F451202

General Info

Members Datasets Scaffolds Average Seq Length
474 260 474 201

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10350653|Ga0307410_103506532
Length 242
Sequence MNAPDLNRRSFVKLSLAAGAVAATSSAYAQEKPAFSLPDLPYKTVDLEPHIDAKTMEIHHGKHHQAYITNLNTAVGANAALKGKSLEELVTGLPSISEEAVRMTVRNNAGGHWNHTFFWEVMAPAGKGGEPGDKLAAAVKSAFGSLDDFKKLFGEAATKRFGSGWAWLIVKDGKLKVVSTPNQDNPLMKGIVPDSDLGTPILGLDVWEHAYYLHYQNRRPDYITAWWNVVNWSEVEKRFSKA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 4.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.26
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000216 3300001977 Bacteria 7825
2 JGI25406J46586_10000120 3300003203 Bacteria 34396
3 Ga0058859_10030274 3300004798 Bacteria 1302
4 Ga0058861_11957070 3300004800 Bacteria 660
5 Ga0058861_12046156 3300004800 Bacteria 896
6 Ga0058860_12215279 3300004801 Bacteria 1628
7 Ga0058862_10155072 3300004803 Bacteria 1288
8 Ga0065704_10020900 3300005289 Bacteria 1578
9 Ga0065704_10092529 3300005289 Bacteria 2649
10 Ga0065712_10161258 3300005290 Bacteria 1301
11 Ga0065712_10261948 3300005290 Bacteria 935
12 Ga0065715_10106116 3300005293 Bacteria 2850
13 Ga0065707_10010952 3300005295 Bacteria 3140
14 Ga0065707_10101651 3300005295 Bacteria 2853
15 Ga0070676_10358412 3300005328 Bacteria 1004
16 Ga0070683_100634198 3300005329 Bacteria 1023
17 Ga0070683_100983983 3300005329 Bacteria 810
18 Ga0070690_100030459 3300005330 Bacteria 3353
19 Ga0070690_100158349 3300005330 Bacteria 1550
20 Ga0070670_100278490 3300005331 Bacteria 1461
21 Ga0070677_10016002 3300005333 Bacteria 2664
22 Ga0070677_10076713 3300005333 Bacteria 1420
23 Ga0068869_100100537 3300005334 Bacteria 2187
24 Ga0070666_10059625 3300005335 Bacteria 2581
25 Ga0070680_100046713 3300005336 Bacteria 3523
26 Ga0070680_100297965 3300005336 Bacteria 1367
27 Ga0068868_100006212 3300005338 Bacteria 8449
28 Ga0068868_100020138 3300005338 Bacteria 5006
29 Ga0068868_100093087 3300005338 Bacteria 2430
30 Ga0070689_100662638 3300005340 Bacteria 909
31 Ga0070689_100968236 3300005340 Bacteria 755
32 Ga0070687_100400388 3300005343 Bacteria 900
33 Ga0070661_100984510 3300005344 Bacteria 699
34 Ga0070692_10047593 3300005345 Bacteria 2219
35 Ga0070692_10055062 3300005345 Bacteria 2079
36 Ga0070692_10161893 3300005345 Bacteria 1283
37 Ga0070692_10504598 3300005345 Bacteria 785
38 Ga0070668_100113917 3300005347 Bacteria 2155
39 Ga0070669_100007790 3300005353 Bacteria 7651
40 Ga0070669_100015609 3300005353 Bacteria 5415
41 Ga0070669_100110020 3300005353 Bacteria 2089
42 Ga0070675_100004831 3300005354 Bacteria 10276
43 Ga0070675_100062135 3300005354 Bacteria 3085
44 Ga0070675_100164549 3300005354 Bacteria 1910
45 Ga0070675_100387468 3300005354 Bacteria 1245
46 Ga0070674_100056160 3300005356 Bacteria 2729
47 Ga0070673_100024697 3300005364 Bacteria 4411
48 Ga0070673_100262059 3300005364 Bacteria 1510
49 Ga0070688_100347171 3300005365 Bacteria 1085
50 Ga0070659_100141010 3300005366 Bacteria 1962
51 Ga0070667_100016375 3300005367 Bacteria 6134
52 Ga0070703_10041937 3300005406 Bacteria 1429
53 Ga0070714_100021670 3300005435 Bacteria 5259
54 Ga0070713_100042507 3300005436 Bacteria 3710
55 Ga0070713_100962033 3300005436 Bacteria 823
56 Ga0070710_10076476 3300005437 Bacteria 1943
57 Ga0070701_10028489 3300005438 Bacteria 2745
58 Ga0070701_10602705 3300005438 Bacteria 727
59 Ga0070705_100001204 3300005440 Bacteria 14089
60 Ga0070705_100002732 3300005440 Bacteria 8811
61 Ga0070705_100129336 3300005440 Bacteria 1645
62 Ga0070705_100541734 3300005440 Bacteria 891
63 Ga0070700_100241273 3300005441 Bacteria 1291
64 Ga0070700_100625561 3300005441 Bacteria 847
65 Ga0070694_100376813 3300005444 Bacteria 1106
66 Ga0070708_100002251 3300005445 Bacteria 14917
67 Ga0070708_100022156 3300005445 Bacteria 5385
68 Ga0070708_100044907 3300005445 Bacteria 3889
69 Ga0070708_100544612 3300005445 Bacteria 1095
70 Ga0070678_100186668 3300005456 Bacteria 1701
71 Ga0070662_100053793 3300005457 Bacteria 2915
72 Ga0070662_100421014 3300005457 Bacteria 1105
73 Ga0070681_10014519 3300005458 Bacteria 7838
74 Ga0070681_10034808 3300005458 Bacteria 5058
75 Ga0068867_100001191 3300005459 Bacteria 17832
76 Ga0068867_100177437 3300005459 Bacteria 1691
77 Ga0070685_10002440 3300005466 Bacteria 9559
78 Ga0070685_10138645 3300005466 Bacteria 1529
79 Ga0070685_10523171 3300005466 Bacteria 843
80 Ga0070706_100003862 3300005467 Bacteria 14636
81 Ga0070706_100009923 3300005467 Bacteria 8841
82 Ga0070707_100000447 3300005468 Bacteria 40904
83 Ga0070707_100065937 3300005468 Bacteria 3479
84 Ga0070698_100072004 3300005471 Bacteria 3465
85 Ga0070699_100024846 3300005518 Bacteria 5164
86 Ga0070699_100089924 3300005518 Bacteria 2683
87 Ga0070679_100144455 3300005530 Bacteria 2357
88 Ga0070679_100161565 3300005530 Bacteria 2214
89 Ga0070684_100049946 3300005535 Bacteria 3632
90 Ga0070684_100239459 3300005535 Bacteria 1658
91 Ga0070684_100325976 3300005535 Bacteria 1411
92 Ga0070697_100009787 3300005536 Bacteria 7476
93 Ga0068853_100388635 3300005539 Bacteria 1304
94 Ga0068853_100599679 3300005539 Bacteria 1046
95 Ga0070672_100414592 3300005543 Bacteria 1156
96 Ga0070672_100480873 3300005543 Bacteria 1072
97 Ga0070672_100711517 3300005543 Bacteria 880
98 Ga0070672_100783089 3300005543 Bacteria 838
99 Ga0070686_100136681 3300005544 Bacteria 1701
100 Ga0070686_100394646 3300005544 Bacteria 1051
101 Ga0070665_100304624 3300005548 Bacteria 1596
102 Ga0070704_100000468 3300005549 Bacteria 19028
103 Ga0070704_100107636 3300005549 Bacteria 2115
104 Ga0068855_100055222 3300005563 Bacteria 4666
105 Ga0070664_100002570 3300005564 Bacteria 14640
106 Ga0070664_100073690 3300005564 Bacteria 2930
107 Ga0068857_100011179 3300005577 Bacteria 7807
108 Ga0068857_100028226 3300005577 Bacteria 4951
109 Ga0068857_100044007 3300005577 Bacteria 3960
110 Ga0068854_100776711 3300005578 Bacteria 833
111 Ga0068856_100088595 3300005614 Bacteria 3077
112 Ga0070702_100361549 3300005615 Bacteria 1026
113 Ga0068852_100192232 3300005616 Bacteria 1926
114 Ga0068852_100516906 3300005616 Bacteria 1191
115 Ga0068859_100003123 3300005617 Bacteria 16824
116 Ga0068859_100016210 3300005617 Bacteria 7485
117 Ga0068859_100085724 3300005617 Bacteria 3195
118 Ga0068864_100029831 3300005618 Bacteria 4622
119 Ga0068866_10083308 3300005718 Bacteria 1723
120 Ga0068866_10388751 3300005718 Bacteria 897
121 Ga0068861_100006606 3300005719 Bacteria 7914
122 Ga0068870_10005956 3300005840 Bacteria 5358
123 Ga0068870_10008339 3300005840 Bacteria 4659
124 Ga0068870_10051156 3300005840 Bacteria 2186
125 Ga0068863_100046713 3300005841 Bacteria 4110
126 Ga0068863_100175662 3300005841 Bacteria 2055
127 Ga0068858_100010752 3300005842 Bacteria 8653
128 Ga0068858_100033151 3300005842 Bacteria 4795
129 Ga0068858_100069115 3300005842 Bacteria 3274
130 Ga0068860_100060319 3300005843 Bacteria 3605
131 Ga0068860_100103370 3300005843 Bacteria 2719
132 Ga0068860_101020577 3300005843 Bacteria 845
133 Ga0068862_100001812 3300005844 Bacteria 19342
134 Ga0068862_100007478 3300005844 Bacteria 9056
135 Ga0081455_10003557 3300005937 Bacteria 17878
136 Ga0081455_10098753 3300005937 Bacteria 2350
137 Ga0081538_10173312 3300005981 Bacteria 937
138 Ga0081539_10000024 3300005985 Bacteria 354702
139 Ga0081539_10006242 3300005985 Bacteria 11540
140 Ga0070717_10206905 3300006028 Bacteria 1721
141 Ga0097621_100020227 3300006237 Bacteria 5127
142 Ga0097621_100040005 3300006237 Bacteria 3767
143 Ga0097621_100099573 3300006237 Bacteria 2443
144 Ga0068871_100007795 3300006358 Bacteria 7666
145 Ga0068871_100374611 3300006358 Bacteria 1263
146 Ga0075428_100002797 3300006844 Bacteria 18985
147 Ga0075428_100007533 3300006844 Bacteria 12066
148 Ga0075428_100010378 3300006844 Bacteria 10343
149 Ga0075428_100151427 3300006844 Bacteria 2520
150 Ga0075428_100497335 3300006844 Bacteria 1305
151 Ga0075430_100000384 3300006846 Bacteria 32464
152 Ga0075430_100157535 3300006846 Bacteria 1890
153 Ga0075430_100256246 3300006846 Bacteria 1449
154 Ga0075431_100000025 3300006847 Bacteria 79014
155 Ga0075431_100000446 3300006847 Bacteria 33843
156 Ga0075431_100112844 3300006847 Bacteria 2805
157 Ga0075431_101356075 3300006847 Bacteria 671
158 Ga0075433_10000092 3300006852 Bacteria 42081
159 Ga0075433_10010230 3300006852 Bacteria 7522
160 Ga0075433_10061543 3300006852 Bacteria 3288
161 Ga0075433_10079942 3300006852 Bacteria 2881
162 Ga0075434_100000213 3300006871 Bacteria 39624
163 Ga0075434_100007624 3300006871 Bacteria 10013
164 Ga0075434_100010392 3300006871 Bacteria 8725
165 Ga0075434_100047614 3300006871 Bacteria 4255
166 Ga0075434_100058709 3300006871 Bacteria 3824
167 Ga0075434_100880446 3300006871 Bacteria 911
168 Ga0075429_100002752 3300006880 Bacteria 14857
169 Ga0075429_100039293 3300006880 Bacteria 4119
170 Ga0075429_100055967 3300006880 Bacteria 3433
171 Ga0075429_100083988 3300006880 Bacteria 2775
172 Ga0068865_100117490 3300006881 Bacteria 1972
173 Ga0075436_100073423 3300006914 Bacteria 2368
174 Ga0097620_100003123 3300006931 Bacteria 16824
175 Ga0097620_100016210 3300006931 Bacteria 7485
176 Ga0097620_100085731 3300006931 Bacteria 3195
177 Ga0075435_100024154 3300007076 Bacteria 4713
178 Ga0075435_100029781 3300007076 Bacteria 4286
179 Ga0075435_100040357 3300007076 Bacteria 3727
180 Ga0075435_100105049 3300007076 Bacteria 2344
181 Ga0105240_10058200 3300009093 Bacteria 4825
182 Ga0105240_10121617 3300009093 Bacteria 3143
183 Ga0111539_10094983 3300009094 Bacteria 3503
184 Ga0111539_10202744 3300009094 Bacteria 2313
185 Ga0111539_10832451 3300009094 Bacteria 1074
186 Ga0105245_10878320 3300009098 Bacteria 937
187 Ga0114129_10000461 3300009147 Bacteria 48733
188 Ga0114129_10017499 3300009147 Bacteria 10206
189 Ga0114129_10153110 3300009147 Bacteria 3155
190 Ga0105243_10097292 3300009148 Bacteria 2436
191 Ga0105242_11419174 3300009176 Bacteria 722
192 Ga0105237_10030909 3300009545 Bacteria 5433
193 Ga0105249_10088587 3300009553 Bacteria 2891
194 Ga0105249_10565812 3300009553 Bacteria 1189
195 Ga0105249_10923646 3300009553 Bacteria 940
196 Ga0105239_10718183 3300010375 Bacteria 1143
197 Ga0105246_10077107 3300011119 Bacteria 2363
198 Ga0157373_10124779 3300013100 Bacteria 1810
199 Ga0157371_10081633 3300013102 Bacteria 2289
200 Ga0157369_10098933 3300013105 Bacteria 3110
201 Ga0157374_10041885 3300013296 Bacteria 4222
202 Ga0157374_10340077 3300013296 Bacteria 1490
203 Ga0157378_10647777 3300013297 Bacteria 1072
204 Ga0157378_11637071 3300013297 Bacteria 690
205 Ga0163162_10067850 3300013306 Bacteria 3618
206 Ga0163162_10553897 3300013306 Bacteria 1278
207 Ga0157372_10030010 3300013307 Bacteria 5944
208 Ga0157375_10030216 3300013308 Bacteria 5107
209 Ga0157375_10506424 3300013308 Bacteria 1371
210 Ga0157375_10575339 3300013308 Bacteria 1287
211 Ga0157375_11162767 3300013308 Bacteria 904
212 Ga0157380_10023560 3300014326 Bacteria 4645
213 Ga0157380_10118746 3300014326 Bacteria 2236
214 Ga0157377_10042275 3300014745 Bacteria 2531
215 Ga0157377_10103753 3300014745 Bacteria 1699
216 Ga0157379_10165987 3300014968 Bacteria 1993
217 Ga0157379_10282841 3300014968 Bacteria 1510
218 Ga0157376_10062103 3300014969 Bacteria 3143
219 Ga0157376_10149047 3300014969 Bacteria 2108
220 Ga0157376_10520762 3300014969 Bacteria 1172
221 Ga0163161_10020346 3300017792 Bacteria 4657
222 Ga0163161_10024787 3300017792 Bacteria 4240
223 Ga0197907_10950682 3300020069 Bacteria 766
224 Ga0197907_11170075 3300020069 Bacteria 908
225 Ga0206356_11200219 3300020070 Bacteria 814
226 Ga0206349_1215835 3300020075 Bacteria 883
227 Ga0206351_10260081 3300020077 Bacteria 849
228 Ga0206351_10493687 3300020077 Bacteria 777
229 Ga0206352_10131148 3300020078 Bacteria 851
230 Ga0206352_10682467 3300020078 Bacteria 778
231 Ga0206350_10195639 3300020080 Bacteria 1213
232 Ga0206350_11315453 3300020080 Bacteria 1504
233 Ga0206354_10876827 3300020081 Bacteria 898
234 Ga0154015_1681081 3300020610 Bacteria 1645
235 Ga0224712_10123682 3300022467 Bacteria 1123
236 Ga0207673_1032224 3300025290 Bacteria 727
237 Ga0207697_10000959 3300025315 Bacteria 16217
238 Ga0207697_10018716 3300025315 Bacteria 2839
239 Ga0207697_10197718 3300025315 Bacteria 884
240 Ga0207656_10375157 3300025321 Bacteria 712
241 Ga0207653_10028854 3300025885 Bacteria 1786
242 Ga0207682_10000173 3300025893 Bacteria 29484
243 Ga0207688_10001170 3300025901 Bacteria 13536
244 Ga0207688_10473593 3300025901 Bacteria 782
245 Ga0207647_10051885 3300025904 Bacteria 2533
246 Ga0207645_10003604 3300025907 Bacteria 11714
247 Ga0207643_10001758 3300025908 Bacteria 12101
248 Ga0207643_10021644 3300025908 Bacteria 3535
249 Ga0207705_10101735 3300025909 Bacteria 2114
250 Ga0207705_10424125 3300025909 Bacteria 1030
251 Ga0207684_10033466 3300025910 Bacteria 4370
252 Ga0207684_10112876 3300025910 Bacteria 2326
253 Ga0207684_10391151 3300025910 Bacteria 1195
254 Ga0207707_10059076 3300025912 Bacteria 3336
255 Ga0207695_10100410 3300025913 Bacteria 2890
256 Ga0207671_10086390 3300025914 Bacteria 2358
257 Ga0207693_10413189 3300025915 Bacteria 1055
258 Ga0207660_10048187 3300025917 Bacteria 3015
259 Ga0207660_10078497 3300025917 Bacteria 2419
260 Ga0207662_10075383 3300025918 Bacteria 2049
261 Ga0207657_10104031 3300025919 Bacteria 2352
262 Ga0207657_10588249 3300025919 Bacteria 869
263 Ga0207649_10040005 3300025920 Bacteria 2846
264 Ga0207646_10065975 3300025922 Bacteria 3231
265 Ga0207646_10236117 3300025922 Bacteria 1652
266 Ga0207681_10005920 3300025923 Bacteria 7496
267 Ga0207681_10063970 3300025923 Bacteria 2538
268 Ga0207650_10175316 3300025925 Bacteria 1706
269 Ga0207659_10000165 3300025926 Bacteria 39413
270 Ga0207659_10314803 3300025926 Bacteria 1289
271 Ga0207659_10367311 3300025926 Bacteria 1197
272 Ga0207659_10466453 3300025926 Bacteria 1065
273 Ga0207700_10184847 3300025928 Bacteria 1748
274 Ga0207690_10120576 3300025932 Bacteria 1904
275 Ga0207706_10036439 3300025933 Bacteria 4369
276 Ga0207686_10656616 3300025934 Bacteria 830
277 Ga0207709_10093359 3300025935 Bacteria 1972
278 Ga0207670_10023096 3300025936 Bacteria 3866
279 Ga0207670_10191703 3300025936 Bacteria 1547
280 Ga0207691_10004294 3300025940 Bacteria 13844
281 Ga0207691_10021429 3300025940 Bacteria 6102
282 Ga0207691_10067373 3300025940 Bacteria 3237
283 Ga0207691_10470051 3300025940 Bacteria 1069
284 Ga0207691_11134307 3300025940 Bacteria 650
285 Ga0207711_10060622 3300025941 Bacteria 3261
286 Ga0207711_10688773 3300025941 Bacteria 953
287 Ga0207689_10004521 3300025942 Bacteria 12592
288 Ga0207689_10090553 3300025942 Bacteria 2513
289 Ga0207689_10174030 3300025942 Bacteria 1775
290 Ga0207661_10954670 3300025944 Bacteria 790
291 Ga0207679_10043838 3300025945 Bacteria 3224
292 Ga0207679_10906758 3300025945 Bacteria 806
293 Ga0207667_10001891 3300025949 Bacteria 26290
294 Ga0207651_10145023 3300025960 Bacteria 1839
295 Ga0207651_10655940 3300025960 Bacteria 921
296 Ga0207651_10975536 3300025960 Bacteria 757
297 Ga0207712_10086277 3300025961 Bacteria 2299
298 Ga0207712_10254390 3300025961 Bacteria 1421
299 Ga0207712_10782034 3300025961 Bacteria 838
300 Ga0207712_10905121 3300025961 Bacteria 780
301 Ga0207668_10317059 3300025972 Bacteria 1292
302 Ga0207668_10632457 3300025972 Bacteria 935
303 Ga0207640_10230292 3300025981 Bacteria 1425
304 Ga0207658_10054642 3300025986 Bacteria 2955
305 Ga0207658_11038529 3300025986 Bacteria 748
306 Ga0207703_10051336 3300026035 Bacteria 3341
307 Ga0207639_10569054 3300026041 Bacteria 1042
308 Ga0207639_10790206 3300026041 Bacteria 884
309 Ga0207678_10064827 3300026067 Bacteria 3139
310 Ga0207678_11098847 3300026067 Bacteria 704
311 Ga0207708_10068107 3300026075 Bacteria 2724
312 Ga0207708_10118497 3300026075 Bacteria 2061
313 Ga0207708_10208410 3300026075 Bacteria 1562
314 Ga0207708_10820983 3300026075 Bacteria 801
315 Ga0207702_10424481 3300026078 Bacteria 1286
316 Ga0207641_11237816 3300026088 Bacteria 746
317 Ga0207648_10001042 3300026089 Bacteria 31075
318 Ga0207648_10029082 3300026089 Bacteria 4900
319 Ga0207676_10004165 3300026095 Bacteria 10223
320 Ga0207676_10155110 3300026095 Bacteria 1977
321 Ga0207676_10185365 3300026095 Bacteria 1826
322 Ga0207674_10023343 3300026116 Bacteria 6628
323 Ga0207674_10081445 3300026116 Bacteria 3239
324 Ga0207675_100004553 3300026118 Bacteria 13372
325 Ga0207675_100515198 3300026118 Bacteria 1192
326 Ga0207675_101390570 3300026118 Bacteria 722
327 Ga0207683_10019186 3300026121 Bacteria 5839
328 Ga0207683_10067440 3300026121 Bacteria 3156
329 Ga0207698_10724604 3300026142 Bacteria 991
330 Ga0209971_1029207 3300027682 Bacteria 1320
331 Ga0207428_10131923 3300027907 Bacteria 1911
332 Ga0207428_10145852 3300027907 Bacteria 1804
333 Ga0268266_10194341 3300028379 Bacteria 1854
334 Ga0268265_10002966 3300028380 Bacteria 12418
335 Ga0268265_10089309 3300028380 Bacteria 2457
336 Ga0268265_10286681 3300028380 Bacteria 1476
337 Ga0268264_10009056 3300028381 Bacteria 8260
338 Ga0265336_10010883 3300028666 Bacteria 3104
339 Ga0265338_10015272 3300028800 Bacteria 8453
340 Ga0265338_10230579 3300028800 Bacteria 1377
341 Ga0265324_10127122 3300029957 Bacteria 865
342 Ga0265330_10000447 3300031235 Bacteria 27592
343 Ga0265328_10011675 3300031239 Bacteria 3506
344 Ga0265328_10063819 3300031239 Bacteria 1353
345 Ga0265325_10000222 3300031241 Bacteria 40255
346 Ga0265325_10060268 3300031241 Bacteria 1928
347 Ga0265340_10123451 3300031247 Bacteria 1190
348 Ga0265339_10000361 3300031249 Bacteria 35945
349 Ga0265339_10013739 3300031249 Bacteria 4900
350 Ga0265316_10000095 3300031344 Bacteria 95750
351 Ga0265316_10003149 3300031344 Bacteria 16790
352 Ga0307408_100543497 3300031548 Bacteria 1024
353 Ga0265313_10012495 3300031595 Bacteria 5177
354 Ga0265314_10007446 3300031711 Bacteria 9493
355 Ga0265342_10004593 3300031712 Bacteria 10773
356 Ga0265342_10009265 3300031712 Bacteria 6959
357 Ga0265342_10061930 3300031712 Bacteria 2203
358 Ga0307405_10193884 3300031731 Bacteria 1470
359 Ga0307405_10498747 3300031731 Bacteria 975
360 Ga0307410_10350653 3300031852 Bacteria 1179
361 Ga0307406_10001596 3300031901 Bacteria 12470
362 Ga0307409_100137980 3300031995 Bacteria 2096
363 Ga0307409_100694123 3300031995 Bacteria 1016
364 Ga0307416_100005889 3300032002 Bacteria 7607
365 Ga0307416_101061352 3300032002 Bacteria 914
366 Ga0307414_10000042 3300032004 Bacteria 142637
367 Ga0316596_1042450 3300033541 Bacteria 1197
368 Ga0373949_0023253 3300035090 Bacteria 1434
369 Ga0373941_0197796 3300035115 Bacteria 763
370 Ga0373962_0071298 3300035242 Bacteria 1039
371 Ga0373933_0077014 3300035724 Bacteria 2038
372 Ga0373947_0546911 3300035725 Bacteria 788
373 Ga0395899_0007845 3300037312 Bacteria 8225
374 Ga0395900_0112781 3300037418 Bacteria 2791
375 Ga0395900_1164744 3300037418 Bacteria 687
376 Ga0395898_0057963 3300037466 Bacteria 3771
377 Ga0395905_0011422 3300037471 Bacteria 8580
378 Ga0395901_0044711 3300038443 Bacteria 4592
379 Ga0395901_0217116 3300038443 Bacteria 2000
380 Ga0242420_079978 3300038996 Bacteria 674
381 Ga0451577_0009782 3300042876 Bacteria 9192
382 Ga0451577_0813272 3300042876 Bacteria 844
383 Ga0466969_0083452 3300044656 Bacteria 1522
384 Ga0453683_0168786 3300044673 Bacteria 1386
385 Ga0466961_0026859 3300044693 Bacteria 3702
386 Ga0453684_0488645 3300044712 Bacteria 1365
387 Ga0451576_0023428 3300045051 Bacteria 6683
388 Ga0451576_0075374 3300045051 Bacteria 3510
389 Ga0451576_0106969 3300045051 Bacteria 2910
390 Ga0451576_0177265 3300045051 Bacteria 2225
391 Ga0451576_0488696 3300045051 Bacteria 1293
392 Ga0451576_0508034 3300045051 Bacteria 1266
393 Ga0495580_0524183 3300046472 Bacteria 789
394 Ga0495584_0255038 3300046491 Bacteria 892
395 Ga0495644_0080078 3300046523 Bacteria 1231
396 Ga0495586_0427866 3300046535 Bacteria 763
397 Ga0495645_0219472 3300046543 Bacteria 1280
398 Ga0495588_0016972 3300046674 Bacteria 3527
399 Ga0495658_0807160 3300046683 Bacteria 601
400 Ga0495669_0017695 3300046684 Bacteria 3060
401 Ga0495669_0535775 3300046684 Bacteria 570
402 Ga0495676_0311774 3300047321 Bacteria 1059
403 Ga0495684_0099230 3300047471 Bacteria 2202
404 Ga0496100_0191583 3300048903 Bacteria 1485
405 Ga0496104_0002686 3300048907 Bacteria 15316
406 Ga0496104_0052273 3300048907 Bacteria 3859
407 Ga0496105_1030495 3300048908 Bacteria 614
408 Ga0496106_0887670 3300048909 Bacteria 704
409 Ga0496106_0950480 3300048909 Bacteria 677
410 Ga0496109_0221800 3300048912 Bacteria 1778
411 Ga0496112_0016462 3300048915 Bacteria 6928
412 Ga0496113_0702312 3300048916 Bacteria 807
413 Ga0496114_0004205 3300048917 Bacteria 11157
414 Ga0501306_051382 3300049127 Bacteria 661
415 Ga0501298_062684 3300049521 Bacteria 790
416 Ga0501034_0242294 3300049571 Bacteria 1749
417 Ga0501037_0272522 3300049573 Bacteria 1181
418 Ga0501047_0238611 3300049581 Bacteria 1669
419 Ga0501048_0227683 3300049582 Bacteria 1323
420 Ga0501048_0740658 3300049582 Bacteria 706
421 Ga0501071_0499341 3300049587 Bacteria 933
422 Ga0501072_0789541 3300049588 Bacteria 744
423 Ga0501076_0046128 3300049592 Bacteria 3443
424 Ga0501076_0477539 3300049592 Bacteria 1027
425 Ga0501202_061905 3300049652 Bacteria 848
426 Ga0501227_001649 3300049665 Bacteria 4971
427 Ga0501225_0100404 3300049705 Bacteria 845
428 Ga0501079_0103732 3300049741 Bacteria 2206
429 Ga0501079_0224797 3300049741 Bacteria 1467
430 Ga0501080_0044229 3300049742 Bacteria 4146
431 Ga0501080_0497098 3300049742 Bacteria 1090
432 Ga0501283_047761 3300049779 Bacteria 753
433 Ga0501035_0090084 3300049822 Bacteria 2701
434 Ga0501045_0127645 3300049824 Bacteria 1890
435 nmdc:mga05p37_1341998_c1 3300050507 Bacteria 725
436 nmdc:mga05p37_149527_c1 3300050507 Bacteria 2858
437 nmdc:mga05p37_158466_c1 3300050507 Bacteria 2765
438 nmdc:mga05p37_20002_c1 3300050507 Bacteria 8100
439 nmdc:mga05p37_2124_c1 3300050507 Bacteria 23140
440 nmdc:mga05p37_405368_c1 3300050507 Bacteria 1591
441 nmdc:mga05p37_623304_c1 3300050507 Bacteria 1213
442 nmdc:mga09592_13257_c1 3300050508 Bacteria 6730
443 nmdc:mga09592_234747_c1 3300050508 Bacteria 1589
444 nmdc:mga09592_34636_c1 3300050508 Bacteria 4221
445 nmdc:mga09592_58617_c1 3300050508 Bacteria 3256
446 nmdc:mga09592_730136_c1 3300050508 Bacteria 841
447 nmdc:mga09592_7954_c2 3300050508 Bacteria 6877
448 nmdc:mga0qj67_47630_c1 3300050509 Bacteria 3387
449 nmdc:mga0qj67_5744_c1 3300050509 Bacteria 9081
450 nmdc:mga06r32_41776_c1 3300050510 Bacteria 4358
451 nmdc:mga06r32_6330_c1 3300050510 Bacteria 10631
452 nmdc:mga06r32_82180_c1 3300050510 Bacteria 3138
453 nmdc:mga08y16_156071_c1 3300050511 Bacteria 2372
454 nmdc:mga08y16_17846_c1 3300050511 Bacteria 7475
455 nmdc:mga08y16_689268_c1 3300050511 Bacteria 1023
456 nmdc:mga0n895_114427_c1 3300050512 Bacteria 2716
457 nmdc:mga0n895_117414_c1 3300050512 Bacteria 2680
458 nmdc:mga0n895_182862_c1 3300050512 Bacteria 2128
459 nmdc:mga0n895_251025_c1 3300050512 Bacteria 1795
460 nmdc:mga0n895_33127_c1 3300050512 Bacteria 4964
461 nmdc:mga0n895_420_c1 3300050512 Bacteria 28435
462 nmdc:mga0n895_473421_c1 3300050512 Bacteria 1263
463 nmdc:mga0rr50_362088_c1 3300050513 Bacteria 1221
464 nmdc:mga0rr50_4121_c1 3300050513 Bacteria 8496
465 nmdc:mga0rr50_88079_c1 3300050513 Bacteria 2411
466 nmdc:mga0rr50_93881_c1 3300050513 Bacteria 2342
467 nmdc:mga0a205_119_c1 3300050515 Bacteria 47408
468 nmdc:mga0a205_145964_c1 3300050515 Bacteria 2266
469 nmdc:mga0a205_27101_c1 3300050515 Bacteria 5471
470 nmdc:mga0a205_388835_c1 3300050515 Bacteria 1259
471 nmdc:mga0a205_8171_c1 3300050515 Bacteria 9507
472 nmdc:mga0a205_9811_c1 3300050515 Bacteria 8781
473 Ga0495601_0005533 3300053077 Bacteria 7369
474 Ga0500583_0195535 3300053092 Bacteria 1006

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10067373 Ga0207691_100673733 163
2 3300046683 Ga0495658_0807160 Ga0495658_0807160_85_582 163
3 3300046684 Ga0495669_0535775 Ga0495669_0535775_15_542 175
4 3300048908 Ga0496105_1030495 Ga0496105_1030495_65_598 175
5 3300050511 nmdc:mga08y16_689268_c1 nmdc:mga08y16_689268_c1_439_978 175
6 3300009176 Ga0105242_11419174 Ga0105242_114191742 183
7 3300042876 Ga0451577_0009782 Ga0451577_0009782_3480_4121 186
8 3300045051 Ga0451576_0488696 Ga0451576_0488696_108_749 186
9 3300049741 Ga0501079_0224797 Ga0501079_0224797_301_1023 187
10 3300005334 Ga0068869_100100537 Ga0068869_1001005371 190
11 3300005340 Ga0070689_100662638 Ga0070689_1006626381 190
12 3300025942 Ga0207689_10174030 Ga0207689_101740301 190
13 3300025960 Ga0207651_10975536 Ga0207651_109755361 190
14 3300005289 Ga0065704_10092529 Ga0065704_100925292 196
15 3300005295 Ga0065707_10101651 Ga0065707_101016512 196
16 3300005437 Ga0070710_10076476 Ga0070710_100764762 196
17 3300005539 Ga0068853_100388635 Ga0068853_1003886352 196
18 3300013308 Ga0157375_10506424 Ga0157375_105064241 196
19 3300026041 Ga0207639_10790206 Ga0207639_107902062 196
20 3300035725 Ga0373947_0546911 Ga0373947_0546911_16_639 196
21 3300005329 Ga0070683_100983983 Ga0070683_1009839831 197
22 3300005578 Ga0068854_100776711 Ga0068854_1007767111 197
23 3300005937 Ga0081455_10003557 Ga0081455_1000355720 197
24 3300005937 Ga0081455_10098753 Ga0081455_100987534 197
25 3300005981 Ga0081538_10173312 Ga0081538_101733122 197
26 3300005985 Ga0081539_10006242 Ga0081539_100062429 197
27 3300009094 Ga0111539_10202744 Ga0111539_102027443 197
28 3300027907 Ga0207428_10131923 Ga0207428_101319233 197
29 3300037312 Ga0395899_0007845 Ga0395899_0007845_5570_6175 197
30 3300037418 Ga0395900_0112781 Ga0395900_0112781_958_1563 197
31 3300037466 Ga0395898_0057963 Ga0395898_0057963_1924_2529 197
32 3300037471 Ga0395905_0011422 Ga0395905_0011422_5103_5708 197
33 3300038443 Ga0395901_0044711 Ga0395901_0044711_2873_3478 197
34 3300048915 Ga0496112_0016462 Ga0496112_0016462_5808_6425 197
35 3300049127 Ga0501306_051382 Ga0501306_051382_15_608 197
36 3300049581 Ga0501047_0238611 Ga0501047_0238611_28_636 197
37 3300049582 Ga0501048_0227683 Ga0501048_0227683_443_1057 197
38 3300049587 Ga0501071_0499341 Ga0501071_0499341_11_625 197
39 3300049592 Ga0501076_0046128 Ga0501076_0046128_409_1023 197
40 3300049741 Ga0501079_0103732 Ga0501079_0103732_747_1361 197
41 3300049742 Ga0501080_0497098 Ga0501080_0497098_12_620 197
42 3300049824 Ga0501045_0127645 Ga0501045_0127645_40_654 197
43 3300050512 nmdc:mga0n895_473421_c1 nmdc:mga0n895_473421_c1_291_884 197
44 3300050515 nmdc:mga0a205_388835_c1 nmdc:mga0a205_388835_c1_630_1235 197
45 3300001977 JGI24746J21847_1000216 JGI24746J21847_10002161 198
46 3300003203 JGI25406J46586_10000120 JGI25406J46586_1000012010 198
47 3300004798 Ga0058859_10030274 Ga0058859_100302741 198
48 3300004800 Ga0058861_11957070 Ga0058861_119570701 198
49 3300004800 Ga0058861_12046156 Ga0058861_120461561 198
50 3300004801 Ga0058860_12215279 Ga0058860_122152792 198
51 3300004803 Ga0058862_10155072 Ga0058862_101550722 198
52 3300005289 Ga0065704_10020900 Ga0065704_100209001 198
53 3300005290 Ga0065712_10161258 Ga0065712_101612581 198
54 3300005290 Ga0065712_10261948 Ga0065712_102619482 198
55 3300005293 Ga0065715_10106116 Ga0065715_101061162 198
56 3300005295 Ga0065707_10010952 Ga0065707_100109521 198
57 3300005328 Ga0070676_10358412 Ga0070676_103584121 198
58 3300005329 Ga0070683_100634198 Ga0070683_1006341981 198
59 3300005330 Ga0070690_100030459 Ga0070690_1000304593 198
60 3300005330 Ga0070690_100158349 Ga0070690_1001583492 198
61 3300005331 Ga0070670_100278490 Ga0070670_1002784902 198
62 3300005333 Ga0070677_10016002 Ga0070677_100160023 198
63 3300005333 Ga0070677_10076713 Ga0070677_100767131 198
64 3300005335 Ga0070666_10059625 Ga0070666_100596253 198
65 3300005336 Ga0070680_100046713 Ga0070680_1000467134 198
66 3300005336 Ga0070680_100297965 Ga0070680_1002979652 198
67 3300005338 Ga0068868_100006212 Ga0068868_1000062122 198
68 3300005338 Ga0068868_100020138 Ga0068868_1000201384 198
69 3300005338 Ga0068868_100093087 Ga0068868_1000930871 198
70 3300005340 Ga0070689_100968236 Ga0070689_1009682361 198
71 3300005343 Ga0070687_100400388 Ga0070687_1004003881 198
72 3300005344 Ga0070661_100984510 Ga0070661_1009845101 198
73 3300005345 Ga0070692_10047593 Ga0070692_100475931 198
74 3300005345 Ga0070692_10055062 Ga0070692_100550622 198
75 3300005345 Ga0070692_10161893 Ga0070692_101618931 198
76 3300005345 Ga0070692_10504598 Ga0070692_105045981 198
77 3300005347 Ga0070668_100113917 Ga0070668_1001139172 198
78 3300005353 Ga0070669_100007790 Ga0070669_1000077909 198
79 3300005353 Ga0070669_100015609 Ga0070669_1000156093 198
80 3300005353 Ga0070669_100110020 Ga0070669_1001100204 198
81 3300005354 Ga0070675_100004831 Ga0070675_10000483111 198
82 3300005354 Ga0070675_100062135 Ga0070675_1000621355 198
83 3300005354 Ga0070675_100164549 Ga0070675_1001645493 198
84 3300005354 Ga0070675_100387468 Ga0070675_1003874682 198
85 3300005356 Ga0070674_100056160 Ga0070674_1000561602 198
86 3300005364 Ga0070673_100024697 Ga0070673_1000246974 198
87 3300005364 Ga0070673_100262059 Ga0070673_1002620591 198
88 3300005365 Ga0070688_100347171 Ga0070688_1003471712 198
89 3300005366 Ga0070659_100141010 Ga0070659_1001410102 198
90 3300005367 Ga0070667_100016375 Ga0070667_1000163753 198
91 3300005406 Ga0070703_10041937 Ga0070703_100419371 198
92 3300005435 Ga0070714_100021670 Ga0070714_1000216704 198
93 3300005436 Ga0070713_100042507 Ga0070713_1000425072 198
94 3300005436 Ga0070713_100962033 Ga0070713_1009620332 198
95 3300005438 Ga0070701_10028489 Ga0070701_100284891 198
96 3300005438 Ga0070701_10602705 Ga0070701_106027051 198
97 3300005440 Ga0070705_100001204 Ga0070705_10000120414 198
98 3300005440 Ga0070705_100002732 Ga0070705_1000027323 198
99 3300005440 Ga0070705_100129336 Ga0070705_1001293363 198
100 3300005440 Ga0070705_100541734 Ga0070705_1005417342 198
101 3300005441 Ga0070700_100241273 Ga0070700_1002412732 198
102 3300005441 Ga0070700_100625561 Ga0070700_1006255611 198
103 3300005444 Ga0070694_100376813 Ga0070694_1003768132 198
104 3300005445 Ga0070708_100002251 Ga0070708_1000022514 198
105 3300005445 Ga0070708_100022156 Ga0070708_1000221561 198
106 3300005445 Ga0070708_100044907 Ga0070708_1000449073 198
107 3300005445 Ga0070708_100544612 Ga0070708_1005446122 198
108 3300005456 Ga0070678_100186668 Ga0070678_1001866682 198
109 3300005457 Ga0070662_100053793 Ga0070662_1000537932 198
110 3300005457 Ga0070662_100421014 Ga0070662_1004210142 198
111 3300005458 Ga0070681_10014519 Ga0070681_100145196 198
112 3300005458 Ga0070681_10034808 Ga0070681_100348083 198
113 3300005459 Ga0068867_100001191 Ga0068867_10000119120 198
114 3300005459 Ga0068867_100177437 Ga0068867_1001774372 198
115 3300005466 Ga0070685_10002440 Ga0070685_100024401 198
116 3300005466 Ga0070685_10138645 Ga0070685_101386452 198
117 3300005466 Ga0070685_10523171 Ga0070685_105231711 198
118 3300005467 Ga0070706_100003862 Ga0070706_10000386213 198
119 3300005467 Ga0070706_100009923 Ga0070706_1000099231 198
120 3300005468 Ga0070707_100000447 Ga0070707_10000044716 198
121 3300005468 Ga0070707_100065937 Ga0070707_1000659371 198
122 3300005471 Ga0070698_100072004 Ga0070698_1000720041 198
123 3300005518 Ga0070699_100024846 Ga0070699_1000248463 198
124 3300005518 Ga0070699_100089924 Ga0070699_1000899242 198
125 3300005530 Ga0070679_100144455 Ga0070679_1001444552 198
126 3300005530 Ga0070679_100161565 Ga0070679_1001615652 198
127 3300005535 Ga0070684_100049946 Ga0070684_1000499462 198
128 3300005535 Ga0070684_100239459 Ga0070684_1002394593 198
129 3300005535 Ga0070684_100325976 Ga0070684_1003259761 198
130 3300005536 Ga0070697_100009787 Ga0070697_1000097875 198
131 3300005539 Ga0068853_100599679 Ga0068853_1005996792 198
132 3300005543 Ga0070672_100414592 Ga0070672_1004145922 198
133 3300005543 Ga0070672_100480873 Ga0070672_1004808732 198
134 3300005543 Ga0070672_100711517 Ga0070672_1007115171 198
135 3300005543 Ga0070672_100783089 Ga0070672_1007830891 198
136 3300005544 Ga0070686_100136681 Ga0070686_1001366812 198
137 3300005544 Ga0070686_100394646 Ga0070686_1003946461 198
138 3300005548 Ga0070665_100304624 Ga0070665_1003046242 198
139 3300005549 Ga0070704_100000468 Ga0070704_1000004681 198
140 3300005549 Ga0070704_100107636 Ga0070704_1001076363 198
141 3300005563 Ga0068855_100055222 Ga0068855_1000552223 198
142 3300005564 Ga0070664_100002570 Ga0070664_10000257016 198
143 3300005564 Ga0070664_100073690 Ga0070664_1000736902 198
144 3300005577 Ga0068857_100011179 Ga0068857_1000111793 198
145 3300005577 Ga0068857_100028226 Ga0068857_1000282265 198
146 3300005577 Ga0068857_100044007 Ga0068857_1000440074 198
147 3300005614 Ga0068856_100088595 Ga0068856_1000885953 198
148 3300005615 Ga0070702_100361549 Ga0070702_1003615492 198
149 3300005616 Ga0068852_100192232 Ga0068852_1001922322 198
150 3300005616 Ga0068852_100516906 Ga0068852_1005169061 198
151 3300005617 Ga0068859_100003123 Ga0068859_10000312315 198
152 3300005617 Ga0068859_100016210 Ga0068859_1000162103 198
153 3300005617 Ga0068859_100085724 Ga0068859_1000857242 198
154 3300005618 Ga0068864_100029831 Ga0068864_1000298318 198
155 3300005718 Ga0068866_10083308 Ga0068866_100833083 198
156 3300005718 Ga0068866_10388751 Ga0068866_103887511 198
157 3300005719 Ga0068861_100006606 Ga0068861_1000066069 198
158 3300005840 Ga0068870_10005956 Ga0068870_100059563 198
159 3300005840 Ga0068870_10008339 Ga0068870_100083397 198
160 3300005840 Ga0068870_10051156 Ga0068870_100511565 198
161 3300005841 Ga0068863_100046713 Ga0068863_1000467133 198
162 3300005841 Ga0068863_100175662 Ga0068863_1001756624 198
163 3300005842 Ga0068858_100010752 Ga0068858_10001075212 198
164 3300005842 Ga0068858_100033151 Ga0068858_1000331513 198
165 3300005842 Ga0068858_100069115 Ga0068858_1000691154 198
166 3300005843 Ga0068860_100060319 Ga0068860_1000603193 198
167 3300005843 Ga0068860_100103370 Ga0068860_1001033705 198
168 3300005843 Ga0068860_101020577 Ga0068860_1010205771 198
169 3300005844 Ga0068862_100001812 Ga0068862_1000018128 198
170 3300005844 Ga0068862_100007478 Ga0068862_1000074788 198
171 3300005985 Ga0081539_10000024 Ga0081539_1000002445 198
172 3300006028 Ga0070717_10206905 Ga0070717_102069052 198
173 3300006237 Ga0097621_100020227 Ga0097621_1000202275 198
174 3300006237 Ga0097621_100040005 Ga0097621_1000400052 198
175 3300006237 Ga0097621_100099573 Ga0097621_1000995735 198
176 3300006358 Ga0068871_100007795 Ga0068871_1000077953 198
177 3300006358 Ga0068871_100374611 Ga0068871_1003746113 198
178 3300006844 Ga0075428_100002797 Ga0075428_1000027973 198
179 3300006844 Ga0075428_100007533 Ga0075428_1000075337 198
180 3300006844 Ga0075428_100010378 Ga0075428_1000103786 198
181 3300006844 Ga0075428_100151427 Ga0075428_1001514273 198
182 3300006844 Ga0075428_100497335 Ga0075428_1004973351 198
183 3300006846 Ga0075430_100000384 Ga0075430_1000003843 198
184 3300006846 Ga0075430_100157535 Ga0075430_1001575352 198
185 3300006846 Ga0075430_100256246 Ga0075430_1002562462 198
186 3300006847 Ga0075431_100000025 Ga0075431_10000002567 198
187 3300006847 Ga0075431_100000446 Ga0075431_1000004467 198
188 3300006847 Ga0075431_100112844 Ga0075431_1001128441 198
189 3300006847 Ga0075431_101356075 Ga0075431_1013560751 198
190 3300006852 Ga0075433_10000092 Ga0075433_1000009221 198
191 3300006852 Ga0075433_10010230 Ga0075433_100102305 198
192 3300006852 Ga0075433_10061543 Ga0075433_100615432 198
193 3300006852 Ga0075433_10079942 Ga0075433_100799424 198
194 3300006871 Ga0075434_100000213 Ga0075434_1000002135 198
195 3300006871 Ga0075434_100007624 Ga0075434_1000076242 198
196 3300006871 Ga0075434_100010392 Ga0075434_1000103923 198
197 3300006871 Ga0075434_100047614 Ga0075434_1000476142 198
198 3300006871 Ga0075434_100058709 Ga0075434_1000587092 198
199 3300006871 Ga0075434_100880446 Ga0075434_1008804462 198
200 3300006880 Ga0075429_100002752 Ga0075429_10000275216 198
201 3300006880 Ga0075429_100039293 Ga0075429_1000392932 198
202 3300006880 Ga0075429_100055967 Ga0075429_1000559673 198
203 3300006880 Ga0075429_100083988 Ga0075429_1000839882 198
204 3300006881 Ga0068865_100117490 Ga0068865_1001174902 198
205 3300006914 Ga0075436_100073423 Ga0075436_1000734232 198
206 3300006931 Ga0097620_100003123 Ga0097620_10000312315 198
207 3300006931 Ga0097620_100016210 Ga0097620_1000162103 198
208 3300006931 Ga0097620_100085731 Ga0097620_1000857312 198
209 3300007076 Ga0075435_100024154 Ga0075435_1000241542 198
210 3300007076 Ga0075435_100029781 Ga0075435_1000297813 198
211 3300007076 Ga0075435_100040357 Ga0075435_1000403572 198
212 3300007076 Ga0075435_100105049 Ga0075435_1001050493 198
213 3300009093 Ga0105240_10058200 Ga0105240_100582002 198
214 3300009093 Ga0105240_10121617 Ga0105240_101216172 198
215 3300009094 Ga0111539_10094983 Ga0111539_100949831 198
216 3300009094 Ga0111539_10832451 Ga0111539_108324512 198
217 3300009098 Ga0105245_10878320 Ga0105245_108783201 198
218 3300009147 Ga0114129_10000461 Ga0114129_1000046116 198
219 3300009147 Ga0114129_10017499 Ga0114129_100174995 198
220 3300009147 Ga0114129_10153110 Ga0114129_101531102 198
221 3300009148 Ga0105243_10097292 Ga0105243_100972923 198
222 3300009545 Ga0105237_10030909 Ga0105237_100309093 198
223 3300009553 Ga0105249_10088587 Ga0105249_100885872 198
224 3300009553 Ga0105249_10565812 Ga0105249_105658122 198
225 3300009553 Ga0105249_10923646 Ga0105249_109236461 198
226 3300010375 Ga0105239_10718183 Ga0105239_107181832 198
227 3300011119 Ga0105246_10077107 Ga0105246_100771073 198
228 3300013100 Ga0157373_10124779 Ga0157373_101247792 198
229 3300013102 Ga0157371_10081633 Ga0157371_100816332 198
230 3300013105 Ga0157369_10098933 Ga0157369_100989332 198
231 3300013296 Ga0157374_10041885 Ga0157374_100418852 198
232 3300013296 Ga0157374_10340077 Ga0157374_103400771 198
233 3300013297 Ga0157378_10647777 Ga0157378_106477771 198
234 3300013297 Ga0157378_11637071 Ga0157378_116370711 198
235 3300013306 Ga0163162_10067850 Ga0163162_100678501 198
236 3300013306 Ga0163162_10553897 Ga0163162_105538972 198
237 3300013307 Ga0157372_10030010 Ga0157372_100300102 198
238 3300013308 Ga0157375_10030216 Ga0157375_100302166 198
239 3300013308 Ga0157375_10575339 Ga0157375_105753391 198
240 3300013308 Ga0157375_11162767 Ga0157375_111627672 198
241 3300014326 Ga0157380_10023560 Ga0157380_100235603 198
242 3300014326 Ga0157380_10118746 Ga0157380_101187461 198
243 3300014745 Ga0157377_10042275 Ga0157377_100422752 198
244 3300014745 Ga0157377_10103753 Ga0157377_101037534 198
245 3300014968 Ga0157379_10165987 Ga0157379_101659872 198
246 3300014968 Ga0157379_10282841 Ga0157379_102828412 198
247 3300014969 Ga0157376_10062103 Ga0157376_100621033 198
248 3300014969 Ga0157376_10149047 Ga0157376_101490472 198
249 3300014969 Ga0157376_10520762 Ga0157376_105207622 198
250 3300017792 Ga0163161_10020346 Ga0163161_100203463 198
251 3300017792 Ga0163161_10024787 Ga0163161_100247872 198
252 3300020069 Ga0197907_10950682 Ga0197907_109506821 198
253 3300020069 Ga0197907_11170075 Ga0197907_111700751 198
254 3300020070 Ga0206356_11200219 Ga0206356_112002191 198
255 3300020075 Ga0206349_1215835 Ga0206349_12158351 198
256 3300020077 Ga0206351_10260081 Ga0206351_102600811 198
257 3300020077 Ga0206351_10493687 Ga0206351_104936871 198
258 3300020078 Ga0206352_10131148 Ga0206352_101311481 198
259 3300020078 Ga0206352_10682467 Ga0206352_106824671 198
260 3300020080 Ga0206350_10195639 Ga0206350_101956391 198
261 3300020080 Ga0206350_11315453 Ga0206350_113154533 198
262 3300020081 Ga0206354_10876827 Ga0206354_108768271 198
263 3300020610 Ga0154015_1681081 Ga0154015_16810811 198
264 3300022467 Ga0224712_10123682 Ga0224712_101236821 198
265 3300025290 Ga0207673_1032224 Ga0207673_10322241 198
266 3300025315 Ga0207697_10000959 Ga0207697_100009595 198
267 3300025315 Ga0207697_10018716 Ga0207697_100187161 198
268 3300025315 Ga0207697_10197718 Ga0207697_101977182 198
269 3300025321 Ga0207656_10375157 Ga0207656_103751571 198
270 3300025885 Ga0207653_10028854 Ga0207653_100288542 198
271 3300025893 Ga0207682_10000173 Ga0207682_1000017328 198
272 3300025901 Ga0207688_10001170 Ga0207688_100011703 198
273 3300025901 Ga0207688_10473593 Ga0207688_104735931 198
274 3300025904 Ga0207647_10051885 Ga0207647_100518853 198
275 3300025907 Ga0207645_10003604 Ga0207645_100036041 198
276 3300025908 Ga0207643_10001758 Ga0207643_1000175811 198
277 3300025908 Ga0207643_10021644 Ga0207643_100216442 198
278 3300025909 Ga0207705_10101735 Ga0207705_101017352 198
279 3300025909 Ga0207705_10424125 Ga0207705_104241251 198
280 3300025910 Ga0207684_10033466 Ga0207684_100334664 198
281 3300025910 Ga0207684_10112876 Ga0207684_101128761 198
282 3300025910 Ga0207684_10391151 Ga0207684_103911511 198
283 3300025912 Ga0207707_10059076 Ga0207707_100590762 198
284 3300025913 Ga0207695_10100410 Ga0207695_101004102 198
285 3300025914 Ga0207671_10086390 Ga0207671_100863902 198
286 3300025915 Ga0207693_10413189 Ga0207693_104131892 198
287 3300025917 Ga0207660_10048187 Ga0207660_100481872 198
288 3300025917 Ga0207660_10078497 Ga0207660_100784972 198
289 3300025918 Ga0207662_10075383 Ga0207662_100753832 198
290 3300025919 Ga0207657_10104031 Ga0207657_101040314 198
291 3300025919 Ga0207657_10588249 Ga0207657_105882492 198
292 3300025920 Ga0207649_10040005 Ga0207649_100400052 198
293 3300025922 Ga0207646_10065975 Ga0207646_100659751 198
294 3300025922 Ga0207646_10236117 Ga0207646_102361173 198
295 3300025923 Ga0207681_10005920 Ga0207681_100059208 198
296 3300025923 Ga0207681_10063970 Ga0207681_100639702 198
297 3300025925 Ga0207650_10175316 Ga0207650_101753162 198
298 3300025926 Ga0207659_10000165 Ga0207659_1000016519 198
299 3300025926 Ga0207659_10314803 Ga0207659_103148031 198
300 3300025926 Ga0207659_10367311 Ga0207659_103673111 198
301 3300025926 Ga0207659_10466453 Ga0207659_104664532 198
302 3300025928 Ga0207700_10184847 Ga0207700_101848472 198
303 3300025932 Ga0207690_10120576 Ga0207690_101205761 198
304 3300025933 Ga0207706_10036439 Ga0207706_100364392 198
305 3300025934 Ga0207686_10656616 Ga0207686_106566162 198
306 3300025935 Ga0207709_10093359 Ga0207709_100933592 198
307 3300025936 Ga0207670_10023096 Ga0207670_100230965 198
308 3300025936 Ga0207670_10191703 Ga0207670_101917031 198
309 3300025940 Ga0207691_10004294 Ga0207691_1000429417 198
310 3300025940 Ga0207691_10021429 Ga0207691_100214295 198
311 3300025940 Ga0207691_10470051 Ga0207691_104700511 198
312 3300025940 Ga0207691_11134307 Ga0207691_111343071 198
313 3300025941 Ga0207711_10060622 Ga0207711_100606223 198
314 3300025941 Ga0207711_10688773 Ga0207711_106887731 198
315 3300025942 Ga0207689_10004521 Ga0207689_100045212 198
316 3300025942 Ga0207689_10090553 Ga0207689_100905533 198
317 3300025944 Ga0207661_10954670 Ga0207661_109546701 198
318 3300025945 Ga0207679_10043838 Ga0207679_100438385 198
319 3300025945 Ga0207679_10906758 Ga0207679_109067581 198
320 3300025949 Ga0207667_10001891 Ga0207667_1000189118 198
321 3300025960 Ga0207651_10145023 Ga0207651_101450232 198
322 3300025960 Ga0207651_10655940 Ga0207651_106559402 198
323 3300025961 Ga0207712_10086277 Ga0207712_100862772 198
324 3300025961 Ga0207712_10254390 Ga0207712_102543902 198
325 3300025961 Ga0207712_10782034 Ga0207712_107820341 198
326 3300025961 Ga0207712_10905121 Ga0207712_109051212 198
327 3300025972 Ga0207668_10317059 Ga0207668_103170592 198
328 3300025972 Ga0207668_10632457 Ga0207668_106324571 198
329 3300025981 Ga0207640_10230292 Ga0207640_102302922 198
330 3300025986 Ga0207658_10054642 Ga0207658_100546423 198
331 3300025986 Ga0207658_11038529 Ga0207658_110385291 198
332 3300026035 Ga0207703_10051336 Ga0207703_100513363 198
333 3300026041 Ga0207639_10569054 Ga0207639_105690542 198
334 3300026067 Ga0207678_10064827 Ga0207678_100648273 198
335 3300026067 Ga0207678_11098847 Ga0207678_110988471 198
336 3300026075 Ga0207708_10068107 Ga0207708_100681071 198
337 3300026075 Ga0207708_10118497 Ga0207708_101184972 198
338 3300026075 Ga0207708_10208410 Ga0207708_102084101 198
339 3300026075 Ga0207708_10820983 Ga0207708_108209831 198
340 3300026078 Ga0207702_10424481 Ga0207702_104244812 198
341 3300026088 Ga0207641_11237816 Ga0207641_112378161 198
342 3300026089 Ga0207648_10001042 Ga0207648_1000104213 198
343 3300026089 Ga0207648_10029082 Ga0207648_100290825 198
344 3300026095 Ga0207676_10004165 Ga0207676_100041659 198
345 3300026095 Ga0207676_10155110 Ga0207676_101551102 198
346 3300026095 Ga0207676_10185365 Ga0207676_101853652 198
347 3300026116 Ga0207674_10023343 Ga0207674_100233431 198
348 3300026116 Ga0207674_10081445 Ga0207674_100814452 198
349 3300026118 Ga0207675_100004553 Ga0207675_10000455316 198
350 3300026118 Ga0207675_100515198 Ga0207675_1005151981 198
351 3300026118 Ga0207675_101390570 Ga0207675_1013905701 198
352 3300026121 Ga0207683_10019186 Ga0207683_100191869 198
353 3300026121 Ga0207683_10067440 Ga0207683_100674402 198
354 3300026142 Ga0207698_10724604 Ga0207698_107246041 198
355 3300027682 Ga0209971_1029207 Ga0209971_10292072 198
356 3300027907 Ga0207428_10145852 Ga0207428_101458522 198
357 3300028379 Ga0268266_10194341 Ga0268266_101943412 198
358 3300028380 Ga0268265_10002966 Ga0268265_100029669 198
359 3300028380 Ga0268265_10089309 Ga0268265_100893092 198
360 3300028380 Ga0268265_10286681 Ga0268265_102866812 198
361 3300028381 Ga0268264_10009056 Ga0268264_100090568 198
362 3300028666 Ga0265336_10010883 Ga0265336_100108831 198
363 3300028800 Ga0265338_10015272 Ga0265338_100152724 198
364 3300028800 Ga0265338_10230579 Ga0265338_102305792 198
365 3300029957 Ga0265324_10127122 Ga0265324_101271221 198
366 3300031235 Ga0265330_10000447 Ga0265330_1000044725 198
367 3300031239 Ga0265328_10011675 Ga0265328_100116752 198
368 3300031239 Ga0265328_10063819 Ga0265328_100638192 198
369 3300031241 Ga0265325_10000222 Ga0265325_1000022218 198
370 3300031241 Ga0265325_10060268 Ga0265325_100602683 198
371 3300031247 Ga0265340_10123451 Ga0265340_101234511 198
372 3300031249 Ga0265339_10000361 Ga0265339_1000036131 198
373 3300031249 Ga0265339_10013739 Ga0265339_100137393 198
374 3300031344 Ga0265316_10000095 Ga0265316_1000009536 198
375 3300031344 Ga0265316_10003149 Ga0265316_1000314912 198
376 3300031548 Ga0307408_100543497 Ga0307408_1005434971 198
377 3300031595 Ga0265313_10012495 Ga0265313_100124954 198
378 3300031711 Ga0265314_10007446 Ga0265314_100074464 198
379 3300031712 Ga0265342_10004593 Ga0265342_100045938 198
380 3300031712 Ga0265342_10009265 Ga0265342_100092655 198
381 3300031712 Ga0265342_10061930 Ga0265342_100619301 198
382 3300031731 Ga0307405_10193884 Ga0307405_101938842 198
383 3300031731 Ga0307405_10498747 Ga0307405_104987472 198
384 3300031852 Ga0307410_10350653 Ga0307410_103506532 198
385 3300031901 Ga0307406_10001596 Ga0307406_1000159615 198
386 3300031995 Ga0307409_100137980 Ga0307409_1001379801 198
387 3300031995 Ga0307409_100694123 Ga0307409_1006941232 198
388 3300032002 Ga0307416_100005889 Ga0307416_1000058892 198
389 3300032002 Ga0307416_101061352 Ga0307416_1010613521 198
390 3300032004 Ga0307414_10000042 Ga0307414_1000004260 198
391 3300033541 Ga0316596_1042450 Ga0316596_10424501 198
392 3300035090 Ga0373949_0023253 Ga0373949_0023253_65_661 198
393 3300035115 Ga0373941_0197796 Ga0373941_0197796_25_621 198
394 3300035242 Ga0373962_0071298 Ga0373962_0071298_413_1009 198
395 3300035724 Ga0373933_0077014 Ga0373933_0077014_1106_1729 198
396 3300037418 Ga0395900_1164744 Ga0395900_1164744_49_669 198
397 3300038443 Ga0395901_0217116 Ga0395901_0217116_961_1584 198
398 3300038996 Ga0242420_079978 Ga0242420_079978_48_644 198
399 3300042876 Ga0451577_0813272 Ga0451577_0813272_64_660 198
400 3300044656 Ga0466969_0083452 Ga0466969_0083452_17_634 198
401 3300044673 Ga0453683_0168786 Ga0453683_0168786_305_901 198
402 3300044693 Ga0466961_0026859 Ga0466961_0026859_722_1339 198
403 3300044712 Ga0453684_0488645 Ga0453684_0488645_189_797 198
404 3300045051 Ga0451576_0023428 Ga0451576_0023428_5457_6053 198
405 3300045051 Ga0451576_0075374 Ga0451576_0075374_897_1493 198
406 3300045051 Ga0451576_0106969 Ga0451576_0106969_479_1075 198
407 3300045051 Ga0451576_0177265 Ga0451576_0177265_1022_1618 198
408 3300045051 Ga0451576_0508034 Ga0451576_0508034_173_769 198
409 3300046472 Ga0495580_0524183 Ga0495580_0524183_121_717 198
410 3300046491 Ga0495584_0255038 Ga0495584_0255038_153_749 198
411 3300046523 Ga0495644_0080078 Ga0495644_0080078_530_1126 198
412 3300046535 Ga0495586_0427866 Ga0495586_0427866_18_614 198
413 3300046543 Ga0495645_0219472 Ga0495645_0219472_485_1108 198
414 3300046674 Ga0495588_0016972 Ga0495588_0016972_2703_3299 198
415 3300046684 Ga0495669_0017695 Ga0495669_0017695_2125_2721 198
416 3300047321 Ga0495676_0311774 Ga0495676_0311774_301_897 198
417 3300047471 Ga0495684_0099230 Ga0495684_0099230_61_663 198
418 3300048903 Ga0496100_0191583 Ga0496100_0191583_28_630 198
419 3300048907 Ga0496104_0002686 Ga0496104_0002686_862_1464 198
420 3300048907 Ga0496104_0052273 Ga0496104_0052273_3010_3633 198
421 3300048909 Ga0496106_0887670 Ga0496106_0887670_36_632 198
422 3300048909 Ga0496106_0950480 Ga0496106_0950480_32_634 198
423 3300048912 Ga0496109_0221800 Ga0496109_0221800_33_635 198
424 3300048916 Ga0496113_0702312 Ga0496113_0702312_159_755 198
425 3300048917 Ga0496114_0004205 Ga0496114_0004205_7147_7749 198
426 3300049521 Ga0501298_062684 Ga0501298_062684_57_653 198
427 3300049571 Ga0501034_0242294 Ga0501034_0242294_50_658 198
428 3300049573 Ga0501037_0272522 Ga0501037_0272522_23_631 198
429 3300049582 Ga0501048_0740658 Ga0501048_0740658_58_654 198
430 3300049588 Ga0501072_0789541 Ga0501072_0789541_26_625 198
431 3300049592 Ga0501076_0477539 Ga0501076_0477539_63_659 198
432 3300049652 Ga0501202_061905 Ga0501202_061905_165_761 198
433 3300049665 Ga0501227_001649 Ga0501227_001649_1584_2309 198
434 3300049705 Ga0501225_0100404 Ga0501225_0100404_122_718 198
435 3300049742 Ga0501080_0044229 Ga0501080_0044229_2929_3531 198
436 3300049779 Ga0501283_047761 Ga0501283_047761_53_649 198
437 3300049822 Ga0501035_0090084 Ga0501035_0090084_408_1016 198
438 3300050507 nmdc:mga05p37_1341998_c1 nmdc:mga05p37_1341998_c1_50_679 198
439 3300050507 nmdc:mga05p37_149527_c1 nmdc:mga05p37_149527_c1_1718_2317 198
440 3300050507 nmdc:mga05p37_158466_c1 nmdc:mga05p37_158466_c1_428_1024 198
441 3300050507 nmdc:mga05p37_20002_c1 nmdc:mga05p37_20002_c1_1933_2529 198
442 3300050507 nmdc:mga05p37_2124_c1 nmdc:mga05p37_2124_c1_10876_11484 198
443 3300050507 nmdc:mga05p37_405368_c1 nmdc:mga05p37_405368_c1_849_1445 198
444 3300050507 nmdc:mga05p37_623304_c1 nmdc:mga05p37_623304_c1_569_1165 198
445 3300050508 nmdc:mga09592_13257_c1 nmdc:mga09592_13257_c1_5671_6267 198
446 3300050508 nmdc:mga09592_234747_c1 nmdc:mga09592_234747_c1_70_669 198
447 3300050508 nmdc:mga09592_34636_c1 nmdc:mga09592_34636_c1_2081_2689 198
448 3300050508 nmdc:mga09592_58617_c1 nmdc:mga09592_58617_c1_674_1285 198
449 3300050508 nmdc:mga09592_730136_c1 nmdc:mga09592_730136_c1_81_677 198
450 3300050508 nmdc:mga09592_7954_c2 nmdc:mga09592_7954_c2_257_853 198
451 3300050509 nmdc:mga0qj67_47630_c1 nmdc:mga0qj67_47630_c1_1574_2185 198
452 3300050509 nmdc:mga0qj67_5744_c1 nmdc:mga0qj67_5744_c1_3192_3788 198
453 3300050510 nmdc:mga06r32_41776_c1 nmdc:mga06r32_41776_c1_1228_1839 198
454 3300050510 nmdc:mga06r32_6330_c1 nmdc:mga06r32_6330_c1_8021_8617 198
455 3300050510 nmdc:mga06r32_82180_c1 nmdc:mga06r32_82180_c1_1148_1744 198
456 3300050511 nmdc:mga08y16_156071_c1 nmdc:mga08y16_156071_c1_1521_2117 198
457 3300050511 nmdc:mga08y16_17846_c1 nmdc:mga08y16_17846_c1_4410_5006 198
458 3300050512 nmdc:mga0n895_114427_c1 nmdc:mga0n895_114427_c1_1582_2178 198
459 3300050512 nmdc:mga0n895_117414_c1 nmdc:mga0n895_117414_c1_1257_1853 198
460 3300050512 nmdc:mga0n895_182862_c1 nmdc:mga0n895_182862_c1_362_970 198
461 3300050512 nmdc:mga0n895_251025_c1 nmdc:mga0n895_251025_c1_1158_1754 198
462 3300050512 nmdc:mga0n895_33127_c1 nmdc:mga0n895_33127_c1_4161_4757 198
463 3300050512 nmdc:mga0n895_420_c1 nmdc:mga0n895_420_c1_2493_3089 198
464 3300050513 nmdc:mga0rr50_362088_c1 nmdc:mga0rr50_362088_c1_142_738 198
465 3300050513 nmdc:mga0rr50_4121_c1 nmdc:mga0rr50_4121_c1_774_1370 198
466 3300050513 nmdc:mga0rr50_88079_c1 nmdc:mga0rr50_88079_c1_227_823 198
467 3300050513 nmdc:mga0rr50_93881_c1 nmdc:mga0rr50_93881_c1_208_804 198
468 3300050515 nmdc:mga0a205_119_c1 nmdc:mga0a205_119_c1_24712_25308 198
469 3300050515 nmdc:mga0a205_145964_c1 nmdc:mga0a205_145964_c1_74_682 198
470 3300050515 nmdc:mga0a205_27101_c1 nmdc:mga0a205_27101_c1_832_1431 198
471 3300050515 nmdc:mga0a205_8171_c1 nmdc:mga0a205_8171_c1_2322_2918 198
472 3300050515 nmdc:mga0a205_9811_c1 nmdc:mga0a205_9811_c1_1979_2575 198
473 3300053077 Ga0495601_0005533 Ga0495601_0005533_3641_4243 198
474 3300053092 Ga0500583_0195535 Ga0500583_0195535_206_808 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

34

123

0.93

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

131

238

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9774 3 196
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.9745 2 196
2rcv-assembly2.cif.gz_H crystal structure of the bacillus subtilis superoxide dismutase 0.9725 2 196
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.9715 2 196
1xre-assembly1.cif.gz_B crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution. 0.9713 3 196
ID Description Score Start End Superfamily
1xuqA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.999 20 90 1.10.287.990
1xuqB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9981 20 90 1.10.287.990
1d5nA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.991 20 87 1.10.287.990
1en5A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9904 20 87 1.10.287.990
1i08A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.989 20 87 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A829RAZ9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9983 1 87 GO:0004784
GO:0005737
GO:0046872
AF-A0A376TQ19-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9934 1 87 GO:0004784
GO:0005737
GO:0046872
AF-A0A2V9MT98-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9927 1 122 GO:0004784
GO:0005737
GO:0046872
AF-A0A3D4FXU5-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9914 1 154 GO:0004784
GO:0005737
GO:0046872
AF-A0A3M0Z9H9-F1-model_v4 deleted 0.9908 1 135

Feature Viewer

pLDDT pTM Quality
94.78 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map