F451159

General Info

Members Datasets Scaffolds Average Seq Length
474 289 948 231

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100232765|Ga0068871_1002327652
Length 263
Sequence MRCGLVTQKVGMTRVFNDAGEHVPVTVLKVDQLQVVAVRSEEKDKYTAVQLGYGKAKVKNVTQPMRGHFAKAKVEPKKKLVEFRVAKDAVLEVGAELVPSHFVPGQFVDVVGTTIGRGFTGSMVRWNFHGLEASHGVSVSHRSHGSTGNRQDPGRVFKNKKMAGHMGARNRTQQNLEIVRTDPIRGLLFIKGSVPGHKGAWLTVSDAIKLPRPDGAPYPAGIVEEMKQDEVHVPEAGLVDDAAVHEIPALPSDEEVAAIESKE

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
266 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
283 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
284 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
285 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
286 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
287 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
288 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
289 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 4.85
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.49
Nodule 0
Rhizoplane 1.9
Rhizosphere 84.18
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100232765 3300006358 Bacteria 1599
2 SwRhRL2b_contig_905627 2162886007 Bacteria 1321
3 JGI25153J46596_10005735 3300003215 Bacteria 6472
4 Ga0055531_10032078 3300003794 Bacteria 1724
5 Ga0058862_10155732 3300004803 Bacteria 1336
6 Ga0065704_10007805 3300005289 Bacteria 2508
7 Ga0065704_10176472 3300005289 Bacteria 1261
8 Ga0070676_10064097 3300005328 Bacteria 2190
9 Ga0070677_10203649 3300005333 Bacteria 956
10 Ga0070680_100003273 3300005336 Bacteria 12075
11 Ga0070680_100308840 3300005336 Bacteria 1341
12 Ga0070682_100313541 3300005337 Bacteria 1155
13 Ga0068868_100584472 3300005338 Bacteria 988
14 Ga0070691_10030152 3300005341 Bacteria 2540
15 Ga0070661_100118593 3300005344 Bacteria 1980
16 Ga0070692_10262455 3300005345 Bacteria 1039
17 Ga0070669_100284957 3300005353 Bacteria 1325
18 Ga0070671_100385754 3300005355 Bacteria 1198
19 Ga0070674_100001266 3300005356 Bacteria 13294
20 Ga0070673_100245181 3300005364 Bacteria 1559
21 Ga0070673_100554272 3300005364 Bacteria 1044
22 Ga0070673_100937575 3300005364 Bacteria 804
23 Ga0070659_100041891 3300005366 Bacteria 3580
24 Ga0070659_100151129 3300005366 Bacteria 1894
25 Ga0070667_100060883 3300005367 Bacteria 3195
26 Ga0070714_100029929 3300005435 Bacteria 4530
27 Ga0070713_100001675 3300005436 Bacteria 14235
28 Ga0070710_10038584 3300005437 Bacteria 2624
29 Ga0070711_100105248 3300005439 Bacteria 2060
30 Ga0070708_100185094 3300005445 Bacteria 1947
31 Ga0070708_100312334 3300005445 Bacteria 1481
32 Ga0070708_100360902 3300005445 Bacteria 1369
33 Ga0070681_10002038 3300005458 Bacteria 18312
34 Ga0070681_10096314 3300005458 Bacteria 2907
35 Ga0070681_10171751 3300005458 Bacteria 2089
36 Ga0070681_10716525 3300005458 Bacteria 917
37 Ga0068867_100669242 3300005459 Bacteria 913
38 Ga0070706_100100968 3300005467 Bacteria 2681
39 Ga0070698_100149346 3300005471 Bacteria 2285
40 Ga0070698_100249504 3300005471 Bacteria 1708
41 Ga0070698_100415225 3300005471 Bacteria 1280
42 Ga0070699_100430026 3300005518 Bacteria 1196
43 Ga0070699_100451517 3300005518 Bacteria 1165
44 Ga0070679_100201602 3300005530 Bacteria 1955
45 Ga0070679_100365374 3300005530 Bacteria 1390
46 Ga0070679_100581501 3300005530 Bacteria 1063
47 Ga0070684_100935303 3300005535 Bacteria 813
48 Ga0070697_100182351 3300005536 Bacteria 1780
49 Ga0068853_100426178 3300005539 Bacteria 1245
50 Ga0070686_100474007 3300005544 Bacteria 967
51 Ga0070695_100265182 3300005545 Bacteria 1256
52 Ga0070696_100019133 3300005546 Bacteria 4636
53 Ga0070696_100379229 3300005546 Bacteria 1102
54 Ga0070696_100604355 3300005546 Bacteria 885
55 Ga0070704_100240048 3300005549 Bacteria 1482
56 Ga0068855_100211415 3300005563 Bacteria 2179
57 Ga0070664_100315784 3300005564 Bacteria 1415
58 Ga0068857_100248544 3300005577 Bacteria 1630
59 Ga0068857_100298669 3300005577 Bacteria 1484
60 Ga0068857_100382800 3300005577 Bacteria 1307
61 Ga0068854_100146052 3300005578 Bacteria 1819
62 Ga0068856_100134295 3300005614 Bacteria 2480
63 Ga0068856_100787744 3300005614 Bacteria 970
64 Ga0068856_100874025 3300005614 Bacteria 918
65 Ga0068859_100279658 3300005617 Bacteria 1761
66 Ga0068851_10086833 3300005834 Bacteria 1642
67 Ga0068863_100269964 3300005841 Bacteria 1646
68 Ga0068863_100434694 3300005841 Bacteria 1287
69 Ga0068860_100310298 3300005843 Bacteria 1547
70 Ga0068862_100215246 3300005844 Bacteria 1737
71 Ga0081455_10005717 3300005937 Bacteria 13557
72 Ga0081455_10017522 3300005937 Bacteria 6863
73 Ga0081455_10183560 3300005937 Bacteria 1582
74 Ga0081538_10005857 3300005981 Bacteria 10947
75 Ga0081540_1039708 3300005983 Bacteria 2464
76 Ga0081540_1049568 3300005983 Bacteria 2094
77 Ga0081539_10009089 3300005985 Bacteria 8416
78 Ga0081539_10011464 3300005985 Bacteria 7000
79 Ga0081539_10020334 3300005985 Bacteria 4493
80 Ga0075365_10115399 3300006038 Bacteria 1848
81 Ga0075365_10383598 3300006038 Bacteria 991
82 Ga0070712_100004619 3300006175 Bacteria 8513
83 Ga0070712_100324522 3300006175 Bacteria 1253
84 Ga0075362_10132403 3300006177 Bacteria 1187
85 Ga0075362_10144775 3300006177 Bacteria 1137
86 Ga0075367_10105959 3300006178 Bacteria 1722
87 Ga0075366_10029773 3300006195 Bacteria 3208
88 Ga0075366_10100604 3300006195 Bacteria 1735
89 Ga0075366_10173331 3300006195 Bacteria 1309
90 Ga0097621_100504252 3300006237 Bacteria 1096
91 Ga0075370_10087267 3300006353 Bacteria 1797
92 Ga0075428_100956256 3300006844 Bacteria 907
93 Ga0097620_100279651 3300006931 Bacteria 1761
94 Ga0097620_100543496 3300006931 Bacteria 1256
95 Ga0105240_10058879 3300009093 Bacteria 4795
96 Ga0111539_10028606 3300009094 Bacteria 6798
97 Ga0105247_10313053 3300009101 Bacteria 1093
98 Ga0114129_10001848 3300009147 Bacteria 28835
99 Ga0105243_10585857 3300009148 Bacteria 1071
100 Ga0105241_10372873 3300009174 Bacteria 1245
101 Ga0105238_10558070 3300009551 Bacteria 1150
102 Ga0105035_108311 3300009988 Bacteria 885
103 Ga0105246_10811892 3300011119 Bacteria 831
104 Ga0157371_10173637 3300013102 Bacteria 1540
105 Ga0157370_10309426 3300013104 Bacteria 1458
106 Ga0157369_10098486 3300013105 Bacteria 3118
107 Ga0157374_10364726 3300013296 Bacteria 1437
108 Ga0157378_10259995 3300013297 Bacteria 1665
109 Ga0157372_10300287 3300013307 Bacteria 1868
110 Ga0157375_10471430 3300013308 Bacteria 1421
111 Ga0157375_11325068 3300013308 Bacteria 847
112 Ga0163163_11056586 3300014325 Bacteria 875
113 Ga0182008_10078721 3300014497 Bacteria 1621
114 Ga0182008_10199387 3300014497 Bacteria 1018
115 Ga0157379_10219559 3300014968 Bacteria 1722
116 Ga0157379_10623458 3300014968 Bacteria 1008
117 Ga0197907_10090218 3300020069 Bacteria 1193
118 Ga0206356_10456507 3300020070 Bacteria 1600
119 Ga0206352_10669964 3300020078 Bacteria 988
120 Ga0206354_10971686 3300020081 Bacteria 1113
121 Ga0206354_11665287 3300020081 Bacteria 1136
122 Ga0213874_10002149 3300021377 Bacteria 4185
123 Ga0213876_10019675 3300021384 Bacteria 3565
124 Ga0213871_10006751 3300021441 Bacteria 2444
125 Ga0224712_10012105 3300022467 Bacteria 2701
126 Ga0209758_1008670 3300025297 Bacteria 6524
127 Ga0209758_1064016 3300025297 Bacteria 1194
128 Ga0207426_1020842 3300025302 Bacteria 2273
129 Ga0207426_1025237 3300025302 Bacteria 2004
130 Ga0209257_1013331 3300025304 Bacteria 3670
131 Ga0207682_10048586 3300025893 Bacteria 1749
132 Ga0207692_10088448 3300025898 Bacteria 1674
133 Ga0207699_10133226 3300025906 Bacteria 1624
134 Ga0207645_10033128 3300025907 Bacteria 3320
135 Ga0207643_10065228 3300025908 Bacteria 2085
136 Ga0207705_10268134 3300025909 Bacteria 1305
137 Ga0207707_10002798 3300025912 Bacteria 15559
138 Ga0207707_10276284 3300025912 Bacteria 1455
139 Ga0207695_10049522 3300025913 Bacteria 4427
140 Ga0207695_10481645 3300025913 Bacteria 1123
141 Ga0207693_10029783 3300025915 Bacteria 4309
142 Ga0207693_10118665 3300025915 Bacteria 2077
143 Ga0207693_10127226 3300025915 Bacteria 2003
144 Ga0207663_10541153 3300025916 Bacteria 909
145 Ga0207660_10002381 3300025917 Bacteria 12363
146 Ga0207662_10033556 3300025918 Bacteria 2992
147 Ga0207662_10372781 3300025918 Bacteria 963
148 Ga0207657_10027330 3300025919 Bacteria 5227
149 Ga0207657_10261710 3300025919 Bacteria 1376
150 Ga0207652_10226625 3300025921 Bacteria 1684
151 Ga0207646_10091324 3300025922 Bacteria 2725
152 Ga0207681_10093699 3300025923 Bacteria 2150
153 Ga0207694_10101379 3300025924 Bacteria 2281
154 Ga0207650_10185525 3300025925 Bacteria 1659
155 Ga0207664_10075173 3300025929 Bacteria 2731
156 Ga0207664_10306786 3300025929 Bacteria 1398
157 Ga0207690_10095478 3300025932 Bacteria 2112
158 Ga0207706_10172363 3300025933 Bacteria 1901
159 Ga0207669_10027625 3300025937 Bacteria 3110
160 Ga0207665_10099455 3300025939 Bacteria 2029
161 Ga0207665_10129181 3300025939 Bacteria 1792
162 Ga0207665_10236708 3300025939 Bacteria 1344
163 Ga0207689_10115687 3300025942 Bacteria 2205
164 Ga0207679_10032394 3300025945 Bacteria 3668
165 Ga0207667_10014133 3300025949 Bacteria 9112
166 Ga0207667_10197616 3300025949 Bacteria 2063
167 Ga0207667_10377019 3300025949 Bacteria 1445
168 Ga0207667_10441735 3300025949 Bacteria 1323
169 Ga0207667_10920529 3300025949 Bacteria 865
170 Ga0207712_10113284 3300025961 Bacteria 2038
171 Ga0207668_10538451 3300025972 Bacteria 1010
172 Ga0207640_10098356 3300025981 Bacteria 2045
173 Ga0207658_10125657 3300025986 Bacteria 2052
174 Ga0207703_10353994 3300026035 Bacteria 1353
175 Ga0207639_10082418 3300026041 Bacteria 2550
176 Ga0207678_10204225 3300026067 Bacteria 1690
177 Ga0207708_10534532 3300026075 Bacteria 987
178 Ga0207702_10008176 3300026078 Bacteria 8844
179 Ga0207702_10040172 3300026078 Bacteria 3922
180 Ga0207702_10339525 3300026078 Bacteria 1435
181 Ga0207641_10296893 3300026088 Bacteria 1525
182 Ga0207648_10434257 3300026089 Bacteria 1194
183 Ga0207674_10028025 3300026116 Bacteria 5952
184 Ga0207674_10053258 3300026116 Bacteria 4125
185 Ga0207674_10088619 3300026116 Bacteria 3087
186 Ga0207674_10315435 3300026116 Bacteria 1513
187 Ga0207675_100264342 3300026118 Bacteria 1668
188 Ga0207675_100472688 3300026118 Bacteria 1245
189 Ga0209588_1093219 3300027671 Bacteria 970
190 Ga0207428_10000169 3300027907 Bacteria 90667
191 Ga0268265_10171349 3300028380 Bacteria 1855
192 Ga0268265_10299404 3300028380 Bacteria 1447
193 Ga0265337_1053641 3300028556 Bacteria 1129
194 Ga0265318_10053941 3300028577 Bacteria 1507
195 Ga0307517_10071865 3300028786 Bacteria 3094
196 Ga0265332_10058110 3300031238 Bacteria 1656
197 Ga0265331_10021110 3300031250 Bacteria 3336
198 Ga0265331_10096986 3300031250 Bacteria 1359
199 Ga0265327_10032604 3300031251 Bacteria 2914
200 Ga0265316_10450469 3300031344 Bacteria 923
201 Ga0307513_10236635 3300031456 Bacteria 1635
202 Ga0307516_10242604 3300031730 Bacteria 1500
203 Ga0307516_10392398 3300031730 Bacteria 1048
204 Ga0307407_10183757 3300031903 Bacteria 1388
205 Ga0307412_10206316 3300031911 Bacteria 1496
206 Ga0307409_100140206 3300031995 Bacteria 2082
207 Ga0307409_100396248 3300031995 Bacteria 1317
208 Ga0307416_100073626 3300032002 Bacteria 2849
209 Ga0307510_10162642 3300033180 Bacteria 1826
210 Ga0373938_0050284 3300034957 Bacteria 951
211 Ga0373926_0072372 3300035083 Bacteria 1268
212 Ga0373923_0147068 3300035111 Bacteria 1068
213 Ga0373936_0071444 3300035113 Bacteria 1431
214 Ga0373936_0087705 3300035113 Bacteria 1302
215 Ga0373953_0004557 3300035117 Bacteria 4422
216 Ga0373954_0040905 3300035118 Bacteria 2160
217 Ga0373957_0007801 3300035120 Bacteria 3439
218 Ga0373943_0211082 3300035170 Bacteria 1078
219 Ga0373942_0021852 3300035207 Bacteria 1618
220 Ga0373924_0011533 3300035410 Bacteria 3285
221 Ga0373924_0049234 3300035410 Bacteria 1743
222 Ga0373931_0022466 3300035691 Bacteria 3175
223 Ga0373935_0166752 3300035692 Bacteria 1504
224 Ga0373933_0156758 3300035724 Bacteria 1444
225 Ga0373933_0243160 3300035724 Bacteria 1158
226 Ga0373933_0282606 3300035724 Bacteria 1072
227 Ga0373947_0018231 3300035725 Bacteria 4040
228 Ga0373947_0036450 3300035725 Bacteria 2917
229 Ga0373947_0190583 3300035725 Bacteria 1338
230 Ga0373947_0408978 3300035725 Bacteria 916
231 Ga0373937_0000922 3300036401 Bacteria 24939
232 Ga0373937_0041143 3300036401 Bacteria 4216
233 Ga0373937_0074325 3300036401 Bacteria 3136
234 Ga0373937_0076699 3300036401 Bacteria 3087
235 Ga0373937_0144757 3300036401 Bacteria 2224
236 Ga0373937_0570078 3300036401 Bacteria 1075
237 Ga0373937_0580243 3300036401 Bacteria 1065
238 Ga0373925_0008231 3300037068 Bacteria 7590
239 Ga0373925_0073718 3300037068 Bacteria 2584
240 Ga0373925_0221294 3300037068 Bacteria 1511
241 Ga0373925_0611641 3300037068 Bacteria 897
242 Ga0395899_0035120 3300037312 Bacteria 3764
243 Ga0395899_0121290 3300037312 Bacteria 1872
244 Ga0395899_0249789 3300037312 Bacteria 1218
245 Ga0395900_0042484 3300037418 Bacteria 4685
246 Ga0395900_0102769 3300037418 Bacteria 2936
247 Ga0395900_0228459 3300037418 Bacteria 1872
248 Ga0395900_0340477 3300037418 Bacteria 1475
249 Ga0395898_0065248 3300037466 Bacteria 3530
250 Ga0395898_0066766 3300037466 Bacteria 3483
251 Ga0395898_0155302 3300037466 Bacteria 2189
252 Ga0395905_0034308 3300037471 Bacteria 4765
253 Ga0395905_0267605 3300037471 Bacteria 1595
254 Ga0395905_0766872 3300037471 Unclassified 867
255 Ga0395901_0237328 3300038443 Bacteria 1902
256 Ga0395901_0269397 3300038443 Bacteria 1771
257 Ga0395901_0332127 3300038443 Bacteria 1571
258 Ga0395901_0347357 3300038443 Bacteria 1531
259 Ga0436365_0568750 3300039437 Bacteria 1095
260 Ga0436365_0842117 3300039437 Bacteria 1121
261 Ga0436365_1687151 3300039437 Bacteria 1052
262 Ga0436365_1852150 3300039437 Bacteria 1190
263 Ga0436360_0561021 3300039438 Bacteria 1542
264 Ga0436360_0725233 3300039438 Bacteria 6806
265 Ga0436361_0003756 3300039447 Bacteria 2364
266 Ga0436361_0084926 3300039447 Bacteria 1344
267 Ga0436361_0209317 3300039447 Bacteria 1663
268 Ga0436363_0310907 3300039450 Bacteria 4074
269 Ga0436363_0384524 3300039450 Bacteria 1150
270 Ga0436362_0309567 3300039453 Bacteria 1345
271 Ga0439465_0052646 3300041413 Bacteria 1336
272 Ga0439431_0025039 3300041997 Bacteria 1456
273 Ga0439441_013431 3300042001 Bacteria 1421
274 Ga0439448_0038049 3300042005 Bacteria 1548
275 Ga0439432_086767 3300042006 Bacteria 944
276 Ga0439456_032735 3300042013 Bacteria 1117
277 Ga0439458_0014761 3300042157 Bacteria 1765
278 Ga0439459_0005929 3300042438 Bacteria 2022
279 Ga0466963_0018844 3300044694 Bacteria 4322
280 Ga0453684_0119247 3300044712 Bacteria 3189
281 Ga0466957_0227603 3300044842 Bacteria 1233
282 Ga0451576_0003979 3300045051 Bacteria 19673
283 Ga0466967_0050110 3300045976 Bacteria 3655
284 Ga0466967_0257152 3300045976 Bacteria 1670
285 Ga0495629_0296027 3300046459 Bacteria 1109
286 Ga0495638_0142002 3300046460 Bacteria 1400
287 Ga0495651_0078288 3300046462 Bacteria 2501
288 Ga0495651_0235464 3300046462 Bacteria 1259
289 Ga0495608_0025697 3300046511 Bacteria 4020
290 Ga0495608_0053198 3300046511 Bacteria 2679
291 Ga0495618_0017921 3300046514 Bacteria 4345
292 Ga0495630_0355591 3300046517 Bacteria 1121
293 Ga0495667_0040179 3300046559 Bacteria 3107
294 Ga0495667_0047390 3300046559 Bacteria 2840
295 Ga0495634_0135945 3300046642 Bacteria 1564
296 Ga0495658_0531413 3300046683 Bacteria 753
297 Ga0495680_0259098 3300047322 Bacteria 1230
298 Ga0496102_0631065 3300048905 Bacteria 995
299 Ga0496103_0018591 3300048906 Bacteria 4169
300 Ga0496104_0490997 3300048907 Bacteria 1139
301 Ga0496106_0130167 3300048909 Bacteria 1973
302 Ga0496110_0761251 3300048913 Bacteria 872
303 Ga0496112_0061041 3300048915 Bacteria 3715
304 Ga0496112_0319557 3300048915 Bacteria 1497
305 Ga0496112_0650594 3300048915 Bacteria 984
306 Ga0496114_0203738 3300048917 Bacteria 1734
307 Ga0496122_0077737 3300048925 Bacteria 2328
308 Ga0501307_016300 3300049162 Bacteria 925
309 Ga0501032_0001267 3300049569 Bacteria 20244
310 Ga0501032_0006938 3300049569 Bacteria 8302
311 Ga0501033_0004067 3300049570 Bacteria 11809
312 Ga0501033_0149475 3300049570 Bacteria 1686
313 Ga0501033_0400774 3300049570 Bacteria 957
314 Ga0501033_0408137 3300049570 Bacteria 947
315 Ga0501033_0661123 3300049570 Bacteria 713
316 Ga0501034_0000001 3300049571 Bacteria 2184493
317 Ga0501034_0050358 3300049571 Bacteria 4201
318 Ga0501034_0114101 3300049571 Bacteria 2691
319 Ga0501034_0247783 3300049571 Bacteria 1726
320 Ga0501034_0266866 3300049571 Bacteria 1653
321 Ga0501036_0005682 3300049572 Bacteria 10117
322 Ga0501036_0112038 3300049572 Bacteria 2306
323 Ga0501036_0182107 3300049572 Bacteria 1768
324 Ga0501036_0874609 3300049572 Bacteria 738
325 Ga0501037_0003226 3300049573 Bacteria 11816
326 Ga0501037_0008751 3300049573 Bacteria 7418
327 Ga0501037_0070294 3300049573 Bacteria 2547
328 Ga0501037_0391070 3300049573 Bacteria 955
329 Ga0501038_0001996 3300049574 Bacteria 18828
330 Ga0501038_0153974 3300049574 Bacteria 1873
331 Ga0501038_0277016 3300049574 Bacteria 1321
332 Ga0501038_0583082 3300049574 Bacteria 848
333 Ga0501039_0000029 3300049575 Bacteria 131786
334 Ga0501039_0046477 3300049575 Bacteria 3353
335 Ga0501039_0197405 3300049575 Bacteria 1582
336 Ga0501039_0356812 3300049575 Bacteria 1149
337 Ga0501039_0400405 3300049575 Bacteria 1078
338 Ga0501039_0612399 3300049575 Bacteria 853
339 Ga0501040_0001777 3300049576 Bacteria 13865
340 Ga0501041_0065421 3300049577 Bacteria 2227
341 Ga0501041_0079160 3300049577 Bacteria 2023
342 Ga0501042_0027487 3300049578 Bacteria 4001
343 Ga0501043_0008206 3300049579 Bacteria 8232
344 Ga0501043_0153737 3300049579 Bacteria 1800
345 Ga0501043_0189825 3300049579 Bacteria 1598
346 Ga0501046_0002158 3300049580 Bacteria 18568
347 Ga0501046_0130648 3300049580 Bacteria 1905
348 Ga0501047_0065711 3300049581 Bacteria 3496
349 Ga0501047_0142773 3300049581 Bacteria 2272
350 Ga0501047_0396545 3300049581 Bacteria 1213
351 Ga0501048_0086639 3300049582 Bacteria 2209
352 Ga0501048_0164694 3300049582 Bacteria 1570
353 Ga0501048_0170118 3300049582 Bacteria 1543
354 Ga0501067_0192328 3300049583 Bacteria 1136
355 Ga0501067_0292229 3300049583 Bacteria 907
356 Ga0501067_0325183 3300049583 Bacteria 856
357 Ga0501069_0070427 3300049585 Bacteria 1959
358 Ga0501069_0213046 3300049585 Bacteria 1121
359 Ga0501069_0235448 3300049585 Bacteria 1066
360 Ga0501070_0031056 3300049586 Bacteria 4474
361 Ga0501070_0059643 3300049586 Bacteria 3163
362 Ga0501070_0092348 3300049586 Bacteria 2505
363 Ga0501070_0270609 3300049586 Bacteria 1387
364 Ga0501070_0569382 3300049586 Bacteria 905
365 Ga0501071_0068245 3300049587 Bacteria 2587
366 Ga0501071_0331438 3300049587 Bacteria 1157
367 Ga0501072_0063809 3300049588 Bacteria 2906
368 Ga0501072_0202499 3300049588 Bacteria 1583
369 Ga0501073_0017098 3300049589 Bacteria 5253
370 Ga0501073_0061280 3300049589 Bacteria 2625
371 Ga0501073_0068852 3300049589 Bacteria 2466
372 Ga0501073_0232275 3300049589 Bacteria 1274
373 Ga0501074_0003314 3300049590 Bacteria 11393
374 Ga0501074_0223711 3300049590 Bacteria 1340
375 Ga0501074_0495598 3300049590 Bacteria 866
376 Ga0501075_0052562 3300049591 Bacteria 3063
377 Ga0501075_0057064 3300049591 Bacteria 2940
378 Ga0501076_0023871 3300049592 Bacteria 4718
379 Ga0501076_0168427 3300049592 Bacteria 1785
380 Ga0501077_0030811 3300049593 Bacteria 3414
381 Ga0501079_0029888 3300049741 Bacteria 4186
382 Ga0501079_0095118 3300049741 Bacteria 2309
383 Ga0501080_0000697 3300049742 Bacteria 27008
384 Ga0501080_0049726 3300049742 Bacteria 3902
385 Ga0501080_0279574 3300049742 Bacteria 1518
386 Ga0501080_0420584 3300049742 Bacteria 1200
387 Ga0501081_0002099 3300049743 Bacteria 12454
388 Ga0501083_0010648 3300049744 Bacteria 6472
389 Ga0501083_0073281 3300049744 Bacteria 2276
390 Ga0501083_0159218 3300049744 Bacteria 1477
391 Ga0501083_0215760 3300049744 Bacteria 1250
392 Ga0501035_0049634 3300049822 Bacteria 3760
393 Ga0501035_0077204 3300049822 Bacteria 2943
394 Ga0501035_0166832 3300049822 Bacteria 1904
395 Ga0501035_0200180 3300049822 Bacteria 1713
396 Ga0501044_0066523 3300049823 Bacteria 3674
397 Ga0501044_0093341 3300049823 Bacteria 3034
398 Ga0501044_0138566 3300049823 Bacteria 2422
399 Ga0501044_0258736 3300049823 Bacteria 1679
400 Ga0501044_0286337 3300049823 Bacteria 1580
401 Ga0501044_0294222 3300049823 Bacteria 1554
402 Ga0501044_0504154 3300049823 Bacteria 1111
403 Ga0501044_0542768 3300049823 Bacteria 1060
404 Ga0501044_0718351 3300049823 Bacteria 883
405 Ga0501044_0755734 3300049823 Bacteria 854
406 Ga0501045_0085887 3300049824 Bacteria 2322
407 nmdc:mga03683_48038_c1 3300050489 Bacteria 1773
408 nmdc:mga03683_75618_c1 3300050489 Bacteria 1446
409 nmdc:mga00v17_276171_c1 3300050491 Bacteria 1091
410 nmdc:mga0k408_170390_c1 3300050493 Bacteria 1298
411 nmdc:mga06z11_203758_c1 3300050494 Bacteria 1150
412 nmdc:mga06z11_278359_c1 3300050494 Bacteria 991
413 nmdc:mga07m45_46266_c1 3300050496 Bacteria 2444
414 nmdc:mga05p37_227342_c1 3300050507 Bacteria 2249
415 nmdc:mga05p37_44008_c1 3300050507 Bacteria 5493
416 nmdc:mga09592_193587_c2 3300050508 Bacteria 1327
417 nmdc:mga06r32_146826_c1 3300050510 Bacteria 2336
418 nmdc:mga08y16_205_c1 3300050511 Bacteria 53058
419 nmdc:mga0n895_786681_c1 3300050512 Bacteria 942
420 nmdc:mga0a205_152518_c1 3300050515 Bacteria 2209
421 Ga0495601_0023465 3300053077 Bacteria 3790
422 Ga0495601_0317890 3300053077 Bacteria 1014
423 Ga0500578_0181652 3300053086 Bacteria 1296
424 Ga0500643_038675 3300053087 Bacteria 1413
425 Ga0500644_0007079 3300053088 Bacteria 2906
426 Ga0500646_0024939 3300053090 Bacteria 1612
427 Ga0500647_0052844 3300053091 Bacteria 1955
428 Ga0500651_0047367 3300053093 Bacteria 2703
429 Ga0500641_0001983 3300053096 Bacteria 7261
430 Ga0500641_0006308 3300053096 Bacteria 4208
431 Ga0500557_057122 3300053105 Bacteria 1262
432 Ga0500594_0007154 3300053118 Bacteria 2522
433 Ga0500595_000405 3300053119 Bacteria 27569
434 Ga0500642_0128395 3300053130 Bacteria 1187
435 Ga0500658_0129545 3300053134 Bacteria 1124
436 Ga0500568_0005226 3300053139 Bacteria 6757
437 Ga0500568_0035918 3300053139 Bacteria 2019
438 Ga0500588_0020344 3300053146 Bacteria 1777
439 Ga0500588_0033400 3300053146 Bacteria 1501
440 Ga0500616_0000624 3300053153 Bacteria 42975
441 Ga0500616_0002871 3300053153 Bacteria 13824
442 Ga0500611_090796 3300053727 Bacteria 777
443 Ga0500552_000131 3300053733 Bacteria 6371
444 Ga0500587_008649 3300053739 Bacteria 1308
445 Ga0501084_0014098 3300054114 Bacteria 6619
446 Ga0501084_0029927 3300054114 Bacteria 4554
447 Ga0501084_0145615 3300054114 Bacteria 1995
448 Ga0587084_004620 3300059477 Bacteria 1585
449 Ga0587077_000161 3300059493 Bacteria 4481
450 Ga0587083_0003909 3300059505 Bacteria 2025
451 Ga0587083_0006728 3300059505 Bacteria 1727
452 Ga0587088_024826 3300059508 Bacteria 1030
453 Ga0587090_005784 3300059510 Bacteria 1565
454 Ga0587128_009356 3300059630 Bacteria 1290
455 Ga0587062_003442 3300059639 Bacteria 1601
456 Ga0587068_014536 3300059641 Bacteria 1228
457 Ga0587076_004681 3300059645 Bacteria 1724
458 Ga0587078_000144 3300059646 Bacteria 4156
459 Ga0587071_010183 3300060344 Bacteria 1564
460 Ga0587111_0000967 3300060346 Bacteria 3179
461 Ga0587111_0001172 3300060346 Bacteria 3019
462 Ga0587111_0010699 3300060346 Bacteria 1582
463 Ga0501082_0006704 3300060353 Bacteria 9961
464 Ga0501082_0008005 3300060353 Bacteria 9126
465 Ga0501082_0043817 3300060353 Bacteria 3859
466 Ga0530510_0044948 3300061734 Bacteria 3191
467 2512032373 2511231221 Bacteria 6846400
468 2523107231 2522572158 Bacteria 6514390
469 2524609933 2524023250 Bacteria 5457705
470 2599105607 2597490356 Bacteria 7030811
471 2846954707 2846952575 Bacteria 6587527
472 2848859026 2848858292 Bacteria 7391279
473 2897804186 2897803580 Bacteria 7000062
474 8054005921 8054002106 Bacteria 7987183
475 Ga0068871_100232765
476 SwRhRL2b_contig_905627
477 JGI25153J46596_10005735
478 Ga0055531_10032078
479 Ga0058862_10155732
480 Ga0065704_10007805
481 Ga0065704_10176472
482 Ga0070676_10064097
483 Ga0070677_10203649
484 Ga0070680_100003273
485 Ga0070680_100308840
486 Ga0070682_100313541
487 Ga0068868_100584472
488 Ga0070691_10030152
489 Ga0070661_100118593
490 Ga0070692_10262455
491 Ga0070669_100284957
492 Ga0070671_100385754
493 Ga0070674_100001266
494 Ga0070673_100245181
495 Ga0070673_100554272
496 Ga0070673_100937575
497 Ga0070659_100041891
498 Ga0070659_100151129
499 Ga0070667_100060883
500 Ga0070714_100029929
501 Ga0070713_100001675
502 Ga0070710_10038584
503 Ga0070711_100105248
504 Ga0070708_100185094
505 Ga0070708_100312334
506 Ga0070708_100360902
507 Ga0070681_10002038
508 Ga0070681_10096314
509 Ga0070681_10171751
510 Ga0070681_10716525
511 Ga0068867_100669242
512 Ga0070706_100100968
513 Ga0070698_100149346
514 Ga0070698_100249504
515 Ga0070698_100415225
516 Ga0070699_100430026
517 Ga0070699_100451517
518 Ga0070679_100201602
519 Ga0070679_100365374
520 Ga0070679_100581501
521 Ga0070684_100935303
522 Ga0070697_100182351
523 Ga0068853_100426178
524 Ga0070686_100474007
525 Ga0070695_100265182
526 Ga0070696_100019133
527 Ga0070696_100379229
528 Ga0070696_100604355
529 Ga0070704_100240048
530 Ga0068855_100211415
531 Ga0070664_100315784
532 Ga0068857_100248544
533 Ga0068857_100298669
534 Ga0068857_100382800
535 Ga0068854_100146052
536 Ga0068856_100134295
537 Ga0068856_100787744
538 Ga0068856_100874025
539 Ga0068859_100279658
540 Ga0068851_10086833
541 Ga0068863_100269964
542 Ga0068863_100434694
543 Ga0068860_100310298
544 Ga0068862_100215246
545 Ga0081455_10005717
546 Ga0081455_10017522
547 Ga0081455_10183560
548 Ga0081538_10005857
549 Ga0081540_1039708
550 Ga0081540_1049568
551 Ga0081539_10009089
552 Ga0081539_10011464
553 Ga0081539_10020334
554 Ga0075365_10115399
555 Ga0075365_10383598
556 Ga0070712_100004619
557 Ga0070712_100324522
558 Ga0075362_10132403
559 Ga0075362_10144775
560 Ga0075367_10105959
561 Ga0075366_10029773
562 Ga0075366_10100604
563 Ga0075366_10173331
564 Ga0097621_100504252
565 Ga0075370_10087267
566 Ga0075428_100956256
567 Ga0097620_100279651
568 Ga0097620_100543496
569 Ga0105240_10058879
570 Ga0111539_10028606
571 Ga0105247_10313053
572 Ga0114129_10001848
573 Ga0105243_10585857
574 Ga0105241_10372873
575 Ga0105238_10558070
576 Ga0105035_108311
577 Ga0105246_10811892
578 Ga0157371_10173637
579 Ga0157370_10309426
580 Ga0157369_10098486
581 Ga0157374_10364726
582 Ga0157378_10259995
583 Ga0157372_10300287
584 Ga0157375_10471430
585 Ga0157375_11325068
586 Ga0163163_11056586
587 Ga0182008_10078721
588 Ga0182008_10199387
589 Ga0157379_10219559
590 Ga0157379_10623458
591 Ga0197907_10090218
592 Ga0206356_10456507
593 Ga0206352_10669964
594 Ga0206354_10971686
595 Ga0206354_11665287
596 Ga0213874_10002149
597 Ga0213876_10019675
598 Ga0213871_10006751
599 Ga0224712_10012105
600 Ga0209758_1008670
601 Ga0209758_1064016
602 Ga0207426_1020842
603 Ga0207426_1025237
604 Ga0209257_1013331
605 Ga0207682_10048586
606 Ga0207692_10088448
607 Ga0207699_10133226
608 Ga0207645_10033128
609 Ga0207643_10065228
610 Ga0207705_10268134
611 Ga0207707_10002798
612 Ga0207707_10276284
613 Ga0207695_10049522
614 Ga0207695_10481645
615 Ga0207693_10029783
616 Ga0207693_10118665
617 Ga0207693_10127226
618 Ga0207663_10541153
619 Ga0207660_10002381
620 Ga0207662_10033556
621 Ga0207662_10372781
622 Ga0207657_10027330
623 Ga0207657_10261710
624 Ga0207652_10226625
625 Ga0207646_10091324
626 Ga0207681_10093699
627 Ga0207694_10101379
628 Ga0207650_10185525
629 Ga0207664_10075173
630 Ga0207664_10306786
631 Ga0207690_10095478
632 Ga0207706_10172363
633 Ga0207669_10027625
634 Ga0207665_10099455
635 Ga0207665_10129181
636 Ga0207665_10236708
637 Ga0207689_10115687
638 Ga0207679_10032394
639 Ga0207667_10014133
640 Ga0207667_10197616
641 Ga0207667_10377019
642 Ga0207667_10441735
643 Ga0207667_10920529
644 Ga0207712_10113284
645 Ga0207668_10538451
646 Ga0207640_10098356
647 Ga0207658_10125657
648 Ga0207703_10353994
649 Ga0207639_10082418
650 Ga0207678_10204225
651 Ga0207708_10534532
652 Ga0207702_10008176
653 Ga0207702_10040172
654 Ga0207702_10339525
655 Ga0207641_10296893
656 Ga0207648_10434257
657 Ga0207674_10028025
658 Ga0207674_10053258
659 Ga0207674_10088619
660 Ga0207674_10315435
661 Ga0207675_100264342
662 Ga0207675_100472688
663 Ga0209588_1093219
664 Ga0207428_10000169
665 Ga0268265_10171349
666 Ga0268265_10299404
667 Ga0265337_1053641
668 Ga0265318_10053941
669 Ga0307517_10071865
670 Ga0265332_10058110
671 Ga0265331_10021110
672 Ga0265331_10096986
673 Ga0265327_10032604
674 Ga0265316_10450469
675 Ga0307513_10236635
676 Ga0307516_10242604
677 Ga0307516_10392398
678 Ga0307407_10183757
679 Ga0307412_10206316
680 Ga0307409_100140206
681 Ga0307409_100396248
682 Ga0307416_100073626
683 Ga0307510_10162642
684 Ga0373938_0050284
685 Ga0373926_0072372
686 Ga0373923_0147068
687 Ga0373936_0071444
688 Ga0373936_0087705
689 Ga0373953_0004557
690 Ga0373954_0040905
691 Ga0373957_0007801
692 Ga0373943_0211082
693 Ga0373942_0021852
694 Ga0373924_0011533
695 Ga0373924_0049234
696 Ga0373931_0022466
697 Ga0373935_0166752
698 Ga0373933_0156758
699 Ga0373933_0243160
700 Ga0373933_0282606
701 Ga0373947_0018231
702 Ga0373947_0036450
703 Ga0373947_0190583
704 Ga0373947_0408978
705 Ga0373937_0000922
706 Ga0373937_0041143
707 Ga0373937_0074325
708 Ga0373937_0076699
709 Ga0373937_0144757
710 Ga0373937_0570078
711 Ga0373937_0580243
712 Ga0373925_0008231
713 Ga0373925_0073718
714 Ga0373925_0221294
715 Ga0373925_0611641
716 Ga0395899_0035120
717 Ga0395899_0121290
718 Ga0395899_0249789
719 Ga0395900_0042484
720 Ga0395900_0102769
721 Ga0395900_0228459
722 Ga0395900_0340477
723 Ga0395898_0065248
724 Ga0395898_0066766
725 Ga0395898_0155302
726 Ga0395905_0034308
727 Ga0395905_0267605
728 Ga0395905_0766872
729 Ga0395901_0237328
730 Ga0395901_0269397
731 Ga0395901_0332127
732 Ga0395901_0347357
733 Ga0436365_0568750
734 Ga0436365_0842117
735 Ga0436365_1687151
736 Ga0436365_1852150
737 Ga0436360_0561021
738 Ga0436360_0725233
739 Ga0436361_0003756
740 Ga0436361_0084926
741 Ga0436361_0209317
742 Ga0436363_0310907
743 Ga0436363_0384524
744 Ga0436362_0309567
745 Ga0439465_0052646
746 Ga0439431_0025039
747 Ga0439441_013431
748 Ga0439448_0038049
749 Ga0439432_086767
750 Ga0439456_032735
751 Ga0439458_0014761
752 Ga0439459_0005929
753 Ga0466963_0018844
754 Ga0453684_0119247
755 Ga0466957_0227603
756 Ga0451576_0003979
757 Ga0466967_0050110
758 Ga0466967_0257152
759 Ga0495629_0296027
760 Ga0495638_0142002
761 Ga0495651_0078288
762 Ga0495651_0235464
763 Ga0495608_0025697
764 Ga0495608_0053198
765 Ga0495618_0017921
766 Ga0495630_0355591
767 Ga0495667_0040179
768 Ga0495667_0047390
769 Ga0495634_0135945
770 Ga0495658_0531413
771 Ga0495680_0259098
772 Ga0496102_0631065
773 Ga0496103_0018591
774 Ga0496104_0490997
775 Ga0496106_0130167
776 Ga0496110_0761251
777 Ga0496112_0061041
778 Ga0496112_0319557
779 Ga0496112_0650594
780 Ga0496114_0203738
781 Ga0496122_0077737
782 Ga0501307_016300
783 Ga0501032_0001267
784 Ga0501032_0006938
785 Ga0501033_0004067
786 Ga0501033_0149475
787 Ga0501033_0400774
788 Ga0501033_0408137
789 Ga0501033_0661123
790 Ga0501034_0000001
791 Ga0501034_0050358
792 Ga0501034_0114101
793 Ga0501034_0247783
794 Ga0501034_0266866
795 Ga0501036_0005682
796 Ga0501036_0112038
797 Ga0501036_0182107
798 Ga0501036_0874609
799 Ga0501037_0003226
800 Ga0501037_0008751
801 Ga0501037_0070294
802 Ga0501037_0391070
803 Ga0501038_0001996
804 Ga0501038_0153974
805 Ga0501038_0277016
806 Ga0501038_0583082
807 Ga0501039_0000029
808 Ga0501039_0046477
809 Ga0501039_0197405
810 Ga0501039_0356812
811 Ga0501039_0400405
812 Ga0501039_0612399
813 Ga0501040_0001777
814 Ga0501041_0065421
815 Ga0501041_0079160
816 Ga0501042_0027487
817 Ga0501043_0008206
818 Ga0501043_0153737
819 Ga0501043_0189825
820 Ga0501046_0002158
821 Ga0501046_0130648
822 Ga0501047_0065711
823 Ga0501047_0142773
824 Ga0501047_0396545
825 Ga0501048_0086639
826 Ga0501048_0164694
827 Ga0501048_0170118
828 Ga0501067_0192328
829 Ga0501067_0292229
830 Ga0501067_0325183
831 Ga0501069_0070427
832 Ga0501069_0213046
833 Ga0501069_0235448
834 Ga0501070_0031056
835 Ga0501070_0059643
836 Ga0501070_0092348
837 Ga0501070_0270609
838 Ga0501070_0569382
839 Ga0501071_0068245
840 Ga0501071_0331438
841 Ga0501072_0063809
842 Ga0501072_0202499
843 Ga0501073_0017098
844 Ga0501073_0061280
845 Ga0501073_0068852
846 Ga0501073_0232275
847 Ga0501074_0003314
848 Ga0501074_0223711
849 Ga0501074_0495598
850 Ga0501075_0052562
851 Ga0501075_0057064
852 Ga0501076_0023871
853 Ga0501076_0168427
854 Ga0501077_0030811
855 Ga0501079_0029888
856 Ga0501079_0095118
857 Ga0501080_0000697
858 Ga0501080_0049726
859 Ga0501080_0279574
860 Ga0501080_0420584
861 Ga0501081_0002099
862 Ga0501083_0010648
863 Ga0501083_0073281
864 Ga0501083_0159218
865 Ga0501083_0215760
866 Ga0501035_0049634
867 Ga0501035_0077204
868 Ga0501035_0166832
869 Ga0501035_0200180
870 Ga0501044_0066523
871 Ga0501044_0093341
872 Ga0501044_0138566
873 Ga0501044_0258736
874 Ga0501044_0286337
875 Ga0501044_0294222
876 Ga0501044_0504154
877 Ga0501044_0542768
878 Ga0501044_0718351
879 Ga0501044_0755734
880 Ga0501045_0085887
881 nmdc:mga03683_48038_c1
882 nmdc:mga03683_75618_c1
883 nmdc:mga00v17_276171_c1
884 nmdc:mga0k408_170390_c1
885 nmdc:mga06z11_203758_c1
886 nmdc:mga06z11_278359_c1
887 nmdc:mga07m45_46266_c1
888 nmdc:mga05p37_227342_c1
889 nmdc:mga05p37_44008_c1
890 nmdc:mga09592_193587_c2
891 nmdc:mga06r32_146826_c1
892 nmdc:mga08y16_205_c1
893 nmdc:mga0n895_786681_c1
894 nmdc:mga0a205_152518_c1
895 Ga0495601_0023465
896 Ga0495601_0317890
897 Ga0500578_0181652
898 Ga0500643_038675
899 Ga0500644_0007079
900 Ga0500646_0024939
901 Ga0500647_0052844
902 Ga0500651_0047367
903 Ga0500641_0001983
904 Ga0500641_0006308
905 Ga0500557_057122
906 Ga0500594_0007154
907 Ga0500595_000405
908 Ga0500642_0128395
909 Ga0500658_0129545
910 Ga0500568_0005226
911 Ga0500568_0035918
912 Ga0500588_0020344
913 Ga0500588_0033400
914 Ga0500616_0000624
915 Ga0500616_0002871
916 Ga0500611_090796
917 Ga0500552_000131
918 Ga0500587_008649
919 Ga0501084_0014098
920 Ga0501084_0029927
921 Ga0501084_0145615
922 Ga0587084_004620
923 Ga0587077_000161
924 Ga0587083_0003909
925 Ga0587083_0006728
926 Ga0587088_024826
927 Ga0587090_005784
928 Ga0587128_009356
929 Ga0587062_003442
930 Ga0587068_014536
931 Ga0587076_004681
932 Ga0587078_000144
933 Ga0587071_010183
934 Ga0587111_0000967
935 Ga0587111_0001172
936 Ga0587111_0010699
937 Ga0501082_0006704
938 Ga0501082_0008005
939 Ga0501082_0043817
940 Ga0530510_0044948
941 2512032373
942 2523107231
943 2524609933
944 2599105607
945 2846954707
946 2848859026
947 2897804186
948 8054005921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

68

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hix-assembly1.cif.gz_AE cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8605 2 206
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.855 4 208
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8434 3 210
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.8383 4 208
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8352 4 208
ID Description Score Start End Superfamily
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8809 1 211 2.40.30.10
af_Q9P6P6_75_139_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8156 34 94 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8119 33 97 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8111 35 94 3.30.160.810
1vw3C02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7798 33 97 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A4Q5QTA6-F1-model_v4 50S ribosomal protein L3 0.9035 1 119 GO:0003735
GO:0006412
GO:0022625
AF-A0A6N2K3L5-F1-model_v4 50S ribosomal protein L3 0.9001 1 119 GO:0003735
GO:0005762
GO:0006412
AF-A0A4Q5QTA6-F1-model_v4 50S ribosomal protein L3 0.8963 1 119 GO:0003735
GO:0006412
GO:0022625
AF-A0A529QAV9-F1-model_v4 50S ribosomal protein L3 0.8726 1 92 GO:0003735
GO:0006412
GO:0022625
AF-A0A7S1QWK2-F1-model_v4 Uncharacterized protein 0.8702 1 102 GO:0003735
GO:0005762
GO:0006412

Map