Ga0068853_100388635 | 3300005539 | Bacteria | 1304 |
| 94 | Ga0068853_100599679 | 3300005539 | Bacteria | 1046 |
| 95 | Ga0070672_100414592 | 3300005543 | Bacteria | 1156 |
| 96 | Ga0070672_100480873 | 3300005543 | Bacteria | 1072 |
| 97 | Ga0070672_100711517 | 3300005543 | Bacteria | 880 |
| 98 | Ga0070672_100783089 | 3300005543 | Bacteria | 838 |
| 99 | Ga0070686_100136681 | 3300005544 | Bacteria | 1701 |
| 100 | Ga0070686_100394646 | 3300005544 | Bacteria | 1051 |
| 101 | Ga0070665_100304624 | 3300005548 | Bacteria | 1596 |
| 102 | Ga0070704_100000468 | 3300005549 | Bacteria | 19028 |
| 103 | Ga0070704_100107636 | 3300005549 | Bacteria | 2115 |
| 104 | Ga0068855_100055222 | 3300005563 | Bacteria | 4666 |
| 105 | Ga0070664_100002570 | 3300005564 | Bacteria | 14640 |
| 106 | Ga0070664_100073690 | 3300005564 | Bacteria | 2930 |
| 107 | Ga0068857_100011179 | 3300005577 | Bacteria | 7807 |
| 108 | Ga0068857_100028226 | 3300005577 | Bacteria | 4951 |
| 109 | Ga0068857_100044007 | 3300005577 | Bacteria | 3960 |
| 110 | Ga0068854_100776711 | 3300005578 | Bacteria | 833 |
| 111 | Ga0068856_100088595 | 3300005614 | Bacteria | 3077 |
| 112 | Ga0070702_100361549 | 3300005615 | Bacteria | 1026 |
| 113 | Ga0068852_100192232 | 3300005616 | Bacteria | 1926 |
| 114 | Ga0068852_100516906 | 3300005616 | Bacteria | 1191 |
| 115 | Ga0068859_100003123 | 3300005617 | Bacteria | 16824 |
| 116 | Ga0068859_100016210 | 3300005617 | Bacteria | 7485 |
| 117 | Ga0068859_100085724 | 3300005617 | Bacteria | 3195 |
| 118 | Ga0068864_100029831 | 3300005618 | Bacteria | 4622 |
| 119 | Ga0068866_10083308 | 3300005718 | Bacteria | 1723 |
| 120 | Ga0068866_10388751 | 3300005718 | Bacteria | 897 |
| 121 | Ga0068861_100006606 | 3300005719 | Bacteria | 7914 |
| 122 | Ga0068870_10005956 | 3300005840 | Bacteria | 5358 |
| 123 | Ga0068870_10008339 | 3300005840 | Bacteria | 4659 |
| 124 | Ga0068870_10051156 | 3300005840 | Bacteria | 2186 |
| 125 | Ga0068863_100046713 | 3300005841 | Bacteria | 4110 |
| 126 | Ga0068863_100175662 | 3300005841 | Bacteria | 2055 |
| 127 | Ga0068858_100010752 | 3300005842 | Bacteria | 8653 |
| 128 | Ga0068858_100033151 | 3300005842 | Bacteria | 4795 |
| 129 | Ga0068858_100069115 | 3300005842 | Bacteria | 3274 |
| 130 | Ga0068860_100060319 | 3300005843 | Bacteria | 3605 |
| 131 | Ga0068860_100103370 | 3300005843 | Bacteria | 2719 |
| 132 | Ga0068860_101020577 | 3300005843 | Bacteria | 845 |
| 133 | Ga0068862_100001812 | 3300005844 | Bacteria | 19342 |
| 134 | Ga0068862_100007478 | 3300005844 | Bacteria | 9056 |
| 135 | Ga0081455_10003557 | 3300005937 | Bacteria | 17878 |
| 136 | Ga0081455_10098753 | 3300005937 | Bacteria | 2350 |
| 137 | Ga0081538_10173312 | 3300005981 | Bacteria | 937 |
| 138 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 139 | Ga0081539_10006242 | 3300005985 | Bacteria | 11540 |
| 140 | Ga0070717_10206905 | 3300006028 | Bacteria | 1721 |
| 141 | Ga0097621_100020227 | 3300006237 | Bacteria | 5127 |
| 142 | Ga0097621_100040005 | 3300006237 | Bacteria | 3767 |
| 143 | Ga0097621_100099573 | 3300006237 | Bacteria | 2443 |
| 144 | Ga0068871_100007795 | 3300006358 | Bacteria | 7666 |
| 145 | Ga0068871_100374611 | 3300006358 | Bacteria | 1263 |
| 146 | Ga0075428_100002797 | 3300006844 | Bacteria | 18985 |
| 147 | Ga0075428_100007533 | 3300006844 | Bacteria | 12066 |
| 148 | Ga0075428_100010378 | 3300006844 | Bacteria | 10343 |
| 149 | Ga0075428_100151427 | 3300006844 | Bacteria | 2520 |
| 150 | Ga0075428_100497335 | 3300006844 | Bacteria | 1305 |
| 151 | Ga0075430_100000384 | 3300006846 | Bacteria | 32464 |
| 152 | Ga0075430_100157535 | 3300006846 | Bacteria | 1890 |
| 153 | Ga0075430_100256246 | 3300006846 | Bacteria | 1449 |
| 154 | Ga0075431_100000025 | 3300006847 | Bacteria | 79014 |
| 155 | Ga0075431_100000446 | 3300006847 | Bacteria | 33843 |
| 156 | Ga0075431_100112844 | 3300006847 | Bacteria | 2805 |
| 157 | Ga0075431_101356075 | 3300006847 | Bacteria | 671 |
| 158 | Ga0075433_10000092 | 3300006852 | Bacteria | 42081 |
| 159 | Ga0075433_10010230 | 3300006852 | Bacteria | 7522 |
| 160 | Ga0075433_10061543 | 3300006852 | Bacteria | 3288 |
| 161 | Ga0075433_10079942 | 3300006852 | Bacteria | 2881 |
| 162 | Ga0075434_100000213 | 3300006871 | Bacteria | 39624 |
| 163 | Ga0075434_100007624 | 3300006871 | Bacteria | 10013 |
| 164 | Ga0075434_100010392 | 3300006871 | Bacteria | 8725 |
| 165 | Ga0075434_100047614 | 3300006871 | Bacteria | 4255 |
| 166 | Ga0075434_100058709 | 3300006871 | Bacteria | 3824 |
| 167 | Ga0075434_100880446 | 3300006871 | Bacteria | 911 |
| 168 | Ga0075429_100002752 | 3300006880 | Bacteria | 14857 |
| 169 | Ga0075429_100039293 | 3300006880 | Bacteria | 4119 |
| 170 | Ga0075429_100055967 | 3300006880 | Bacteria | 3433 |
| 171 | Ga0075429_100083988 | 3300006880 | Bacteria | 2775 |
| 172 | Ga0068865_100117490 | 3300006881 | Bacteria | 1972 |
| 173 | Ga0075436_100073423 | 3300006914 | Bacteria | 2368 |
| 174 | Ga0097620_100003123 | 3300006931 | Bacteria | 16824 |
| 175 | Ga0097620_100016210 | 3300006931 | Bacteria | 7485 |
| 176 | Ga0097620_100085731 | 3300006931 | Bacteria | 3195 |
| 177 | Ga0075435_100024154 | 3300007076 | Bacteria | 4713 |
| 178 | Ga0075435_100029781 | 3300007076 | Bacteria | 4286 |
| 179 | Ga0075435_100040357 | 3300007076 | Bacteria | 3727 |
| 180 | Ga0075435_100105049 | 3300007076 | Bacteria | 2344 |
| 181 | Ga0105240_10058200 | 3300009093 | Bacteria | 4825 |
| 182 | Ga0105240_10121617 | 3300009093 | Bacteria | 3143 |
| 183 | Ga0111539_10094983 | 3300009094 | Bacteria | 3503 |
| 184 | Ga0111539_10202744 | 3300009094 | Bacteria | 2313 |
| 185 | Ga0111539_10832451 | 3300009094 | Bacteria | 1074 |
| 186 | Ga0105245_10878320 | 3300009098 | Bacteria | 937 |
| 187 | Ga0114129_10000461 | 3300009147 | Bacteria | 48733 |
| 188 | Ga0114129_10017499 | 3300009147 | Bacteria | 10206 |
| 189 | Ga0114129_10153110 | 3300009147 | Bacteria | 3155 |
| 190 | Ga0105243_10097292 | 3300009148 | Bacteria | 2436 |
| 191 | Ga0105242_11419174 | 3300009176 | Bacteria | 722 |
| 192 | Ga0105237_10030909 | 3300009545 | Bacteria | 5433 |
| 193 | Ga0105249_10088587 | 3300009553 | Bacteria | 2891 |
| 194 | Ga0105249_10565812 | 3300009553 | Bacteria | 1189 |
| 195 | Ga0105249_10923646 | 3300009553 | Bacteria | 940 |
| 196 | Ga0105239_10718183 | 3300010375 | Bacteria | 1143 |
| 197 | Ga0105246_10077107 | 3300011119 | Bacteria | 2363 |
| 198 | Ga0157373_10124779 | 3300013100 | Bacteria | 1810 |
| 199 | Ga0157371_10081633 | 3300013102 | Bacteria | 2289 |
| 200 | Ga0157369_10098933 | 3300013105 | Bacteria | 3110 |
| 201 | Ga0157374_10041885 | 3300013296 | Bacteria | 4222 |
| 202 | Ga0157374_10340077 | 3300013296 | Bacteria | 1490 |
| 203 | Ga0157378_10647777 | 3300013297 | Bacteria | 1072 |
| 204 | Ga0157378_11637071 | 3300013297 | Bacteria | 690 |
| 205 | Ga0163162_10067850 | 3300013306 | Bacteria | 3618 |
| 206 | Ga0163162_10553897 | 3300013306 | Bacteria | 1278 |
| 207 | Ga0157372_10030010 | 3300013307 | Bacteria | 5944 |
| 208 | Ga0157375_10030216 | 3300013308 | Bacteria | 5107 |
| 209 | Ga0157375_10506424 | 3300013308 | Bacteria | 1371 |
| 210 | Ga0157375_10575339 | 3300013308 | Bacteria | 1287 |
| 211 | Ga0157375_11162767 | 3300013308 | Bacteria | 904 |
| 212 | Ga0157380_10023560 | 3300014326 | Bacteria | 4645 |
| 213 | Ga0157380_10118746 | 3300014326 | Bacteria | 2236 |
| 214 | Ga0157377_10042275 | 3300014745 | Bacteria | 2531 |
| 215 | Ga0157377_10103753 | 3300014745 | Bacteria | 1699 |
| 216 | Ga0157379_10165987 | 3300014968 | Bacteria | 1993 |
| 217 | Ga0157379_10282841 | 3300014968 | Bacteria | 1510 |
| 218 | Ga0157376_10062103 | 3300014969 | Bacteria | 3143 |
| 219 | Ga0157376_10149047 | 3300014969 | Bacteria | 2108 |
| 220 | Ga0157376_10520762 | 3300014969 | Bacteria | 1172 |
| 221 | Ga0163161_10020346 | 3300017792 | Bacteria | 4657 |
| 222 | Ga0163161_10024787 | 3300017792 | Bacteria | 4240 |
| 223 | Ga0197907_10950682 | 3300020069 | Bacteria | 766 |
| 224 | Ga0197907_11170075 | 3300020069 | Bacteria | 908 |
| 225 | Ga0206356_11200219 | 3300020070 | Bacteria | 814 |
| 226 | Ga0206349_1215835 | 3300020075 | Bacteria | 883 |
| 227 | Ga0206351_10260081 | 3300020077 | Bacteria | 849 |
| 228 | Ga0206351_10493687 | 3300020077 | Bacteria | 777 |
| 229 | Ga0206352_10131148 | 3300020078 | Bacteria | 851 |
| 230 | Ga0206352_10682467 | 3300020078 | Bacteria | 778 |
| 231 | Ga0206350_10195639 | 3300020080 | Bacteria | 1213 |
| 232 | Ga0206350_11315453 | 3300020080 | Bacteria | 1504 |
| 233 | Ga0206354_10876827 | 3300020081 | Bacteria | 898 |
| 234 | Ga0154015_1681081 | 3300020610 | Bacteria | 1645 |
| 235 | Ga0224712_10123682 | 3300022467 | Bacteria | 1123 |
| 236 | Ga0207673_1032224 | 3300025290 | Bacteria | 727 |
| 237 | Ga0207697_10000959 | 3300025315 | Bacteria | 16217 |
| 238 | Ga0207697_10018716 | 3300025315 | Bacteria | 2839 |
| 239 | Ga0207697_10197718 | 3300025315 | Bacteria | 884 |
| 240 | Ga0207656_10375157 | 3300025321 | Bacteria | 712 |
| 241 | Ga0207653_10028854 | 3300025885 | Bacteria | 1786 |
| 242 | Ga0207682_10000173 | 3300025893 | Bacteria | 29484 |
| 243 | Ga0207688_10001170 | 3300025901 | Bacteria | 13536 |
| 244 | Ga0207688_10473593 | 3300025901 | Bacteria | 782 |
| 245 | Ga0207647_10051885 | 3300025904 | Bacteria | 2533 |
| 246 | Ga0207645_10003604 | 3300025907 | Bacteria | 11714 |
| 247 | Ga0207643_10001758 | 3300025908 | Bacteria | 12101 |
| 248 | Ga0207643_10021644 | 3300025908 | Bacteria | 3535 |
| 249 | Ga0207705_10101735 | 3300025909 | Bacteria | 2114 |
| 250 | Ga0207705_10424125 | 3300025909 | Bacteria | 1030 |
| 251 | Ga0207684_10033466 | 3300025910 | Bacteria | 4370 |
| 252 | Ga0207684_10112876 | 3300025910 | Bacteria | 2326 |
| 253 | Ga0207684_10391151 | 3300025910 | Bacteria | 1195 |
| 254 | Ga0207707_10059076 | 3300025912 | Bacteria | 3336 |
| 255 | Ga0207695_10100410 | 3300025913 | Bacteria | 2890 |
| 256 | Ga0207671_10086390 | 3300025914 | Bacteria | 2358 |
| 257 | Ga0207693_10413189 | 3300025915 | Bacteria | 1055 |
| 258 | Ga0207660_10048187 | 3300025917 | Bacteria | 3015 |
| 259 | Ga0207660_10078497 | 3300025917 | Bacteria | 2419 |
| 260 | Ga0207662_10075383 | 3300025918 | Bacteria | 2049 |
| 261 | Ga0207657_10104031 | 3300025919 | Bacteria | 2352 |
| 262 | Ga0207657_10588249 | 3300025919 | Bacteria | 869 |
| 263 | Ga0207649_10040005 | 3300025920 | Bacteria | 2846 |
| 264 | Ga0207646_10065975 | 3300025922 | Bacteria | 3231 |
| 265 | Ga0207646_10236117 | 3300025922 | Bacteria | 1652 |
| 266 | Ga0207681_10005920 | 3300025923 | Bacteria | 7496 |
| 267 | Ga0207681_10063970 | 3300025923 | Bacteria | 2538 |
| 268 | Ga0207650_10175316 | 3300025925 | Bacteria | 1706 |
| 269 | Ga0207659_10000165 | 3300025926 | Bacteria | 39413 |
| 270 | Ga0207659_10314803 | 3300025926 | Bacteria | 1289 |
| 271 | Ga0207659_10367311 | 3300025926 | Bacteria | 1197 |
| 272 | Ga0207659_10466453 | 3300025926 | Bacteria | 1065 |
| 273 | Ga0207700_10184847 | 3300025928 | Bacteria | 1748 |
| 274 | Ga0207690_10120576 | 3300025932 | Bacteria | 1904 |
| 275 | Ga0207706_10036439 | 3300025933 | Bacteria | 4369 |
| 276 | Ga0207686_10656616 | 3300025934 | Bacteria | 830 |
| 277 | Ga0207709_10093359 | 3300025935 | Bacteria | 1972 |
| 278 | Ga0207670_10023096 | 3300025936 | Bacteria | 3866 |
| 279 | Ga0207670_10191703 | 3300025936 | Bacteria | 1547 |
| 280 | Ga0207691_10004294 | 3300025940 | Bacteria | 13844 |
| 281 | Ga0207691_10021429 | 3300025940 | Bacteria | 6102 |
| 282 | Ga0207691_10067373 | 3300025940 | Bacteria | 3237 |
| 283 | Ga0207691_10470051 | 3300025940 | Bacteria | 1069 |
| 284 | Ga0207691_11134307 | 3300025940 | Bacteria | 650 |
| 285 | Ga0207711_10060622 | 3300025941 | Bacteria | 3261 |
| 286 | Ga0207711_10688773 | 3300025941 | Bacteria | 953 |
| 287 | Ga0207689_10004521 | 3300025942 | Bacteria | 12592 |
| 288 | Ga0207689_10090553 | 3300025942 | Bacteria | 2513 |
| 289 | Ga0207689_10174030 | 3300025942 | Bacteria | 1775 |
| 290 | Ga0207661_10954670 | 3300025944 | Bacteria | 790 |
| 291 | Ga0207679_10043838 | 3300025945 | Bacteria | 3224 |
| 292 | Ga0207679_10906758 | 3300025945 | Bacteria | 806 |
| 293 | Ga0207667_10001891 | 3300025949 | Bacteria | 26290 |
| 294 | Ga0207651_10145023 | 3300025960 | Bacteria | 1839 |
| 295 | Ga0207651_10655940 | 3300025960 | Bacteria | 921 |
| 296 | Ga0207651_10975536 | 3300025960 | Bacteria | 757 |
| 297 | Ga0207712_10086277 | 3300025961 | Bacteria | 2299 |
| 298 | Ga0207712_10254390 | 3300025961 | Bacteria | 1421 |
| 299 | Ga0207712_10782034 | 3300025961 | Bacteria | 838 |
| 300 | Ga0207712_10905121 | 3300025961 | Bacteria | 780 |
| 301 | Ga0207668_10317059 | 3300025972 | Bacteria | 1292 |
| 302 | Ga0207668_10632457 | 3300025972 | Bacteria | 935 |
| 303 | Ga0207640_10230292 | 3300025981 | Bacteria | 1425 |
| 304 | Ga0207658_10054642 | 3300025986 | Bacteria | 2955 |
| 305 | Ga0207658_11038529 | 3300025986 | Bacteria | 748 |
| 306 | Ga0207703_10051336 | 3300026035 | Bacteria | 3341 |
| 307 | Ga0207639_10569054 | 3300026041 | Bacteria | 1042 |
| 308 | Ga0207639_10790206 | 3300026041 | Bacteria | 884 |
| 309 | Ga0207678_10064827 | 3300026067 | Bacteria | 3139 |
| 310 | Ga0207678_11098847 | 3300026067 | Bacteria | 704 |
| 311 | Ga0207708_10068107 | 3300026075 | Bacteria | 2724 |
| 312 | Ga0207708_10118497 | 3300026075 | Bacteria | 2061 |
| 313 | Ga0207708_10208410 | 3300026075 | Bacteria | 1562 |
| 314 | Ga0207708_10820983 | 3300026075 | Bacteria | 801 |
| 315 | Ga0207702_10424481 | 3300026078 | Bacteria | 1286 |
| 316 | Ga0207641_11237816 | 3300026088 | Bacteria | 746 |
| 317 | Ga0207648_10001042 | 3300026089 | Bacteria | 31075 |
| 318 | Ga0207648_10029082 | 3300026089 | Bacteria | 4900 |
| 319 | Ga0207676_10004165 | 3300026095 | Bacteria | 10223 |
| 320 | Ga0207676_10155110 | 3300026095 | Bacteria | 1977 |
| 321 | Ga0207676_10185365 | 3300026095 | Bacteria | 1826 |
| 322 | Ga0207674_10023343 | 3300026116 | Bacteria | 6628 |
| 323 | Ga0207674_10081445 | 3300026116 | Bacteria | 3239 |
| 324 | Ga0207675_100004553 | 3300026118 | Bacteria | 13372 |
| 325 | Ga0207675_100515198 | 3300026118 | Bacteria | 1192 |
| 326 | Ga0207675_101390570 | 3300026118 | Bacteria | 722 |
| 327 | Ga0207683_10019186 | 3300026121 | Bacteria | 5839 |
| 328 | Ga0207683_10067440 | 3300026121 | Bacteria | 3156 |
| 329 | Ga0207698_10724604 | 3300026142 | Bacteria | 991 |
| 330 | Ga0209971_1029207 | 3300027682 | Bacteria | 1320 |
| 331 | Ga0207428_10131923 | 3300027907 | Bacteria | 1911 |
| 332 | Ga0207428_10145852 | 3300027907 | Bacteria | 1804 |
| 333 | Ga0268266_10194341 | 3300028379 | Bacteria | 1854 |
| 334 | Ga0268265_10002966 | 3300028380 | Bacteria | 12418 |
| 335 | Ga0268265_10089309 | 3300028380 | Bacteria | 2457 |
| 336 | Ga0268265_10286681 | 3300028380 | Bacteria | 1476 |
| 337 | Ga0268264_10009056 | 3300028381 | Bacteria | 8260 |
| 338 | Ga0265336_10010883 | 3300028666 | Bacteria | 3104 |
| 339 | Ga0265338_10015272 | 3300028800 | Bacteria | 8453 |
| 340 | Ga0265338_10230579 | 3300028800 | Bacteria | 1377 |
| 341 | Ga0265324_10127122 | 3300029957 | Bacteria | 865 |
| 342 | Ga0265330_10000447 | 3300031235 | Bacteria | 27592 |
| 343 | Ga0265328_10011675 | 3300031239 | Bacteria | 3506 |
| 344 | Ga0265328_10063819 | 3300031239 | Bacteria | 1353 |
| 345 | Ga0265325_10000222 | 3300031241 | Bacteria | 40255 |
| 346 | Ga0265325_10060268 | 3300031241 | Bacteria | 1928 |
| 347 | Ga0265340_10123451 | 3300031247 | Bacteria | 1190 |
| 348 | Ga0265339_10000361 | 3300031249 | Bacteria | 35945 |
| 349 | Ga0265339_10013739 | 3300031249 | Bacteria | 4900 |
| 350 | Ga0265316_10000095 | 3300031344 | Bacteria | 95750 |
| 351 | Ga0265316_10003149 | 3300031344 | Bacteria | 16790 |
| 352 | Ga0307408_100543497 | 3300031548 | Bacteria | 1024 |
| 353 | Ga0265313_10012495 | 3300031595 | Bacteria | 5177 |
| 354 | Ga0265314_10007446 | 3300031711 | Bacteria | 9493 |
| 355 | Ga0265342_10004593 | 3300031712 | Bacteria | 10773 |
| 356 | Ga0265342_10009265 | 3300031712 | Bacteria | 6959 |
| 357 | Ga0265342_10061930 | 3300031712 | Bacteria | 2203 |
| 358 | Ga0307405_10193884 | 3300031731 | Bacteria | 1470 |
| 359 | Ga0307405_10498747 | 3300031731 | Bacteria | 975 |
| 360 | Ga0307410_10350653 | 3300031852 | Bacteria | 1179 |
| 361 | Ga0307406_10001596 | 3300031901 | Bacteria | 12470 |
| 362 | Ga0307409_100137980 | 3300031995 | Bacteria | 2096 |
| 363 | Ga0307409_100694123 | 3300031995 | Bacteria | 1016 |
| 364 | Ga0307416_100005889 | 3300032002 | Bacteria | 7607 |
| 365 | Ga0307416_101061352 | 3300032002 | Bacteria | 914 |
| 366 | Ga0307414_10000042 | 3300032004 | Bacteria | 142637 |
| 367 | Ga0316596_1042450 | 3300033541 | Bacteria | 1197 |
| 368 | Ga0373949_0023253 | 3300035090 | Bacteria | 1434 |
| 369 | Ga0373941_0197796 | 3300035115 | Bacteria | 763 |
| 370 | Ga0373962_0071298 | 3300035242 | Bacteria | 1039 |
| 371 | Ga0373933_0077014 | 3300035724 | Bacteria | 2038 |
| 372 | Ga0373947_0546911 | 3300035725 | Bacteria | 788 |
| 373 | Ga0395899_0007845 | 3300037312 | Bacteria | 8225 |
| 374 | Ga0395900_0112781 | 3300037418 | Bacteria | 2791 |
| 375 | Ga0395900_1164744 | 3300037418 | Bacteria | 687 |
| 376 | Ga0395898_0057963 | 3300037466 | Bacteria | 3771 |
| 377 | Ga0395905_0011422 | 3300037471 | Bacteria | 8580 |
| 378 | Ga0395901_0044711 | 3300038443 | Bacteria | 4592 |
| 379 | Ga0395901_0217116 | 3300038443 | Bacteria | 2000 |
| 380 | Ga0242420_079978 | 3300038996 | Bacteria | 674 |
| 381 | Ga0451577_0009782 | 3300042876 | Bacteria | 9192 |
| 382 | Ga0451577_0813272 | 3300042876 | Bacteria | 844 |
| 383 | Ga0466969_0083452 | 3300044656 | Bacteria | 1522 |
| 384 | Ga0453683_0168786 | 3300044673 | Bacteria | 1386 |
| 385 | Ga0466961_0026859 | 3300044693 | Bacteria | 3702 |
| 386 | Ga0453684_0488645 | 3300044712 | Bacteria | 1365 |
| 387 | Ga0451576_0023428 | 3300045051 | Bacteria | 6683 |
| 388 | Ga0451576_0075374 | 3300045051 | Bacteria | 3510 |
| 389 | Ga0451576_0106969 | 3300045051 | Bacteria | 2910 |
| 390 | Ga0451576_0177265 | 3300045051 | Bacteria | 2225 |
| 391 | Ga0451576_0488696 | 3300045051 | Bacteria | 1293 |
| 392 | Ga0451576_0508034 | 3300045051 | Bacteria | 1266 |
| 393 | Ga0495580_0524183 | 3300046472 | Bacteria | 789 |
| 394 | Ga0495584_0255038 | 3300046491 | Bacteria | 892 |
| 395 | Ga0495644_0080078 | 3300046523 | Bacteria | 1231 |
| 396 | Ga0495586_0427866 | 3300046535 | Bacteria | 763 |
| 397 | Ga0495645_0219472 | 3300046543 | Bacteria | 1280 |
| 398 | Ga0495588_0016972 | 3300046674 | Bacteria | 3527 |
| 399 | Ga0495658_0807160 | 3300046683 | Bacteria | 601 |
| 400 | Ga0495669_0017695 | 3300046684 | Bacteria | 3060 |
| 401 | Ga0495669_0535775 | 3300046684 | Bacteria | 570 |
| 402 | Ga0495676_0311774 | 3300047321 | Bacteria | 1059 |
| 403 | Ga0495684_0099230 | 3300047471 | Bacteria | 2202 |
| 404 | Ga0496100_0191583 | 3300048903 | Bacteria | 1485 |
| 405 | Ga0496104_0002686 | 3300048907 | Bacteria | 15316 |
| 406 | Ga0496104_0052273 | 3300048907 | Bacteria | 3859 |
| 407 | Ga0496105_1030495 | 3300048908 | Bacteria | 614 |
| 408 | Ga0496106_0887670 | 3300048909 | Bacteria | 704 |
| 409 | Ga0496106_0950480 | 3300048909 | Bacteria | 677 |
| 410 | Ga0496109_0221800 | 3300048912 | Bacteria | 1778 |
| 411 | Ga0496112_0016462 | 3300048915 | Bacteria | 6928 |
| 412 | Ga0496113_0702312 | 3300048916 | Bacteria | 807 |
| 413 | Ga0496114_0004205 | 3300048917 | Bacteria | 11157 |
| 414 | Ga0501306_051382 | 3300049127 | Bacteria | 661 |
| 415 | Ga0501298_062684 | 3300049521 | Bacteria | 790 |
| 416 | Ga0501034_0242294 | 3300049571 | Bacteria | 1749 |
| 417 | Ga0501037_0272522 | 3300049573 | Bacteria | 1181 |
| 418 | Ga0501047_0238611 | 3300049581 | Bacteria | 1669 |
| 419 | Ga0501048_0227683 | 3300049582 | Bacteria | 1323 |
| 420 | Ga0501048_0740658 | 3300049582 | Bacteria | 706 |
| 421 | Ga0501071_0499341 | 3300049587 | Bacteria | 933 |
| 422 | Ga0501072_0789541 | 3300049588 | Bacteria | 744 |
| 423 | Ga0501076_0046128 | 3300049592 | Bacteria | 3443 |
| 424 | Ga0501076_0477539 | 3300049592 | Bacteria | 1027 |
| 425 | Ga0501202_061905 | 3300049652 | Bacteria | 848 |
| 426 | Ga0501227_001649 | 3300049665 | Bacteria | 4971 |
| 427 | Ga0501225_0100404 | 3300049705 | Bacteria | 845 |
| 428 | Ga0501079_0103732 | 3300049741 | Bacteria | 2206 |
| 429 | Ga0501079_0224797 | 3300049741 | Bacteria | 1467 |
| 430 | Ga0501080_0044229 | 3300049742 | Bacteria | 4146 |
| 431 | Ga0501080_0497098 | 3300049742 | Bacteria | 1090 |
| 432 | Ga0501283_047761 | 3300049779 | Bacteria | 753 |
| 433 | Ga0501035_0090084 | 3300049822 | Bacteria | 2701 |
| 434 | Ga0501045_0127645 | 3300049824 | Bacteria | 1890 |
| 435 | nmdc:mga05p37_1341998_c1 | 3300050507 | Bacteria | 725 |
| 436 | nmdc:mga05p37_149527_c1 | 3300050507 | Bacteria | 2858 |
| 437 | nmdc:mga05p37_158466_c1 | 3300050507 | Bacteria | 2765 |
| 438 | nmdc:mga05p37_20002_c1 | 3300050507 | Bacteria | 8100 |
| 439 | nmdc:mga05p37_2124_c1 | 3300050507 | Bacteria | 23140 |
| 440 | nmdc:mga05p37_405368_c1 | 3300050507 | Bacteria | 1591 |
| 441 | nmdc:mga05p37_623304_c1 | 3300050507 | Bacteria | 1213 |
| 442 | nmdc:mga09592_13257_c1 | 3300050508 | Bacteria | 6730 |
| 443 | nmdc:mga09592_234747_c1 | 3300050508 | Bacteria | 1589 |
| 444 | nmdc:mga09592_34636_c1 | 3300050508 | Bacteria | 4221 |
| 445 | nmdc:mga09592_58617_c1 | 3300050508 | Bacteria | 3256 |
| 446 | nmdc:mga09592_730136_c1 | 3300050508 | Bacteria | 841 |
| 447 | nmdc:mga09592_7954_c2 | 3300050508 | Bacteria | 6877 |
| 448 | nmdc:mga0qj67_47630_c1 | 3300050509 | Bacteria | 3387 |
| 449 | nmdc:mga0qj67_5744_c1 | 3300050509 | Bacteria | 9081 |
| 450 | nmdc:mga06r32_41776_c1 | 3300050510 | Bacteria | 4358 |
| 451 | nmdc:mga06r32_6330_c1 | 3300050510 | Bacteria | 10631 |
| 452 | nmdc:mga06r32_82180_c1 | 3300050510 | Bacteria | 3138 |
| 453 | nmdc:mga08y16_156071_c1 | 3300050511 | Bacteria | 2372 |
| 454 | nmdc:mga08y16_17846_c1 | 3300050511 | Bacteria | 7475 |
| 455 | nmdc:mga08y16_689268_c1 | 3300050511 | Bacteria | 1023 |
| 456 | nmdc:mga0n895_114427_c1 | 3300050512 | Bacteria | 2716 |
| 457 | nmdc:mga0n895_117414_c1 | 3300050512 | Bacteria | 2680 |
| 458 | nmdc:mga0n895_182862_c1 | 3300050512 | Bacteria | 2128 |
| 459 | nmdc:mga0n895_251025_c1 | 3300050512 | Bacteria | 1795 |
| 460 | nmdc:mga0n895_33127_c1 | 3300050512 | Bacteria | 4964 |
| 461 | nmdc:mga0n895_420_c1 | 3300050512 | Bacteria | 28435 |
| 462 | nmdc:mga0n895_473421_c1 | 3300050512 | Bacteria | 1263 |
| 463 | nmdc:mga0rr50_362088_c1 | 3300050513 | Bacteria | 1221 |
| 464 | nmdc:mga0rr50_4121_c1 | 3300050513 | Bacteria | 8496 |
| 465 | nmdc:mga0rr50_88079_c1 | 3300050513 | Bacteria | 2411 |
| 466 | nmdc:mga0rr50_93881_c1 | 3300050513 | Bacteria | 2342 |
| 467 | nmdc:mga0a205_119_c1 | 3300050515 | Bacteria | 47408 |
| 468 | nmdc:mga0a205_145964_c1 | 3300050515 | Bacteria | 2266 |
| 469 | nmdc:mga0a205_27101_c1 | 3300050515 | Bacteria | 5471 |
| 470 | nmdc:mga0a205_388835_c1 | 3300050515 | Bacteria | 1259 |
| 471 | nmdc:mga0a205_8171_c1 | 3300050515 | Bacteria | 9507 |
| 472 | nmdc:mga0a205_9811_c1 | 3300050515 | Bacteria | 8781 |
| 473 | Ga0495601_0005533 | 3300053077 | Bacteria | 7369 |
| 474 | Ga0500583_0195535 | 3300053092 | Bacteria | 1006 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025940 | Ga0207691_10067373 | Ga0207691_100673733 | 163 |
| 2 | 3300046683 | Ga0495658_0807160 | Ga0495658_0807160_85_582 | 163 |
| 3 | 3300046684 | Ga0495669_0535775 | Ga0495669_0535775_15_542 | 175 |
| 4 | 3300048908 | Ga0496105_1030495 | Ga0496105_1030495_65_598 | 175 |
| 5 | 3300050511 | nmdc:mga08y16_689268_c1 | nmdc:mga08y16_689268_c1_439_978 | 175 |
| 6 | 3300009176 | Ga0105242_11419174 | Ga0105242_114191742 | 183 |
| 7 | 3300042876 | Ga0451577_0009782 | Ga0451577_0009782_3480_4121 | 186 |
| 8 | 3300045051 | Ga0451576_0488696 | Ga0451576_0488696_108_749 | 186 |
| 9 | 3300049741 | Ga0501079_0224797 | Ga0501079_0224797_301_1023 | 187 |
| 10 | 3300005334 | Ga0068869_100100537 | Ga0068869_1001005371 | 190 |
| 11 | 3300005340 | Ga0070689_100662638 | Ga0070689_1006626381 | 190 |
| 12 | 3300025942 | Ga0207689_10174030 | Ga0207689_101740301 | 190 |
| 13 | 3300025960 | Ga0207651_10975536 | Ga0207651_109755361 | 190 |
| 14 | 3300005289 | Ga0065704_10092529 | Ga0065704_100925292 | 196 |
| 15 | 3300005295 | Ga0065707_10101651 | Ga0065707_101016512 | 196 |
| 16 | 3300005437 | Ga0070710_10076476 | Ga0070710_100764762 | 196 |
| 17 | 3300005539 | Ga0068853_100388635 | Ga0068853_1003886352 | 196 |
| 18 | 3300013308 | Ga0157375_10506424 | Ga0157375_105064241 | 196 |
| 19 | 3300026041 | Ga0207639_10790206 | Ga0207639_107902062 | 196 |
| 20 | 3300035725 | Ga0373947_0546911 | Ga0373947_0546911_16_639 | 196 |
| 21 | 3300005329 | Ga0070683_100983983 | Ga0070683_1009839831 | 197 |
| 22 | 3300005578 | Ga0068854_100776711 | Ga0068854_1007767111 | 197 |
| 23 | 3300005937 | Ga0081455_10003557 | Ga0081455_1000355720 | 197 |
| 24 | 3300005937 | Ga0081455_10098753 | Ga0081455_100987534 | 197 |
| 25 | 3300005981 | Ga0081538_10173312 | Ga0081538_101733122 | 197 |
| 26 | 3300005985 | Ga0081539_10006242 | Ga0081539_100062429 | 197 |
| 27 | 3300009094 | Ga0111539_10202744 | Ga0111539_102027443 | 197 |
| 28 | 3300027907 | Ga0207428_10131923 | Ga0207428_101319233 | 197 |
| 29 | 3300037312 | Ga0395899_0007845 | Ga0395899_0007845_5570_6175 | 197 |
| 30 | 3300037418 | Ga0395900_0112781 | Ga0395900_0112781_958_1563 | 197 |
| 31 | 3300037466 | Ga0395898_0057963 | Ga0395898_0057963_1924_2529 | 197 |
| 32 | 3300037471 | Ga0395905_0011422 | Ga0395905_0011422_5103_5708 | 197 |
| 33 | 3300038443 | Ga0395901_0044711 | Ga0395901_0044711_2873_3478 | 197 |
| 34 | 3300048915 | Ga0496112_0016462 | Ga0496112_0016462_5808_6425 | 197 |
| 35 | 3300049127 | Ga0501306_051382 | Ga0501306_051382_15_608 | 197 |
| 36 | 3300049581 | Ga0501047_0238611 | Ga0501047_0238611_28_636 | 197 |
| 37 | 3300049582 | Ga0501048_0227683 | Ga0501048_0227683_443_1057 | 197 |
| 38 | 3300049587 | Ga0501071_0499341 | Ga0501071_0499341_11_625 | 197 |
| 39 | 3300049592 | Ga0501076_0046128 | Ga0501076_0046128_409_1023 | 197 |
| 40 | 3300049741 | Ga0501079_0103732 | Ga0501079_0103732_747_1361 | 197 |
| 41 | 3300049742 | Ga0501080_0497098 | Ga0501080_0497098_12_620 | 197 |
| 42 | 3300049824 | Ga0501045_0127645 | Ga0501045_0127645_40_654 | 197 |
| 43 | 3300050512 | nmdc:mga0n895_473421_c1 | nmdc:mga0n895_473421_c1_291_884 | 197 |
| 44 | 3300050515 | nmdc:mga0a205_388835_c1 | nmdc:mga0a205_388835_c1_630_1235 | 197 |
| 45 | 3300001977 | JGI24746J21847_1000216 | JGI24746J21847_10002161 | 198 |
| 46 | 3300003203 | JGI25406J46586_10000120 | JGI25406J46586_1000012010 | 198 |
| 47 | 3300004798 | Ga0058859_10030274 | Ga0058859_100302741 | 198 |
| 48 | 3300004800 | Ga0058861_11957070 | Ga0058861_119570701 | 198 |
| 49 | 3300004800 | Ga0058861_12046156 | Ga0058861_120461561 | 198 |
| 50 | 3300004801 | Ga0058860_12215279 | Ga0058860_122152792 | 198 |
| 51 | 3300004803 | Ga0058862_10155072 | Ga0058862_101550722 | 198 |
| 52 | 3300005289 | Ga0065704_10020900 | Ga0065704_100209001 | 198 |
| 53 | 3300005290 | Ga0065712_10161258 | Ga0065712_101612581 | 198 |
| 54 | 3300005290 | Ga0065712_10261948 | Ga0065712_102619482 | 198 |
| 55 | 3300005293 | Ga0065715_10106116 | Ga0065715_101061162 | 198 |
| 56 | 3300005295 | Ga0065707_10010952 | Ga0065707_100109521 | 198 |
| 57 | 3300005328 | Ga0070676_10358412 | Ga0070676_103584121 | 198 |
| 58 | 3300005329 | Ga0070683_100634198 | Ga0070683_1006341981 | 198 |
| 59 | 3300005330 | Ga0070690_100030459 | Ga0070690_1000304593 | 198 |
| 60 | 3300005330 | Ga0070690_100158349 | Ga0070690_1001583492 | 198 |
| 61 | 3300005331 | Ga0070670_100278490 | Ga0070670_1002784902 | 198 |
| 62 | 3300005333 | Ga0070677_10016002 | Ga0070677_100160023 | 198 |
| 63 | 3300005333 | Ga0070677_10076713 | Ga0070677_100767131 | 198 |
| 64 | 3300005335 | Ga0070666_10059625 | Ga0070666_100596253 | 198 |
| 65 | 3300005336 | Ga0070680_100046713 | Ga0070680_1000467134 | 198 |
| 66 | 3300005336 | Ga0070680_100297965 | Ga0070680_1002979652 | 198 |
| 67 | 3300005338 | Ga0068868_100006212 | Ga0068868_1000062122 | 198 |
| 68 | 3300005338 | Ga0068868_100020138 | Ga0068868_1000201384 | 198 |
| 69 | 3300005338 | Ga0068868_100093087 | Ga0068868_1000930871 | 198 |
| 70 | 3300005340 | Ga0070689_100968236 | Ga0070689_1009682361 | 198 |
| 71 | 3300005343 | Ga0070687_100400388 | Ga0070687_1004003881 | 198 |
| 72 | 3300005344 | Ga0070661_100984510 | Ga0070661_1009845101 | 198 |
| 73 | 3300005345 | Ga0070692_10047593 | Ga0070692_100475931 | 198 |
| 74 | 3300005345 | Ga0070692_10055062 | Ga0070692_100550622 | 198 |
| 75 | 3300005345 | Ga0070692_10161893 | Ga0070692_101618931 | 198 |
| 76 | 3300005345 | Ga0070692_10504598 | Ga0070692_105045981 | 198 |
| 77 | 3300005347 | Ga0070668_100113917 | Ga0070668_1001139172 | 198 |
| 78 | 3300005353 | Ga0070669_100007790 | Ga0070669_1000077909 | 198 |
| 79 | 3300005353 | Ga0070669_100015609 | Ga0070669_1000156093 | 198 |
| 80 | 3300005353 | Ga0070669_100110020 | Ga0070669_1001100204 | 198 |
| 81 | 3300005354 | Ga0070675_100004831 | Ga0070675_10000483111 | 198 |
| 82 | 3300005354 | Ga0070675_100062135 | Ga0070675_1000621355 | 198 |
| 83 | 3300005354 | Ga0070675_100164549 | Ga0070675_1001645493 | 198 |
| 84 | 3300005354 | Ga0070675_100387468 | Ga0070675_1003874682 | 198 |
| 85 | 3300005356 | Ga0070674_100056160 | Ga0070674_1000561602 | 198 |
| 86 | 3300005364 | Ga0070673_100024697 | Ga0070673_1000246974 | 198 |
| 87 | 3300005364 | Ga0070673_100262059 | Ga0070673_1002620591 | 198 |
| 88 | 3300005365 | Ga0070688_100347171 | Ga0070688_1003471712 | 198 |
| 89 | 3300005366 | Ga0070659_100141010 | Ga0070659_1001410102 | 198 |
| 90 | 3300005367 | Ga0070667_100016375 | Ga0070667_1000163753 | 198 |
| 91 | 3300005406 | Ga0070703_10041937 | Ga0070703_100419371 | 198 |
| 92 | 3300005435 | Ga0070714_100021670 | Ga0070714_1000216704 | 198 |
| 93 | 3300005436 | Ga0070713_100042507 | Ga0070713_1000425072 | 198 |
| 94 | 3300005436 | Ga0070713_100962033 | Ga0070713_1009620332 | 198 |
| 95 | 3300005438 | Ga0070701_10028489 | Ga0070701_100284891 | 198 |
| 96 | 3300005438 | Ga0070701_10602705 | Ga0070701_106027051 | 198 |
| 97 | 3300005440 | Ga0070705_100001204 | Ga0070705_10000120414 | 198 |
| 98 | 3300005440 | Ga0070705_100002732 | Ga0070705_1000027323 | 198 |
| 99 | 3300005440 | Ga0070705_100129336 | Ga0070705_1001293363 | 198 |
| 100 | 3300005440 | Ga0070705_100541734 | Ga0070705_1005417342 | 198 |
| 101 | 3300005441 | Ga0070700_100241273 | Ga0070700_1002412732 | 198 |
| 102 | 3300005441 | Ga0070700_100625561 | Ga0070700_1006255611 | 198 |
| 103 | 3300005444 | Ga0070694_100376813 | Ga0070694_1003768132 | 198 |
| 104 | 3300005445 | Ga0070708_100002251 | Ga0070708_1000022514 | 198 |
| 105 | 3300005445 | Ga0070708_100022156 | Ga0070708_1000221561 | 198 |
| 106 | 3300005445 | Ga0070708_100044907 | Ga0070708_1000449073 | 198 |
| 107 | 3300005445 | Ga0070708_100544612 | Ga0070708_1005446122 | 198 |
| 108 | 3300005456 | Ga0070678_100186668 | Ga0070678_1001866682 | 198 |
| 109 | 3300005457 | Ga0070662_100053793 | Ga0070662_1000537932 | 198 |
| 110 | 3300005457 | Ga0070662_100421014 | Ga0070662_1004210142 | 198 |
| 111 | 3300005458 | Ga0070681_10014519 | Ga0070681_100145196 | 198 |
| 112 | 3300005458 | Ga0070681_10034808 | Ga0070681_100348083 | 198 |
| 113 | 3300005459 | Ga0068867_100001191 | Ga0068867_10000119120 | 198 |
| 114 | 3300005459 | Ga0068867_100177437 | Ga0068867_1001774372 | 198 |
| 115 | 3300005466 | Ga0070685_10002440 | Ga0070685_100024401 | 198 |
| 116 | 3300005466 | Ga0070685_10138645 | Ga0070685_101386452 | 198 |
| 117 | 3300005466 | Ga0070685_10523171 | Ga0070685_105231711 | 198 |
| 118 | 3300005467 | Ga0070706_100003862 | Ga0070706_10000386213 | 198 |
| 119 | 3300005467 | Ga0070706_100009923 | Ga0070706_1000099231 | 198 |
| 120 | 3300005468 | Ga0070707_100000447 | Ga0070707_10000044716 | 198 |
| 121 | 3300005468 | Ga0070707_100065937 | Ga0070707_1000659371 | 198 |
| 122 | 3300005471 | Ga0070698_100072004 | Ga0070698_1000720041 | 198 |
| 123 | 3300005518 | Ga0070699_100024846 | Ga0070699_1000248463 | 198 |
| 124 | 3300005518 | Ga0070699_100089924 | Ga0070699_1000899242 | 198 |
| 125 | 3300005530 | Ga0070679_100144455 | Ga0070679_1001444552 | 198 |
| 126 | 3300005530 | Ga0070679_100161565 | Ga0070679_1001615652 | 198 |
| 127 | 3300005535 | Ga0070684_100049946 | Ga0070684_1000499462 | 198 |
| 128 | 3300005535 | Ga0070684_100239459 | Ga0070684_1002394593 | 198 |
| 129 | 3300005535 | Ga0070684_100325976 | Ga0070684_1003259761 | 198 |
| 130 | 3300005536 | Ga0070697_100009787 | Ga0070697_1000097875 | 198 |
| 131 | 3300005539 | Ga0068853_100599679 | Ga0068853_1005996792 | 198 |
| 132 | 3300005543 | Ga0070672_100414592 | Ga0070672_1004145922 | 198 |
| 133 | 3300005543 | Ga0070672_100480873 | Ga0070672_1004808732 | 198 |
| 134 | 3300005543 | Ga0070672_100711517 | Ga0070672_1007115171 | 198 |
| 135 | 3300005543 | Ga0070672_100783089 | Ga0070672_1007830891 | 198 |
| 136 | 3300005544 | Ga0070686_100136681 | Ga0070686_1001366812 | 198 |
| 137 | 3300005544 | Ga0070686_100394646 | Ga0070686_1003946461 | 198 |
| 138 | 3300005548 | Ga0070665_100304624 | Ga0070665_1003046242 | 198 |
| 139 | 3300005549 | Ga0070704_100000468 | Ga0070704_1000004681 | 198 |
| 140 | 3300005549 | Ga0070704_100107636 | Ga0070704_1001076363 | 198 |
| 141 | 3300005563 | Ga0068855_100055222 | Ga0068855_1000552223 | 198 |
| 142 | 3300005564 | Ga0070664_100002570 | Ga0070664_10000257016 | 198 |
| 143 | 3300005564 | Ga0070664_100073690 | Ga0070664_1000736902 | 198 |
| 144 | 3300005577 | Ga0068857_100011179 | Ga0068857_1000111793 | 198 |
| 145 | 3300005577 | Ga0068857_100028226 | Ga0068857_1000282265 | 198 |
| 146 | 3300005577 | Ga0068857_100044007 | Ga0068857_1000440074 | 198 |
| 147 | 3300005614 | Ga0068856_100088595 | Ga0068856_1000885953 | 198 |
| 148 | 3300005615 | Ga0070702_100361549 | Ga0070702_1003615492 | 198 |
| 149 | 3300005616 | Ga0068852_100192232 | Ga0068852_1001922322 | 198 |
| 150 | 3300005616 | Ga0068852_100516906 | Ga0068852_1005169061 | 198 |
| 151 | 3300005617 | Ga0068859_100003123 | Ga0068859_10000312315 | 198 |
| 152 | 3300005617 | Ga0068859_100016210 | Ga0068859_1000162103 | 198 |
| 153 | 3300005617 | Ga0068859_100085724 | Ga0068859_1000857242 | 198 |
| 154 | 3300005618 | Ga0068864_100029831 | Ga0068864_1000298318 | 198 |
| 155 | 3300005718 | Ga0068866_10083308 | Ga0068866_100833083 | 198 |
| 156 | 3300005718 | Ga0068866_10388751 | Ga0068866_103887511 | 198 |
| 157 | 3300005719 | Ga0068861_100006606 | Ga0068861_1000066069 | 198 |
| 158 | 3300005840 | Ga0068870_10005956 | Ga0068870_100059563 | 198 |
| 159 | 3300005840 | Ga0068870_10008339 | Ga0068870_100083397 | 198 |
| 160 | 3300005840 | Ga0068870_10051156 | Ga0068870_100511565 | 198 |
| 161 | 3300005841 | Ga0068863_100046713 | Ga0068863_1000467133 | 198 |
| 162 | 3300005841 | Ga0068863_100175662 | Ga0068863_1001756624 | 198 |
| 163 | 3300005842 | Ga0068858_100010752 | Ga0068858_10001075212 | 198 |
| 164 | 3300005842 | Ga0068858_100033151 | Ga0068858_1000331513 | 198 |
| 165 | 3300005842 | Ga0068858_100069115 | Ga0068858_1000691154 | 198 |
| 166 | 3300005843 | Ga0068860_100060319 | Ga0068860_1000603193 | 198 |
| 167 | 3300005843 | Ga0068860_100103370 | Ga0068860_1001033705 | 198 |
| 168 | 3300005843 | Ga0068860_101020577 | Ga0068860_1010205771 | 198 |
| 169 | 3300005844 | Ga0068862_100001812 | Ga0068862_1000018128 | 198 |
| 170 | 3300005844 | Ga0068862_100007478 | Ga0068862_1000074788 | 198 |
| 171 | 3300005985 | Ga0081539_10000024 | Ga0081539_1000002445 | 198 |
| 172 | 3300006028 | Ga0070717_10206905 | Ga0070717_102069052 | 198 |
| 173 | 3300006237 | Ga0097621_100020227 | Ga0097621_1000202275 | 198 |
| 174 | 3300006237 | Ga0097621_100040005 | Ga0097621_1000400052 | 198 |
| 175 | 3300006237 | Ga0097621_100099573 | Ga0097621_1000995735 | 198 |
| 176 | 3300006358 | Ga0068871_100007795 | Ga0068871_1000077953 | 198 |
| 177 | 3300006358 | Ga0068871_100374611 | Ga0068871_1003746113 | 198 |
| 178 | 3300006844 | Ga0075428_100002797 | Ga0075428_1000027973 | 198 |
| 179 | 3300006844 | Ga0075428_100007533 | Ga0075428_1000075337 | 198 |
| 180 | 3300006844 | Ga0075428_100010378 | Ga0075428_1000103786 | 198 |
| 181 | 3300006844 | Ga0075428_100151427 | Ga0075428_1001514273 | 198 |
| 182 | 3300006844 | Ga0075428_100497335 | Ga0075428_1004973351 | 198 |
| 183 | 3300006846 | Ga0075430_100000384 | Ga0075430_1000003843 | 198 |
| 184 | 3300006846 | Ga0075430_100157535 | Ga0075430_1001575352 | 198 |
| 185 | 3300006846 | Ga0075430_100256246 | Ga0075430_1002562462 | 198 |
| 186 | 3300006847 | Ga0075431_100000025 | Ga0075431_10000002567 | 198 |
| 187 | 3300006847 | Ga0075431_100000446 | Ga0075431_1000004467 | 198 |
| 188 | 3300006847 | Ga0075431_100112844 | Ga0075431_1001128441 | 198 |
| 189 | 3300006847 | Ga0075431_101356075 | Ga0075431_1013560751 | 198 |
| 190 | 3300006852 | Ga0075433_10000092 | Ga0075433_1000009221 | 198 |
| 191 | 3300006852 | Ga0075433_10010230 | Ga0075433_100102305 | 198 |
| 192 | 3300006852 | Ga0075433_10061543 | Ga0075433_100615432 | 198 |
| 193 | 3300006852 | Ga0075433_10079942 | Ga0075433_100799424 | 198 |
| 194 | 3300006871 | Ga0075434_100000213 | Ga0075434_1000002135 | 198 |
| 195 | 3300006871 | Ga0075434_100007624 | Ga0075434_1000076242 | 198 |
| 196 | 3300006871 | Ga0075434_100010392 | Ga0075434_1000103923 | 198 |
| 197 | 3300006871 | Ga0075434_100047614 | Ga0075434_1000476142 | 198 |
| 198 | 3300006871 | Ga0075434_100058709 | Ga0075434_1000587092 | 198 |
| 199 | 3300006871 | Ga0075434_100880446 | Ga0075434_1008804462 | 198 |
| 200 | 3300006880 | Ga0075429_100002752 | Ga0075429_10000275216 | 198 |
| 201 | 3300006880 | Ga0075429_100039293 | Ga0075429_1000392932 | 198 |
| 202 | 3300006880 | Ga0075429_100055967 | Ga0075429_1000559673 | 198 |
| 203 | 3300006880 | Ga0075429_100083988 | Ga0075429_1000839882 | 198 |
| 204 | 3300006881 | Ga0068865_100117490 | Ga0068865_1001174902 | 198 |
| 205 | 3300006914 | Ga0075436_100073423 | Ga0075436_1000734232 | 198 |
| 206 | 3300006931 | Ga0097620_100003123 | Ga0097620_10000312315 | 198 |
| 207 | 3300006931 | Ga0097620_100016210 | Ga0097620_1000162103 | 198 |
| 208 | 3300006931 | Ga0097620_100085731 | Ga0097620_1000857312 | 198 |
| 209 | 3300007076 | Ga0075435_100024154 | Ga0075435_1000241542 | 198 |
| 210 | 3300007076 | Ga0075435_100029781 | Ga0075435_1000297813 | 198 |
| 211 | 3300007076 | Ga0075435_100040357 | Ga0075435_1000403572 | 198 |
| 212 | 3300007076 | Ga0075435_100105049 | Ga0075435_1001050493 | 198 |
| 213 | 3300009093 | Ga0105240_10058200 | Ga0105240_100582002 | 198 |
| 214 | 3300009093 | Ga0105240_10121617 | Ga0105240_101216172 | 198 |
| 215 | 3300009094 | Ga0111539_10094983 | Ga0111539_100949831 | 198 |
| 216 | 3300009094 | Ga0111539_10832451 | Ga0111539_108324512 | 198 |
| 217 | 3300009098 | Ga0105245_10878320 | Ga0105245_108783201 | 198 |
| 218 | 3300009147 | Ga0114129_10000461 | Ga0114129_1000046116 | 198 |
| 219 | 3300009147 | Ga0114129_10017499 | Ga0114129_100174995 | 198 |
| 220 | 3300009147 | Ga0114129_10153110 | Ga0114129_101531102 | 198 |
| 221 | 3300009148 | Ga0105243_10097292 | Ga0105243_100972923 | 198 |
| 222 | 3300009545 | Ga0105237_10030909 | Ga0105237_100309093 | 198 |
| 223 | 3300009553 | Ga0105249_10088587 | Ga0105249_100885872 | 198 |
| 224 | 3300009553 | Ga0105249_10565812 | Ga0105249_105658122 | 198 |
| 225 | 3300009553 | Ga0105249_10923646 | Ga0105249_109236461 | 198 |
| 226 | 3300010375 | Ga0105239_10718183 | Ga0105239_107181832 | 198 |
| 227 | 3300011119 | Ga0105246_10077107 | Ga0105246_100771073 | 198 |
| 228 | 3300013100 | Ga0157373_10124779 | Ga0157373_101247792 | 198 |
| 229 | 3300013102 | Ga0157371_10081633 | Ga0157371_100816332 | 198 |
| 230 | 3300013105 | Ga0157369_10098933 | Ga0157369_100989332 | 198 |
| 231 | 3300013296 | Ga0157374_10041885 | Ga0157374_100418852 | 198 |
| 232 | 3300013296 | Ga0157374_10340077 | Ga0157374_103400771 | 198 |
| 233 | 3300013297 | Ga0157378_10647777 | Ga0157378_106477771 | 198 |
| 234 | 3300013297 | Ga0157378_11637071 | Ga0157378_116370711 | 198 |
| 235 | 3300013306 | Ga0163162_10067850 | Ga0163162_100678501 | 198 |
| 236 | 3300013306 | Ga0163162_10553897 | Ga0163162_105538972 | 198 |
| 237 | 3300013307 | Ga0157372_10030010 | Ga0157372_100300102 | 198 |
| 238 | 3300013308 | Ga0157375_10030216 | Ga0157375_100302166 | 198 |
| 239 | 3300013308 | Ga0157375_10575339 | Ga0157375_105753391 | 198 |
| 240 | 3300013308 | Ga0157375_11162767 | Ga0157375_111627672 | 198 |
| 241 | 3300014326 | Ga0157380_10023560 | Ga0157380_100235603 | 198 |
| 242 | 3300014326 | Ga0157380_10118746 | Ga0157380_101187461 | 198 |
| 243 | 3300014745 | Ga0157377_10042275 | Ga0157377_100422752 | 198 |
| 244 | 3300014745 | Ga0157377_10103753 | Ga0157377_101037534 | 198 |
| 245 | 3300014968 | Ga0157379_10165987 | Ga0157379_101659872 | 198 |
| 246 | 3300014968 | Ga0157379_10282841 | Ga0157379_102828412 | 198 |
| 247 | 3300014969 | Ga0157376_10062103 | Ga0157376_100621033 | 198 |
| 248 | 3300014969 | Ga0157376_10149047 | Ga0157376_101490472 | 198 |
| 249 | 3300014969 | Ga0157376_10520762 | Ga0157376_105207622 | 198 |
| 250 | 3300017792 | Ga0163161_10020346 | Ga0163161_100203463 | 198 |
| 251 | 3300017792 | Ga0163161_10024787 | Ga0163161_100247872 | 198 |
| 252 | 3300020069 | Ga0197907_10950682 | Ga0197907_109506821 | 198 |
| 253 | 3300020069 | Ga0197907_11170075 | Ga0197907_111700751 | 198 |
| 254 | 3300020070 | Ga0206356_11200219 | Ga0206356_112002191 | 198 |
| 255 | 3300020075 | Ga0206349_1215835 | Ga0206349_12158351 | 198 |
| 256 | 3300020077 | Ga0206351_10260081 | Ga0206351_102600811 | 198 |
| 257 | 3300020077 | Ga0206351_10493687 | Ga0206351_104936871 | 198 |
| 258 | 3300020078 | Ga0206352_10131148 | Ga0206352_101311481 | 198 |
| 259 | 3300020078 | Ga0206352_10682467 | Ga0206352_106824671 | 198 |
| 260 | 3300020080 | Ga0206350_10195639 | Ga0206350_101956391 | 198 |
| 261 | 3300020080 | Ga0206350_11315453 | Ga0206350_113154533 | 198 |
| 262 | 3300020081 | Ga0206354_10876827 | Ga0206354_108768271 | 198 |
| 263 | 3300020610 | Ga0154015_1681081 | Ga0154015_16810811 | 198 |
| 264 | 3300022467 | Ga0224712_10123682 | Ga0224712_101236821 | 198 |
| 265 | 3300025290 | Ga0207673_1032224 | Ga0207673_10322241 | 198 |
| 266 | 3300025315 | Ga0207697_10000959 | Ga0207697_100009595 | 198 |
| 267 | 3300025315 | Ga0207697_10018716 | Ga0207697_100187161 | 198 |
| 268 | 3300025315 | Ga0207697_10197718 | Ga0207697_101977182 | 198 |
| 269 | 3300025321 | Ga0207656_10375157 | Ga0207656_103751571 | 198 |
| 270 | 3300025885 | Ga0207653_10028854 | Ga0207653_100288542 | 198 |
| 271 | 3300025893 | Ga0207682_10000173 | Ga0207682_1000017328 | 198 |
| 272 | 3300025901 | Ga0207688_10001170 | Ga0207688_100011703 | 198 |
| 273 | 3300025901 | Ga0207688_10473593 | Ga0207688_104735931 | 198 |
| 274 | 3300025904 | Ga0207647_10051885 | Ga0207647_100518853 | 198 |
| 275 | 3300025907 | Ga0207645_10003604 | Ga0207645_100036041 | 198 |
| 276 | 3300025908 | Ga0207643_10001758 | Ga0207643_1000175811 | 198 |
| 277 | 3300025908 | Ga0207643_10021644 | Ga0207643_100216442 | 198 |
| 278 | 3300025909 | Ga0207705_10101735 | Ga0207705_101017352 | 198 |
| 279 | 3300025909 | Ga0207705_10424125 | Ga0207705_104241251 | 198 |
| 280 | 3300025910 | Ga0207684_10033466 | Ga0207684_100334664 | 198 |
| 281 | 3300025910 | Ga0207684_10112876 | Ga0207684_101128761 | 198 |
| 282 | 3300025910 | Ga0207684_10391151 | Ga0207684_103911511 | 198 |
| 283 | 3300025912 | Ga0207707_10059076 | Ga0207707_100590762 | 198 |
| 284 | 3300025913 | Ga0207695_10100410 | Ga0207695_101004102 | 198 |
| 285 | 3300025914 | Ga0207671_10086390 | Ga0207671_100863902 | 198 |
| 286 | 3300025915 | Ga0207693_10413189 | Ga0207693_104131892 | 198 |
| 287 | 3300025917 | Ga0207660_10048187 | Ga0207660_100481872 | 198 |
| 288 | 3300025917 | Ga0207660_10078497 | Ga0207660_100784972 | 198 |
| 289 | 3300025918 | Ga0207662_10075383 | Ga0207662_100753832 | 198 |
| 290 | 3300025919 | Ga0207657_10104031 | Ga0207657_101040314 | 198 |
| 291 | 3300025919 | Ga0207657_10588249 | Ga0207657_105882492 | 198 |
| 292 | 3300025920 | Ga0207649_10040005 | Ga0207649_100400052 | 198 |
| 293 | 3300025922 | Ga0207646_10065975 | Ga0207646_100659751 | 198 |
| 294 | 3300025922 | Ga0207646_10236117 | Ga0207646_102361173 | 198 |
| 295 | 3300025923 | Ga0207681_10005920 | Ga0207681_100059208 | 198 |
| 296 | 3300025923 | Ga0207681_10063970 | Ga0207681_100639702 | 198 |
| 297 | 3300025925 | Ga0207650_10175316 | Ga0207650_101753162 | 198 |
| 298 | 3300025926 | Ga0207659_10000165 | Ga0207659_1000016519 | 198 |
| 299 | 3300025926 | Ga0207659_10314803 | Ga0207659_103148031 | 198 |
| 300 | 3300025926 | Ga0207659_10367311 | Ga0207659_103673111 | 198 |
| 301 | 3300025926 | Ga0207659_10466453 | Ga0207659_104664532 | 198 |
| 302 | 3300025928 | Ga0207700_10184847 | Ga0207700_101848472 | 198 |
| 303 | 3300025932 | Ga0207690_10120576 | Ga0207690_101205761 | 198 |
| 304 | 3300025933 | Ga0207706_10036439 | Ga0207706_100364392 | 198 |
| 305 | 3300025934 | Ga0207686_10656616 | Ga0207686_106566162 | 198 |
| 306 | 3300025935 | Ga0207709_10093359 | Ga0207709_100933592 | 198 |
| 307 | 3300025936 | Ga0207670_10023096 | Ga0207670_100230965 | 198 |
| 308 | 3300025936 | Ga0207670_10191703 | Ga0207670_101917031 | 198 |
| 309 | 3300025940 | Ga0207691_10004294 | Ga0207691_1000429417 | 198 |
| 310 | 3300025940 | Ga0207691_10021429 | Ga0207691_100214295 | 198 |
| 311 | 3300025940 | Ga0207691_10470051 | Ga0207691_104700511 | 198 |
| 312 | 3300025940 | Ga0207691_11134307 | Ga0207691_111343071 | 198 |
| 313 | 3300025941 | Ga0207711_10060622 | Ga0207711_100606223 | 198 |
| 314 | 3300025941 | Ga0207711_10688773 | Ga0207711_106887731 | 198 |
| 315 | 3300025942 | Ga0207689_10004521 | Ga0207689_100045212 | 198 |
| 316 | 3300025942 | Ga0207689_10090553 | Ga0207689_100905533 | 198 |
| 317 | 3300025944 | Ga0207661_10954670 | Ga0207661_109546701 | 198 |
| 318 | 3300025945 | Ga0207679_10043838 | Ga0207679_100438385 | 198 |
| 319 | 3300025945 | Ga0207679_10906758 | Ga0207679_109067581 | 198 |
| 320 | 3300025949 | Ga0207667_10001891 | Ga0207667_1000189118 | 198 |
| 321 | 3300025960 | Ga0207651_10145023 | Ga0207651_101450232 | 198 |
| 322 | 3300025960 | Ga0207651_10655940 | Ga0207651_106559402 | 198 |
| 323 | 3300025961 | Ga0207712_10086277 | Ga0207712_100862772 | 198 |
| 324 | 3300025961 | Ga0207712_10254390 | Ga0207712_102543902 | 198 |
| 325 | 3300025961 | Ga0207712_10782034 | Ga0207712_107820341 | 198 |
| 326 | 3300025961 | Ga0207712_10905121 | Ga0207712_109051212 | 198 |
| 327 | 3300025972 | Ga0207668_10317059 | Ga0207668_103170592 | 198 |
| 328 | 3300025972 | Ga0207668_10632457 | Ga0207668_106324571 | 198 |
| 329 | 3300025981 | Ga0207640_10230292 | Ga0207640_102302922 | 198 |
| 330 | 3300025986 | Ga0207658_10054642 | Ga0207658_100546423 | 198 |
| 331 | 3300025986 | Ga0207658_11038529 | Ga0207658_110385291 | 198 |
| 332 | 3300026035 | Ga0207703_10051336 | Ga0207703_100513363 | 198 |
| 333 | 3300026041 | Ga0207639_10569054 | Ga0207639_105690542 | 198 |
| 334 | 3300026067 | Ga0207678_10064827 | Ga0207678_100648273 | 198 |
| 335 | 3300026067 | Ga0207678_11098847 | Ga0207678_110988471 | 198 |
| 336 | 3300026075 | Ga0207708_10068107 | Ga0207708_100681071 | 198 |
| 337 | 3300026075 | Ga0207708_10118497 | Ga0207708_101184972 | 198 |
| 338 | 3300026075 | Ga0207708_10208410 | Ga0207708_102084101 | 198 |
| 339 | 3300026075 | Ga0207708_10820983 | Ga0207708_108209831 | 198 |
| 340 | 3300026078 | Ga0207702_10424481 | Ga0207702_104244812 | 198 |
| 341 | 3300026088 | Ga0207641_11237816 | Ga0207641_112378161 | 198 |
| 342 | 3300026089 | Ga0207648_10001042 | Ga0207648_1000104213 | 198 |
| 343 | 3300026089 | Ga0207648_10029082 | Ga0207648_100290825 | 198 |
| 344 | 3300026095 | Ga0207676_10004165 | Ga0207676_100041659 | 198 |
| 345 | 3300026095 | Ga0207676_10155110 | Ga0207676_101551102 | 198 |
| 346 | 3300026095 | Ga0207676_10185365 | Ga0207676_101853652 | 198 |
| 347 | 3300026116 | Ga0207674_10023343 | Ga0207674_100233431 | 198 |
| 348 | 3300026116 | Ga0207674_10081445 | Ga0207674_100814452 | 198 |
| 349 | 3300026118 | Ga0207675_100004553 | Ga0207675_10000455316 | 198 |
| 350 | 3300026118 | Ga0207675_100515198 | Ga0207675_1005151981 | 198 |
| 351 | 3300026118 | Ga0207675_101390570 | Ga0207675_1013905701 | 198 |
| 352 | 3300026121 | Ga0207683_10019186 | Ga0207683_100191869 | 198 |
| 353 | 3300026121 | Ga0207683_10067440 | Ga0207683_100674402 | 198 |
| 354 | 3300026142 | Ga0207698_10724604 | Ga0207698_107246041 | 198 |
| 355 | 3300027682 | Ga0209971_1029207 | Ga0209971_10292072 | 198 |
| 356 | 3300027907 | Ga0207428_10145852 | Ga0207428_101458522 | 198 |
| 357 | 3300028379 | Ga0268266_10194341 | Ga0268266_101943412 | 198 |
| 358 | 3300028380 | Ga0268265_10002966 | Ga0268265_100029669 | 198 |
| 359 | 3300028380 | Ga0268265_10089309 | Ga0268265_100893092 | 198 |
| 360 | 3300028380 | Ga0268265_10286681 | Ga0268265_102866812 | 198 |
| 361 | 3300028381 | Ga0268264_10009056 | Ga0268264_100090568 | 198 |
| 362 | 3300028666 | Ga0265336_10010883 | Ga0265336_100108831 | 198 |
| 363 | 3300028800 | Ga0265338_10015272 | Ga0265338_100152724 | 198 |
| 364 | 3300028800 | Ga0265338_10230579 | Ga0265338_102305792 | 198 |
| 365 | 3300029957 | Ga0265324_10127122 | Ga0265324_101271221 | 198 |
| 366 | 3300031235 | Ga0265330_10000447 | Ga0265330_1000044725 | 198 |
| 367 | 3300031239 | Ga0265328_10011675 | Ga0265328_100116752 | 198 |
| 368 | 3300031239 | Ga0265328_10063819 | Ga0265328_100638192 | 198 |
| 369 | 3300031241 | Ga0265325_10000222 | Ga0265325_1000022218 | 198 |
| 370 | 3300031241 | Ga0265325_10060268 | Ga0265325_100602683 | 198 |
| 371 | 3300031247 | Ga0265340_10123451 | Ga0265340_101234511 | 198 |
| 372 | 3300031249 | Ga0265339_10000361 | Ga0265339_1000036131 | 198 |
| 373 | 3300031249 | Ga0265339_10013739 | Ga0265339_100137393 | 198 |
| 374 | 3300031344 | Ga0265316_10000095 | Ga0265316_1000009536 | 198 |
| 375 | 3300031344 | Ga0265316_10003149 | Ga0265316_1000314912 | 198 |
| 376 | 3300031548 | Ga0307408_100543497 | Ga0307408_1005434971 | 198 |
| 377 | 3300031595 | Ga0265313_10012495 | Ga0265313_100124954 | 198 |
| 378 | 3300031711 | Ga0265314_10007446 | Ga0265314_100074464 | 198 |
| 379 | 3300031712 | Ga0265342_10004593 | Ga0265342_100045938 | 198 |
| 380 | 3300031712 | Ga0265342_10009265 | Ga0265342_100092655 | 198 |
| 381 | 3300031712 | Ga0265342_10061930 | Ga0265342_100619301 | 198 |
| 382 | 3300031731 | Ga0307405_10193884 | Ga0307405_101938842 | 198 |
| 383 | 3300031731 | Ga0307405_10498747 | Ga0307405_104987472 | 198 |
| 384 | 3300031852 | Ga0307410_10350653 | Ga0307410_103506532 | 198 |
| 385 | 3300031901 | Ga0307406_10001596 | Ga0307406_1000159615 | 198 |
| 386 | 3300031995 | Ga0307409_100137980 | Ga0307409_1001379801 | 198 |
| 387 | 3300031995 | Ga0307409_100694123 | Ga0307409_1006941232 | 198 |
| 388 | 3300032002 | Ga0307416_100005889 | Ga0307416_1000058892 | 198 |
| 389 | 3300032002 | Ga0307416_101061352 | Ga0307416_1010613521 | 198 |
| 390 | 3300032004 | Ga0307414_10000042 | Ga0307414_1000004260 | 198 |
| 391 | 3300033541 | Ga0316596_1042450 | Ga0316596_10424501 | 198 |
| 392 | 3300035090 | Ga0373949_0023253 | Ga0373949_0023253_65_661 | 198 |
| 393 | 3300035115 | Ga0373941_0197796 | Ga0373941_0197796_25_621 | 198 |
| 394 | 3300035242 | Ga0373962_0071298 | Ga0373962_0071298_413_1009 | 198 |
| 395 | 3300035724 | Ga0373933_0077014 | Ga0373933_0077014_1106_1729 | 198 |
| 396 | 3300037418 | Ga0395900_1164744 | Ga0395900_1164744_49_669 | 198 |
| 397 | 3300038443 | Ga0395901_0217116 | Ga0395901_0217116_961_1584 | 198 |
| 398 | 3300038996 | Ga0242420_079978 | Ga0242420_079978_48_644 | 198 |
| 399 | 3300042876 | Ga0451577_0813272 | Ga0451577_0813272_64_660 | 198 |
| 400 | 3300044656 | Ga0466969_0083452 | Ga0466969_0083452_17_634 | 198 |
| 401 | 3300044673 | Ga0453683_0168786 | Ga0453683_0168786_305_901 | 198 |
| 402 | 3300044693 | Ga0466961_0026859 | Ga0466961_0026859_722_1339 | 198 |
| 403 | 3300044712 | Ga0453684_0488645 | Ga0453684_0488645_189_797 | 198 |
| 404 | 3300045051 | Ga0451576_0023428 | Ga0451576_0023428_5457_6053 | 198 |
| 405 | 3300045051 | Ga0451576_0075374 | Ga0451576_0075374_897_1493 | 198 |
| 406 | 3300045051 | Ga0451576_0106969 | Ga0451576_0106969_479_1075 | 198 |
| 407 | 3300045051 | Ga0451576_0177265 | Ga0451576_0177265_1022_1618 | 198 |
| 408 | 3300045051 | Ga0451576_0508034 | Ga0451576_0508034_173_769 | 198 |
| 409 | 3300046472 | Ga0495580_0524183 | Ga0495580_0524183_121_717 | 198 |
| 410 | 3300046491 | Ga0495584_0255038 | Ga0495584_0255038_153_749 | 198 |
| 411 | 3300046523 | Ga0495644_0080078 | Ga0495644_0080078_530_1126 | 198 |
| 412 | 3300046535 | Ga0495586_0427866 | Ga0495586_0427866_18_614 | 198 |
| 413 | 3300046543 | Ga0495645_0219472 | Ga0495645_0219472_485_1108 | 198 |
| 414 | 3300046674 | Ga0495588_0016972 | Ga0495588_0016972_2703_3299 | 198 |
| 415 | 3300046684 | Ga0495669_0017695 | Ga0495669_0017695_2125_2721 | 198 |
| 416 | 3300047321 | Ga0495676_0311774 | Ga0495676_0311774_301_897 | 198 |
| 417 | 3300047471 | Ga0495684_0099230 | Ga0495684_0099230_61_663 | 198 |
| 418 | 3300048903 | Ga0496100_0191583 | Ga0496100_0191583_28_630 | 198 |
| 419 | 3300048907 | Ga0496104_0002686 | Ga0496104_0002686_862_1464 | 198 |
| 420 | 3300048907 | Ga0496104_0052273 | Ga0496104_0052273_3010_3633 | 198 |
| 421 | 3300048909 | Ga0496106_0887670 | Ga0496106_0887670_36_632 | 198 |
| 422 | 3300048909 | Ga0496106_0950480 | Ga0496106_0950480_32_634 | 198 |
| 423 | 3300048912 | Ga0496109_0221800 | Ga0496109_0221800_33_635 | 198 |
| 424 | 3300048916 | Ga0496113_0702312 | Ga0496113_0702312_159_755 | 198 |
| 425 | 3300048917 | Ga0496114_0004205 | Ga0496114_0004205_7147_7749 | 198 |
| 426 | 3300049521 | Ga0501298_062684 | Ga0501298_062684_57_653 | 198 |
| 427 | 3300049571 | Ga0501034_0242294 | Ga0501034_0242294_50_658 | 198 |
| 428 | 3300049573 | Ga0501037_0272522 | Ga0501037_0272522_23_631 | 198 |
| 429 | 3300049582 | Ga0501048_0740658 | Ga0501048_0740658_58_654 | 198 |
| 430 | 3300049588 | Ga0501072_0789541 | Ga0501072_0789541_26_625 | 198 |
| 431 | 3300049592 | Ga0501076_0477539 | Ga0501076_0477539_63_659 | 198 |
| 432 | 3300049652 | Ga0501202_061905 | Ga0501202_061905_165_761 | 198 |
| 433 | 3300049665 | Ga0501227_001649 | Ga0501227_001649_1584_2309 | 198 |
| 434 | 3300049705 | Ga0501225_0100404 | Ga0501225_0100404_122_718 | 198 |
| 435 | 3300049742 | Ga0501080_0044229 | Ga0501080_0044229_2929_3531 | 198 |
| 436 | 3300049779 | Ga0501283_047761 | Ga0501283_047761_53_649 | 198 |
| 437 | 3300049822 | Ga0501035_0090084 | Ga0501035_0090084_408_1016 | 198 |
| 438 | 3300050507 | nmdc:mga05p37_1341998_c1 | nmdc:mga05p37_1341998_c1_50_679 | 198 |
| 439 | 3300050507 | nmdc:mga05p37_149527_c1 | nmdc:mga05p37_149527_c1_1718_2317 | 198 |
| 440 | 3300050507 | nmdc:mga05p37_158466_c1 | nmdc:mga05p37_158466_c1_428_1024 | 198 |
| 441 | 3300050507 | nmdc:mga05p37_20002_c1 | nmdc:mga05p37_20002_c1_1933_2529 | 198 |
| 442 | 3300050507 | nmdc:mga05p37_2124_c1 | nmdc:mga05p37_2124_c1_10876_11484 | 198 |
| 443 | 3300050507 | nmdc:mga05p37_405368_c1 | nmdc:mga05p37_405368_c1_849_1445 | 198 |
| 444 | 3300050507 | nmdc:mga05p37_623304_c1 | nmdc:mga05p37_623304_c1_569_1165 | 198 |
| 445 | 3300050508 | nmdc:mga09592_13257_c1 | nmdc:mga09592_13257_c1_5671_6267 | 198 |
| 446 | 3300050508 | nmdc:mga09592_234747_c1 | nmdc:mga09592_234747_c1_70_669 | 198 |
| 447 | 3300050508 | nmdc:mga09592_34636_c1 | nmdc:mga09592_34636_c1_2081_2689 | 198 |
| 448 | 3300050508 | nmdc:mga09592_58617_c1 | nmdc:mga09592_58617_c1_674_1285 | 198 |
| 449 | 3300050508 | nmdc:mga09592_730136_c1 | nmdc:mga09592_730136_c1_81_677 | 198 |
| 450 | 3300050508 | nmdc:mga09592_7954_c2 | nmdc:mga09592_7954_c2_257_853 | 198 |
| 451 | 3300050509 | nmdc:mga0qj67_47630_c1 | nmdc:mga0qj67_47630_c1_1574_2185 | 198 |
| 452 | 3300050509 | nmdc:mga0qj67_5744_c1 | nmdc:mga0qj67_5744_c1_3192_3788 | 198 |
| 453 | 3300050510 | nmdc:mga06r32_41776_c1 | nmdc:mga06r32_41776_c1_1228_1839 | 198 |
| 454 | 3300050510 | nmdc:mga06r32_6330_c1 | nmdc:mga06r32_6330_c1_8021_8617 | 198 |
| 455 | 3300050510 | nmdc:mga06r32_82180_c1 | nmdc:mga06r32_82180_c1_1148_1744 | 198 |
| 456 | 3300050511 | nmdc:mga08y16_156071_c1 | nmdc:mga08y16_156071_c1_1521_2117 | 198 |
| 457 | 3300050511 | nmdc:mga08y16_17846_c1 | nmdc:mga08y16_17846_c1_4410_5006 | 198 |
| 458 | 3300050512 | nmdc:mga0n895_114427_c1 | nmdc:mga0n895_114427_c1_1582_2178 | 198 |
| 459 | 3300050512 | nmdc:mga0n895_117414_c1 | nmdc:mga0n895_117414_c1_1257_1853 | 198 |
| 460 | 3300050512 | nmdc:mga0n895_182862_c1 | nmdc:mga0n895_182862_c1_362_970 | 198 |
| 461 | 3300050512 | nmdc:mga0n895_251025_c1 | nmdc:mga0n895_251025_c1_1158_1754 | 198 |
| 462 | 3300050512 | nmdc:mga0n895_33127_c1 | nmdc:mga0n895_33127_c1_4161_4757 | 198 |
| 463 | 3300050512 | nmdc:mga0n895_420_c1 | nmdc:mga0n895_420_c1_2493_3089 | 198 |
| 464 | 3300050513 | nmdc:mga0rr50_362088_c1 | nmdc:mga0rr50_362088_c1_142_738 | 198 |
| 465 | 3300050513 | nmdc:mga0rr50_4121_c1 | nmdc:mga0rr50_4121_c1_774_1370 | 198 |
| 466 | 3300050513 | nmdc:mga0rr50_88079_c1 | nmdc:mga0rr50_88079_c1_227_823 | 198 |
| 467 | 3300050513 | nmdc:mga0rr50_93881_c1 | nmdc:mga0rr50_93881_c1_208_804 | 198 |
| 468 | 3300050515 | nmdc:mga0a205_119_c1 | nmdc:mga0a205_119_c1_24712_25308 | 198 |
| 469 | 3300050515 | nmdc:mga0a205_145964_c1 | nmdc:mga0a205_145964_c1_74_682 | 198 |
| 470 | 3300050515 | nmdc:mga0a205_27101_c1 | nmdc:mga0a205_27101_c1_832_1431 | 198 |
| 471 | 3300050515 | nmdc:mga0a205_8171_c1 | nmdc:mga0a205_8171_c1_2322_2918 | 198 |
| 472 | 3300050515 | nmdc:mga0a205_9811_c1 | nmdc:mga0a205_9811_c1_1979_2575 | 198 |
| 473 | 3300053077 | Ga0495601_0005533 | Ga0495601_0005533_3641_4243 | 198 |
| 474 | 3300053092 | Ga0500583_0195535 | Ga0500583_0195535_206_808 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xuq-assembly1.cif.gz_B | crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. | 0.9774 | 3 | 196 |
| 2rcv-assembly4.cif.gz_F | crystal structure of the bacillus subtilis superoxide dismutase | 0.9745 | 2 | 196 |
| 2rcv-assembly2.cif.gz_H | crystal structure of the bacillus subtilis superoxide dismutase | 0.9725 | 2 | 196 |
| 2rcv-assembly3.cif.gz_D | crystal structure of the bacillus subtilis superoxide dismutase | 0.9715 | 2 | 196 |
| 1xre-assembly1.cif.gz_B | crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution. | 0.9713 | 3 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xuqA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.999 | 20 | 90 | 1.10.287.990 |
| 1xuqB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9981 | 20 | 90 | 1.10.287.990 |
| 1d5nA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.991 | 20 | 87 | 1.10.287.990 |
| 1en5A01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9904 | 20 | 87 | 1.10.287.990 |
| 1i08A01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.989 | 20 | 87 | 1.10.287.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A829RAZ9-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9983 | 1 | 87 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A376TQ19-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9934 | 1 | 87 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A2V9MT98-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9927 | 1 | 122 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A3D4FXU5-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9914 | 1 | 154 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A3M0Z9H9-F1-model_v4 | deleted | 0.9908 | 1 | 135 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar