F450449

General Info

Members Datasets Scaffolds Average Seq Length
470 246 468 377

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0004286|Ga0395900_0004286_44_1297
Length 409
Sequence MSLTPSVAGYRDTSPEDGRRNEMAKNWIPLRQVEGTASRQAHVRLPEGTYEREISKEGFFGPSAQFHHKHKPTDWSDFDGPIRPRAFDLNKLVTAHANPWQAELVMNNPHLQMRIWKLDQAMPELARNSDGDQLLFVHEGAGDLFCDYGHLEYRDGDYIVIPRGTMWRLAPKQPTTTLMIEATNDHFTLPEKGIVGRHAIFDPAMLDTPHIDDAFKAQQDERPWKVSVKRRHALSTVTFPFNPLDAIGWHGDLSVVRINWRDIRPVMSHRAHLPPSAHTTFVAGRFVVCTFVPRPLESDPEALRLPFFHNNDDFDEVIFYHKGSFFSRDNIHPGMMTVHPSGFTHGPHPKAFDAATKTSVQSGGKAETDEVAVMVDTRDAIDIAAMPAGVEFEGYVKSWRPAEMKQAAE

Samples

Sample ID Description Type Environment
1 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
2 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
174 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.21
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 2.98
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10000116 3300003322 Bacteria 29881
2 Ga0065712_10095512 3300005290 Bacteria 2207
3 Ga0065715_10110976 3300005293 Bacteria 2594
4 Ga0065707_10081743 3300005295 Bacteria 52414
5 Ga0070658_10007220 3300005327 Bacteria 8966
6 Ga0070658_10016126 3300005327 Bacteria 5976
7 Ga0070690_100009545 3300005330 Bacteria 5624
8 Ga0070670_100012090 3300005331 Bacteria 7381
9 Ga0070670_100161939 3300005331 Bacteria 1939
10 Ga0068869_100001906 3300005334 Bacteria 12536
11 Ga0068869_100007868 3300005334 Bacteria 6840
12 Ga0068869_100029433 3300005334 Bacteria 3848
13 Ga0070666_10001642 3300005335 Bacteria 13628
14 Ga0070666_10036422 3300005335 Bacteria 3266
15 Ga0070689_100067632 3300005340 Bacteria 2785
16 Ga0070691_10001763 3300005341 Bacteria 9416
17 Ga0070691_10009930 3300005341 Bacteria 4338
18 Ga0070661_100028450 3300005344 Bacteria 4032
19 Ga0070661_100066587 3300005344 Bacteria 2647
20 Ga0070668_100017012 3300005347 Bacteria 5440
21 Ga0070668_100025836 3300005347 Bacteria 4454
22 Ga0070669_100006253 3300005353 Bacteria 8595
23 Ga0070669_100068823 3300005353 Bacteria 2613
24 Ga0070675_100011231 3300005354 Bacteria 7011
25 Ga0070675_100035733 3300005354 Bacteria 4040
26 Ga0070675_100103162 3300005354 Bacteria 2404
27 Ga0070675_100123024 3300005354 Bacteria 2205
28 Ga0070671_100078425 3300005355 Bacteria 2761
29 Ga0070671_100218772 3300005355 Bacteria 1616
30 Ga0070673_100007877 3300005364 Bacteria 7059
31 Ga0070673_100092267 3300005364 Bacteria 2477
32 Ga0070688_100093577 3300005365 Bacteria 1969
33 Ga0070667_100010842 3300005367 Bacteria 7535
34 Ga0070667_100128680 3300005367 Bacteria 2208
35 Ga0070713_100151708 3300005436 Bacteria 2062
36 Ga0070705_100059677 3300005440 Bacteria 2260
37 Ga0070700_100059164 3300005441 Bacteria 2411
38 Ga0070662_100013048 3300005457 Bacteria 5522
39 Ga0070662_100154519 3300005457 Bacteria 1790
40 Ga0070681_10000213 3300005458 Bacteria 45271
41 Ga0070681_10063742 3300005458 Bacteria 3658
42 Ga0068867_100031185 3300005459 Bacteria 3847
43 Ga0068867_100031756 3300005459 Bacteria 3815
44 Ga0068867_100033635 3300005459 Bacteria 3714
45 Ga0070685_10047704 3300005466 Bacteria 2464
46 Ga0070699_100144710 3300005518 Bacteria 2100
47 Ga0070699_100244907 3300005518 Bacteria 1601
48 Ga0070684_100006131 3300005535 Bacteria 9265
49 Ga0068853_100007541 3300005539 Bacteria 8708
50 Ga0070672_100010704 3300005543 Bacteria 6372
51 Ga0070672_100301487 3300005543 Bacteria 1358
52 Ga0070665_100010676 3300005548 Bacteria 9297
53 Ga0070665_100015917 3300005548 Bacteria 7549
54 Ga0070665_100130213 3300005548 Bacteria 2518
55 Ga0070704_100093157 3300005549 Bacteria 2251
56 Ga0068855_100008507 3300005563 Bacteria 12406
57 Ga0068855_100160004 3300005563 Bacteria 2556
58 Ga0070664_100012704 3300005564 Bacteria 6855
59 Ga0068857_100008579 3300005577 Bacteria 8841
60 Ga0068857_100010692 3300005577 Bacteria 7984
61 Ga0068857_100052316 3300005577 Bacteria 3624
62 Ga0070702_100009956 3300005615 Bacteria 4667
63 Ga0068859_100006352 3300005617 Bacteria 11993
64 Ga0068859_100026976 3300005617 Bacteria 5762
65 Ga0068859_100082792 3300005617 Bacteria 3251
66 Ga0068859_100116961 3300005617 Bacteria 2731
67 Ga0068859_100220424 3300005617 Bacteria 1985
68 Ga0068864_100009835 3300005618 Bacteria 7885
69 Ga0068864_100116017 3300005618 Bacteria 2389
70 Ga0068864_100140380 3300005618 Bacteria 2179
71 Ga0068861_100001029 3300005719 Bacteria 17066
72 Ga0068861_100023444 3300005719 Bacteria 4451
73 Ga0068861_100079984 3300005719 Bacteria 2556
74 Ga0068861_100414302 3300005719 Bacteria 1199
75 Ga0068863_100001391 3300005841 Bacteria 23993
76 Ga0068863_100011421 3300005841 Bacteria 8590
77 Ga0068863_100157359 3300005841 Bacteria 2176
78 Ga0068863_100159775 3300005841 Bacteria 2159
79 Ga0068858_100046353 3300005842 Bacteria 4030
80 Ga0068860_100012899 3300005843 Bacteria 8213
81 Ga0068860_100038631 3300005843 Bacteria 4567
82 Ga0068860_100040194 3300005843 Bacteria 4471
83 Ga0068860_100083571 3300005843 Bacteria 3037
84 Ga0068860_100101162 3300005843 Bacteria 2750
85 Ga0068860_100134835 3300005843 Bacteria 2371
86 Ga0068862_100001992 3300005844 Bacteria 18521
87 Ga0068862_100040378 3300005844 Bacteria 3966
88 Ga0068862_100048706 3300005844 Bacteria 3618
89 Ga0068862_100134407 3300005844 Bacteria 2191
90 Ga0081455_10000347 3300005937 Bacteria 60756
91 Ga0081455_10002115 3300005937 Bacteria 23647
92 Ga0081455_10030259 3300005937 Bacteria 4921
93 Ga0081538_10018402 3300005981 Bacteria 5247
94 Ga0081539_10004851 3300005985 Bacteria 14381
95 Ga0081539_10007682 3300005985 Bacteria 9691
96 Ga0075368_10000907 3300006042 Bacteria 9191
97 Ga0075362_10024628 3300006177 Bacteria 2554
98 Ga0075367_10004458 3300006178 Bacteria 6840
99 Ga0075367_10059615 3300006178 Bacteria 2273
100 Ga0097621_100006196 3300006237 Bacteria 8480
101 Ga0097621_100008103 3300006237 Bacteria 7549
102 Ga0097621_100211089 3300006237 Bacteria 1689
103 Ga0097621_100254431 3300006237 Bacteria 1539
104 Ga0075370_10034583 3300006353 Bacteria 2832
105 Ga0068871_100006155 3300006358 Bacteria 8456
106 Ga0068871_100231707 3300006358 Bacteria 1603
107 Ga0068871_100255882 3300006358 Bacteria 1526
108 Ga0075428_100001014 3300006844 Bacteria 29769
109 Ga0075428_100004912 3300006844 Bacteria 14853
110 Ga0075428_100054639 3300006844 Bacteria 4376
111 Ga0075428_100091973 3300006844 Bacteria 3308
112 Ga0075428_100101160 3300006844 Bacteria 3142
113 Ga0075428_100136743 3300006844 Bacteria 2664
114 Ga0075430_100018809 3300006846 Bacteria 5877
115 Ga0075431_100000030 3300006847 Bacteria 72683
116 Ga0075431_100114324 3300006847 Bacteria 2786
117 Ga0075434_100000154 3300006871 Bacteria 42762
118 Ga0075429_100001752 3300006880 Bacteria 17974
119 Ga0075429_100002466 3300006880 Bacteria 15563
120 Ga0068865_100035407 3300006881 Bacteria 3357
121 Ga0068865_100092532 3300006881 Bacteria 2197
122 Ga0068865_100116272 3300006881 Bacteria 1981
123 Ga0075436_100146742 3300006914 Bacteria 1659
124 Ga0097620_100006352 3300006931 Bacteria 11993
125 Ga0097620_100026976 3300006931 Bacteria 5762
126 Ga0097620_100082790 3300006931 Bacteria 3251
127 Ga0097620_100116958 3300006931 Bacteria 2731
128 Ga0097620_100220419 3300006931 Bacteria 1985
129 Ga0105240_10007263 3300009093 Bacteria 16126
130 Ga0105240_10177010 3300009093 Bacteria 2521
131 Ga0105240_10177017 3300009093 Bacteria 2521
132 Ga0105240_10372374 3300009093 Bacteria 1614
133 Ga0111539_10004009 3300009094 Bacteria 19329
134 Ga0111539_10004730 3300009094 Bacteria 17791
135 Ga0111539_10200042 3300009094 Bacteria 2330
136 Ga0111539_10244392 3300009094 Bacteria 2089
137 Ga0111539_10307670 3300009094 Bacteria 1844
138 Ga0105245_10006170 3300009098 Bacteria 10548
139 Ga0105247_10089564 3300009101 Bacteria 1951
140 Ga0105247_10288100 3300009101 Bacteria 1135
141 Ga0114129_10004229 3300009147 Bacteria 20289
142 Ga0114129_10015376 3300009147 Bacteria 10890
143 Ga0114129_10022290 3300009147 Bacteria 8992
144 Ga0114129_10312791 3300009147 Bacteria 2090
145 Ga0105241_10020212 3300009174 Bacteria 4919
146 Ga0105242_10013402 3300009176 Bacteria 6335
147 Ga0105248_10000417 3300009177 Bacteria 48821
148 Ga0105248_10003913 3300009177 Bacteria 16471
149 Ga0105248_10004863 3300009177 Bacteria 14873
150 Ga0105237_10040208 3300009545 Bacteria 4716
151 Ga0105238_10034325 3300009551 Bacteria 5162
152 Ga0105238_10303927 3300009551 Bacteria 1579
153 Ga0105249_10008214 3300009553 Bacteria 9094
154 Ga0105249_10082490 3300009553 Bacteria 2991
155 Ga0099796_10000033 3300010159 Bacteria 31267
156 Ga0099796_10020680 3300010159 Bacteria 2015
157 Ga0105239_10044346 3300010375 Bacteria 4876
158 Ga0105239_10100766 3300010375 Bacteria 3195
159 Ga0105246_10087212 3300011119 Bacteria 2240
160 Ga0157374_10038823 3300013296 Bacteria 4379
161 Ga0163162_10091827 3300013306 Bacteria 3119
162 Ga0157372_10022136 3300013307 Bacteria 6876
163 Ga0157372_10133632 3300013307 Bacteria 2856
164 Ga0157372_10187815 3300013307 Bacteria 2393
165 Ga0157375_10003565 3300013308 Bacteria 13513
166 Ga0157375_10013845 3300013308 Bacteria 7190
167 Ga0157375_10039336 3300013308 Bacteria 4552
168 Ga0157375_10067992 3300013308 Bacteria 3562
169 Ga0157375_10444344 3300013308 Bacteria 1462
170 Ga0163163_10024323 3300014325 Bacteria 5764
171 Ga0163163_10048110 3300014325 Bacteria 4192
172 Ga0163163_10075394 3300014325 Bacteria 3367
173 Ga0163163_10086052 3300014325 Bacteria 3152
174 Ga0163163_10114562 3300014325 Bacteria 2727
175 Ga0157380_10009987 3300014326 Bacteria 6813
176 Ga0157380_10020174 3300014326 Bacteria 4980
177 Ga0157377_10023226 3300014745 Bacteria 3285
178 Ga0157379_10010858 3300014968 Bacteria 7940
179 Ga0157379_10067275 3300014968 Bacteria 3203
180 Ga0157379_10172414 3300014968 Bacteria 1953
181 Ga0157379_10175686 3300014968 Bacteria 1934
182 Ga0157376_10006638 3300014969 Bacteria 8192
183 Ga0157376_10015671 3300014969 Bacteria 5733
184 Ga0157376_10423692 3300014969 Bacteria 1292
185 Ga0163161_10112357 3300017792 Bacteria 2038
186 Ga0213872_10049442 3300021361 Bacteria 1910
187 Ga0213874_10008350 3300021377 Bacteria 2523
188 Ga0213876_10000115 3300021384 Bacteria 87113
189 Ga0213876_10006737 3300021384 Bacteria 6272
190 Ga0224712_10093175 3300022467 Bacteria 1265
191 Ga0209675_1003156 3300025291 Bacteria 8012
192 Ga0207688_10073634 3300025901 Bacteria 1942
193 Ga0207680_10007639 3300025903 Bacteria 5281
194 Ga0207680_10142131 3300025903 Bacteria 1592
195 Ga0207645_10133476 3300025907 Bacteria 1616
196 Ga0207645_10190118 3300025907 Bacteria 1349
197 Ga0207705_10035640 3300025909 Bacteria 3559
198 Ga0207705_10044444 3300025909 Bacteria 3192
199 Ga0207654_10057815 3300025911 Bacteria 2255
200 Ga0207707_10007070 3300025912 Bacteria 9783
201 Ga0207695_10040372 3300025913 Bacteria 5005
202 Ga0207695_10151824 3300025913 Bacteria 2255
203 Ga0207671_10027687 3300025914 Bacteria 4237
204 Ga0207660_10002463 3300025917 Bacteria 12163
205 Ga0207649_10033489 3300025920 Bacteria 3070
206 Ga0207652_10090860 3300025921 Bacteria 2684
207 Ga0207681_10010252 3300025923 Bacteria 5738
208 Ga0207681_10040921 3300025923 Bacteria 3087
209 Ga0207681_10059895 3300025923 Bacteria 2611
210 Ga0207681_10141404 3300025923 Bacteria 1793
211 Ga0207650_10027428 3300025925 Bacteria 4077
212 Ga0207650_10087461 3300025925 Bacteria 2374
213 Ga0207650_10154528 3300025925 Bacteria 1814
214 Ga0207659_10002224 3300025926 Bacteria 11553
215 Ga0207659_10045166 3300025926 Bacteria 3104
216 Ga0207659_10063792 3300025926 Bacteria 2665
217 Ga0207659_10139061 3300025926 Bacteria 1883
218 Ga0207644_10227720 3300025931 Bacteria 1480
219 Ga0207644_10229071 3300025931 Bacteria 1476
220 Ga0207644_10314168 3300025931 Bacteria 1266
221 Ga0207706_10008999 3300025933 Bacteria 9191
222 Ga0207706_10111711 3300025933 Bacteria 2404
223 Ga0207706_10126607 3300025933 Bacteria 2246
224 Ga0207706_10192334 3300025933 Bacteria 1791
225 Ga0207706_10199719 3300025933 Bacteria 1754
226 Ga0207686_10059985 3300025934 Bacteria 2406
227 Ga0207670_10214582 3300025936 Bacteria 1469
228 Ga0207704_10046540 3300025938 Bacteria 2586
229 Ga0207704_10268935 3300025938 Bacteria 1289
230 Ga0207691_10003560 3300025940 Bacteria 15152
231 Ga0207691_10012272 3300025940 Bacteria 8214
232 Ga0207691_10019933 3300025940 Bacteria 6344
233 Ga0207691_10023600 3300025940 Bacteria 5792
234 Ga0207691_10162503 3300025940 Bacteria 1958
235 Ga0207711_10016947 3300025941 Bacteria 6051
236 Ga0207711_10097775 3300025941 Bacteria 2592
237 Ga0207689_10001586 3300025942 Bacteria 21539
238 Ga0207689_10006575 3300025942 Bacteria 10249
239 Ga0207689_10037057 3300025942 Bacteria 4047
240 Ga0207679_10007670 3300025945 Bacteria 6855
241 Ga0207667_10115583 3300025949 Bacteria 2765
242 Ga0207667_10232668 3300025949 Bacteria 1887
243 Ga0207651_10016436 3300025960 Bacteria 4334
244 Ga0207712_10003847 3300025961 Bacteria 9479
245 Ga0207712_10025217 3300025961 Bacteria 3949
246 Ga0207668_10086608 3300025972 Bacteria 2289
247 Ga0207658_10085209 3300025986 Bacteria 2433
248 Ga0207658_10211062 3300025986 Bacteria 1627
249 Ga0207703_10029230 3300026035 Bacteria 4347
250 Ga0207639_10001641 3300026041 Bacteria 15068
251 Ga0207708_10132676 3300026075 Bacteria 1948
252 Ga0207708_10227216 3300026075 Bacteria 1497
253 Ga0207641_10044066 3300026088 Bacteria 3750
254 Ga0207641_10060603 3300026088 Bacteria 3225
255 Ga0207641_10083662 3300026088 Bacteria 2776
256 Ga0207641_10102064 3300026088 Bacteria 2529
257 Ga0207641_10139894 3300026088 Bacteria 2183
258 Ga0207648_10043569 3300026089 Bacteria 3939
259 Ga0207648_10113470 3300026089 Bacteria 2380
260 Ga0207676_10006221 3300026095 Bacteria 8429
261 Ga0207676_10007041 3300026095 Bacteria 7969
262 Ga0207676_10016908 3300026095 Bacteria 5282
263 Ga0207676_10110070 3300026095 Bacteria 2303
264 Ga0207674_10015074 3300026116 Bacteria 8509
265 Ga0207674_10027912 3300026116 Bacteria 5964
266 Ga0207674_10067009 3300026116 Bacteria 3615
267 Ga0207674_10147188 3300026116 Bacteria 2314
268 Ga0207675_100001358 3300026118 Bacteria 24514
269 Ga0207675_100004919 3300026118 Bacteria 12872
270 Ga0207675_100031410 3300026118 Bacteria 4948
271 Ga0207675_100043990 3300026118 Bacteria 4170
272 Ga0207675_100102422 3300026118 Bacteria 2698
273 Ga0207675_100115914 3300026118 Bacteria 2531
274 Ga0207683_10216298 3300026121 Bacteria 1745
275 Ga0207698_10066351 3300026142 Bacteria 2840
276 Ga0209179_1000055 3300027512 Bacteria 21337
277 Ga0209974_10047290 3300027876 Bacteria 1441
278 Ga0207428_10000848 3300027907 Bacteria 34448
279 Ga0207428_10001822 3300027907 Bacteria 21820
280 Ga0207428_10018693 3300027907 Bacteria 5915
281 Ga0207428_10174941 3300027907 Bacteria 1624
282 Ga0207428_10258223 3300027907 Bacteria 1298
283 Ga0268266_10021888 3300028379 Bacteria 5447
284 Ga0268266_10085728 3300028379 Bacteria 2752
285 Ga0268266_10309302 3300028379 Bacteria 1476
286 Ga0268265_10039321 3300028380 Bacteria 3486
287 Ga0268265_10063318 3300028380 Bacteria 2845
288 Ga0268265_10249937 3300028380 Bacteria 1570
289 Ga0268265_10258244 3300028380 Bacteria 1547
290 Ga0268264_10009015 3300028381 Bacteria 8275
291 Ga0268264_10016792 3300028381 Bacteria 5990
292 Ga0268264_10064910 3300028381 Bacteria 3074
293 Ga0265332_10001809 3300031238 Bacteria 11496
294 Ga0265328_10001376 3300031239 Bacteria 11228
295 Ga0265325_10012767 3300031241 Bacteria 4794
296 Ga0265325_10057365 3300031241 Bacteria 1986
297 Ga0265340_10001783 3300031247 Bacteria 12282
298 Ga0265340_10076977 3300031247 Bacteria 1575
299 Ga0265339_10004680 3300031249 Bacteria 9291
300 Ga0265331_10000003 3300031250 Bacteria 499358
301 Ga0265331_10015259 3300031250 Bacteria 4063
302 Ga0265327_10013661 3300031251 Bacteria 5377
303 Ga0265316_10057480 3300031344 Bacteria 3033
304 Ga0265316_10071859 3300031344 Bacteria 2667
305 Ga0307513_10091688 3300031456 Bacteria 3096
306 Ga0307509_10018026 3300031507 Bacteria 8106
307 Ga0307408_100005579 3300031548 Bacteria 8413
308 Ga0307408_100093019 3300031548 Bacteria 2280
309 Ga0307408_100134637 3300031548 Bacteria 1932
310 Ga0307408_100138358 3300031548 Bacteria 1908
311 Ga0316575_10016884 3300031665 Bacteria 2767
312 Ga0265314_10075075 3300031711 Bacteria 2250
313 Ga0265314_10085981 3300031711 Bacteria 2060
314 Ga0265342_10000210 3300031712 Bacteria 65961
315 Ga0265342_10087194 3300031712 Bacteria 1794
316 Ga0316576_10065269 3300031727 Bacteria 2675
317 Ga0316576_10143851 3300031727 Bacteria 1795
318 Ga0307405_10004202 3300031731 Bacteria 6780
319 Ga0307410_10073643 3300031852 Bacteria 2376
320 Ga0307407_10177203 3300031903 Bacteria 1409
321 Ga0307409_100172153 3300031995 Bacteria 1907
322 Ga0307409_100212697 3300031995 Bacteria 1739
323 Ga0307416_100003806 3300032002 Bacteria 8963
324 Ga0307416_100062924 3300032002 Bacteria 3036
325 Ga0307414_10284963 3300032004 Bacteria 1390
326 Ga0373939_0031264 3300035114 Bacteria 1538
327 Ga0373935_0054683 3300035692 Bacteria 2543
328 Ga0373927_0135441 3300035695 Bacteria 1610
329 Ga0373937_0154297 3300036401 Bacteria 2152
330 Ga0373937_0226998 3300036401 Bacteria 1758
331 Ga0373925_0135397 3300037068 Bacteria 1925
332 Ga0395899_0001973 3300037312 Bacteria 16872
333 Ga0395899_0095228 3300037312 Bacteria 2154
334 Ga0395899_0238216 3300037312 Bacteria 1253
335 Ga0395900_0004286 3300037418 Bacteria 15134
336 Ga0395900_0017572 3300037418 Bacteria 7298
337 Ga0395900_0019725 3300037418 Bacteria 6873
338 Ga0395900_0065795 3300037418 Bacteria 3724
339 Ga0395900_0181023 3300037418 Bacteria 2142
340 Ga0395898_0017545 3300037466 Bacteria 7306
341 Ga0395898_0017884 3300037466 Bacteria 7231
342 Ga0395898_0111771 3300037466 Bacteria 2618
343 Ga0395901_0002102 3300038443 Bacteria 20446
344 Ga0395901_0020486 3300038443 Bacteria 6768
345 Ga0395901_0033895 3300038443 Bacteria 5273
346 Ga0395901_0097909 3300038443 Bacteria 3075
347 Ga0436365_0507621 3300039437 Bacteria 122643
348 Ga0436365_0737310 3300039437 Bacteria 23715
349 Ga0436360_0477258 3300039438 Bacteria 17690
350 Ga0436361_0004926 3300039447 Bacteria 16512
351 Ga0436361_0814330 3300039447 Bacteria 2789
352 Ga0436363_0550910 3300039450 Bacteria 12229
353 Ga0436363_0571997 3300039450 Bacteria 7484
354 Ga0436363_0923907 3300039450 Bacteria 1849
355 Ga0439461_0007791 3300041410 Bacteria 1908
356 Ga0439465_0027594 3300041413 Bacteria 1799
357 Ga0439448_0038855 3300042005 Bacteria 1533
358 Ga0439451_011533 3300042009 Bacteria 1783
359 Ga0450894_003826 3300042131 Bacteria 1967
360 Ga0439446_0001262 3300042156 Bacteria 5687
361 Ga0439446_0003380 3300042156 Bacteria 3953
362 Ga0439434_0002952 3300042435 Bacteria 4969
363 Ga0439434_0045178 3300042435 Bacteria 1358
364 Ga0439435_0000169 3300042436 Bacteria 9067
365 Ga0439444_0007278 3300042437 Bacteria 1696
366 Ga0439460_0000411 3300042461 Bacteria 9149
367 Ga0451577_0266116 3300042876 Bacteria 1552
368 Ga0453683_0128238 3300044673 Bacteria 1598
369 Ga0453684_0000163 3300044712 Bacteria 296196
370 Ga0453684_0348111 3300044712 Bacteria 1672
371 Ga0451576_0002793 3300045051 Bacteria 25197
372 Ga0451576_0030042 3300045051 Bacteria 5811
373 Ga0495638_0002250 3300046460 Bacteria 15996
374 Ga0495641_0026684 3300046461 Bacteria 2816
375 Ga0495625_0005703 3300046660 Bacteria 11270
376 Ga0496100_0126841 3300048903 Bacteria 1792
377 Ga0496102_0193327 3300048905 Bacteria 1918
378 Ga0496104_0178178 3300048907 Bacteria 2036
379 Ga0496104_0187281 3300048907 Bacteria 1980
380 Ga0496105_0090126 3300048908 Bacteria 2533
381 Ga0496106_0119623 3300048909 Bacteria 2058
382 Ga0496108_0027380 3300048911 Bacteria 4706
383 Ga0496108_0174594 3300048911 Bacteria 1860
384 Ga0496109_0045048 3300048912 Bacteria 4003
385 Ga0496110_0009800 3300048913 Bacteria 7758
386 Ga0496111_0008249 3300048914 Bacteria 6887
387 Ga0496113_0066492 3300048916 Bacteria 2731
388 Ga0496114_0014914 3300048917 Bacteria 6246
389 Ga0496114_0033870 3300048917 Bacteria 4211
390 Ga0501031_0030379 3300049568 Bacteria 3524
391 Ga0501034_0001803 3300049571 Bacteria 27303
392 Ga0501034_0147207 3300049571 Bacteria 2332
393 Ga0501038_0043837 3300049574 Bacteria 3889
394 Ga0501040_0029637 3300049576 Bacteria 3695
395 Ga0501042_0032619 3300049578 Bacteria 3689
396 Ga0501042_0127385 3300049578 Bacteria 1834
397 Ga0501043_0014030 3300049579 Bacteria 6271
398 Ga0501046_0073951 3300049580 Bacteria 2644
399 Ga0501046_0199208 3300049580 Bacteria 1490
400 Ga0501048_0037869 3300049582 Bacteria 3463
401 Ga0501048_0190637 3300049582 Bacteria 1453
402 Ga0501067_0024222 3300049583 Bacteria 3366
403 Ga0501068_0001133 3300049584 Bacteria 14117
404 Ga0501068_0002018 3300049584 Bacteria 10801
405 Ga0501070_0029647 3300049586 Bacteria 4586
406 Ga0501070_0106166 3300049586 Bacteria 2321
407 Ga0501070_0127182 3300049586 Bacteria 2105
408 Ga0501070_0143371 3300049586 Bacteria 1972
409 Ga0501071_0015620 3300049587 Bacteria 5213
410 Ga0501071_0051723 3300049587 Bacteria 2961
411 Ga0501072_0016781 3300049588 Bacteria 5622
412 Ga0501073_0001730 3300049589 Bacteria 16225
413 Ga0501074_0004326 3300049590 Bacteria 10143
414 Ga0501075_0040464 3300049591 Bacteria 3490
415 Ga0501075_0056735 3300049591 Bacteria 2949
416 Ga0501076_0003513 3300049592 Bacteria 11015
417 Ga0501076_0109849 3300049592 Bacteria 2229
418 Ga0501077_0007747 3300049593 Bacteria 6627
419 Ga0501077_0033444 3300049593 Bacteria 3272
420 Ga0501077_0040108 3300049593 Bacteria 2983
421 Ga0501077_0118318 3300049593 Bacteria 1679
422 Ga0501217_014671 3300049661 Bacteria 1774
423 Ga0501079_0000176 3300049741 Bacteria 36131
424 Ga0501079_0181498 3300049741 Bacteria 1642
425 Ga0501079_0278000 3300049741 Bacteria 1309
426 Ga0501080_0028968 3300049742 Bacteria 5155
427 Ga0501081_0027405 3300049743 Bacteria 3844
428 Ga0501083_0045311 3300049744 Bacteria 2976
429 Ga0501044_0138984 3300049823 Bacteria 2418
430 Ga0501045_0020041 3300049824 Bacteria 4774
431 nmdc:mga03683_7872_c1 3300050489 Bacteria 3721
432 nmdc:mga0yw44_93766_c1 3300050492 Bacteria 1902
433 nmdc:mga0k408_15659_c1 3300050493 Bacteria 4197
434 nmdc:mga06z11_32040_c1 3300050494 Bacteria 2560
435 nmdc:mga07m45_3954_c1 3300050496 Bacteria 7203
436 nmdc:mga05p37_117884_c1 3300050507 Bacteria 3262
437 nmdc:mga05p37_2104_c1 3300050507 Bacteria 23255
438 nmdc:mga05p37_42043_c1 3300050507 Bacteria 5614
439 nmdc:mga09592_1337_c1 3300050508 Bacteria 19755
440 nmdc:mga09592_8636_c1 3300050508 Bacteria 8288
441 nmdc:mga09592_92997_c1 3300050508 Bacteria 2578
442 nmdc:mga0qj67_117743_c1 3300050509 Bacteria 2147
443 nmdc:mga0qj67_3666_c1 3300050509 Bacteria 11087
444 nmdc:mga0qj67_88634_c1 3300050509 Bacteria 2484
445 nmdc:mga06r32_159_c1 3300050510 Bacteria 51926
446 nmdc:mga06r32_2646_c1 3300050510 Bacteria 15998
447 nmdc:mga08y16_1034_c1 3300050511 Bacteria 27262
448 nmdc:mga08y16_127890_c1 3300050511 Bacteria 2643
449 nmdc:mga08y16_2874_c1 3300050511 Bacteria 17720
450 nmdc:mga08y16_66970_c1 3300050511 Bacteria 3747
451 nmdc:mga0n895_3358_c1 3300050512 Bacteria 12869
452 nmdc:mga08x19_135384_c1 3300050514 Bacteria 1660
453 nmdc:mga0a205_17458_c1 3300050515 Bacteria 6729
454 nmdc:mga0sz30_4264_c1 3300050516 Bacteria 5156
455 Ga0500644_0013867 3300053088 Bacteria 2261
456 Ga0500651_0123373 3300053093 Bacteria 1571
457 Ga0500595_002165 3300053119 Bacteria 9988
458 Ga0500642_0001037 3300053130 Bacteria 8007
459 Ga0500568_0057870 3300053139 Bacteria 1507
460 Ga0500616_0001125 3300053153 Bacteria 27512
461 Ga0500552_007454 3300053733 Bacteria 1263
462 Ga0501084_0024470 3300054114 Bacteria 5037
463 Ga0501084_0048334 3300054114 Bacteria 3561
464 Ga0501084_0049799 3300054114 Bacteria 3507
465 Ga0501082_0006979 3300060353 Bacteria 9752
466 Ga0501082_0027241 3300060353 Bacteria 4921
467 Ga0501082_0050210 3300060353 Bacteria 3597
468 Ga0530510_0002737 3300061734 Bacteria 12117

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10142131 Ga0207680_101421312 294
2 3300049582 Ga0501048_0190637 Ga0501048_0190637_409_1404 301
3 3300039450 Ga0436363_0923907 Ga0436363_0923907_100_1233 305
4 3300005844 Ga0068862_100040378 Ga0068862_1000403783 310
5 3300025938 Ga0207704_10268935 Ga0207704_102689351 313
6 3300009101 Ga0105247_10288100 Ga0105247_102881001 316
7 3300049591 Ga0501075_0056735 Ga0501075_0056735_1276_2442 325
8 3300049593 Ga0501077_0118318 Ga0501077_0118318_385_1551 325
9 3300049741 Ga0501079_0181498 Ga0501079_0181498_464_1630 325
10 3300054114 Ga0501084_0049799 Ga0501084_0049799_2032_3198 325
11 3300005354 Ga0070675_100103162 Ga0070675_1001031622 330
12 3300025940 Ga0207691_10162503 Ga0207691_101625032 330
13 3300006237 Ga0097621_100211089 Ga0097621_1002110891 332
14 3300025931 Ga0207644_10227720 Ga0207644_102277201 332
15 3300005327 Ga0070658_10016126 Ga0070658_100161264 334
16 3300005548 Ga0070665_100130213 Ga0070665_1001302132 334
17 3300009093 Ga0105240_10177017 Ga0105240_101770172 334
18 3300009551 Ga0105238_10034325 Ga0105238_100343256 334
19 3300010375 Ga0105239_10100766 Ga0105239_101007663 334
20 3300025909 Ga0207705_10044444 Ga0207705_100444443 334
21 3300025913 Ga0207695_10040372 Ga0207695_100403722 334
22 3300026116 Ga0207674_10147188 Ga0207674_101471882 334
23 3300028379 Ga0268266_10085728 Ga0268266_100857282 334
24 3300037418 Ga0395900_0065795 Ga0395900_0065795_1141_2262 334
25 3300037466 Ga0395898_0111771 Ga0395898_0111771_1248_2369 334
26 3300050509 nmdc:mga0qj67_88634_c1 nmdc:mga0qj67_88634_c1_638_1741 334
27 3300005518 Ga0070699_100244907 Ga0070699_1002449072 336
28 3300005347 Ga0070668_100017012 Ga0070668_1000170124 337
29 3300005353 Ga0070669_100006253 Ga0070669_1000062538 337
30 3300005354 Ga0070675_100123024 Ga0070675_1001230242 337
31 3300005355 Ga0070671_100078425 Ga0070671_1000784253 337
32 3300005364 Ga0070673_100007877 Ga0070673_1000078774 337
33 3300005457 Ga0070662_100154519 Ga0070662_1001545192 337
34 3300005459 Ga0068867_100033635 Ga0068867_1000336354 337
35 3300005518 Ga0070699_100144710 Ga0070699_1001447103 337
36 3300005543 Ga0070672_100301487 Ga0070672_1003014872 337
37 3300005618 Ga0068864_100116017 Ga0068864_1001160172 337
38 3300005719 Ga0068861_100023444 Ga0068861_1000234444 337
39 3300005843 Ga0068860_100101162 Ga0068860_1001011622 337
40 3300006844 Ga0075428_100091973 Ga0075428_1000919732 337
41 3300013306 Ga0163162_10091827 Ga0163162_100918272 337
42 3300013308 Ga0157375_10003565 Ga0157375_100035658 337
43 3300014325 Ga0163163_10114562 Ga0163163_101145621 337
44 3300014969 Ga0157376_10423692 Ga0157376_104236922 337
45 3300017792 Ga0163161_10112357 Ga0163161_101123572 337
46 3300025925 Ga0207650_10154528 Ga0207650_101545282 337
47 3300025926 Ga0207659_10139061 Ga0207659_101390612 337
48 3300025933 Ga0207706_10111711 Ga0207706_101117112 337
49 3300025940 Ga0207691_10003560 Ga0207691_100035607 337
50 3300025972 Ga0207668_10086608 Ga0207668_100866083 337
51 3300026088 Ga0207641_10083662 Ga0207641_100836622 337
52 3300026088 Ga0207641_10102064 Ga0207641_101020643 337
53 3300026089 Ga0207648_10113470 Ga0207648_101134702 337
54 3300026095 Ga0207676_10110070 Ga0207676_101100702 337
55 3300026118 Ga0207675_100102422 Ga0207675_1001024222 337
56 3300028380 Ga0268265_10258244 Ga0268265_102582442 337
57 3300035695 Ga0373927_0135441 Ga0373927_0135441_151_1281 337
58 3300036401 Ga0373937_0154297 Ga0373937_0154297_742_1872 337
59 iso_pu_bacteria 2883291878 2883295038 339
60 3300005335 Ga0070666_10001642 Ga0070666_100016429 340
61 3300005341 Ga0070691_10001763 Ga0070691_100017636 340
62 3300009093 Ga0105240_10007263 Ga0105240_100072634 340
63 3300010375 Ga0105239_10044346 Ga0105239_100443463 340
64 3300031548 Ga0307408_100138358 Ga0307408_1001383582 340
65 3300036401 Ga0373937_0226998 Ga0373937_0226998_588_1712 340
66 3300037312 Ga0395899_0238216 Ga0395899_0238216_38_1081 340
67 3300039450 Ga0436363_0550910 Ga0436363_0550910_5663_6787 340
68 3300049586 Ga0501070_0106166 Ga0501070_0106166_304_1428 340
69 3300053119 Ga0500595_002165 Ga0500595_002165_8540_9667 340
70 iso_pu_bacteria 2894772417 2894776139 340
71 3300006042 Ga0075368_10000907 Ga0075368_1000090712 341
72 3300006178 Ga0075367_10004458 Ga0075367_100044588 341
73 3300009147 Ga0114129_10312791 Ga0114129_103127911 341
74 3300025921 Ga0207652_10090860 Ga0207652_100908602 341
75 3300031250 Ga0265331_10000003 Ga0265331_10000003401 341
76 3300031711 Ga0265314_10085981 Ga0265314_100859812 341
77 3300050496 nmdc:mga07m45_3954_c1 nmdc:mga07m45_3954_c1_4244_5371 341
78 3300005290 Ga0065712_10095512 Ga0065712_100955122 342
79 3300005293 Ga0065715_10110976 Ga0065715_101109761 342
80 3300005295 Ga0065707_10081743 Ga0065707_1008174324 342
81 3300005327 Ga0070658_10007220 Ga0070658_100072203 342
82 3300005330 Ga0070690_100009545 Ga0070690_1000095454 342
83 3300005331 Ga0070670_100012090 Ga0070670_1000120902 342
84 3300005331 Ga0070670_100161939 Ga0070670_1001619392 342
85 3300005334 Ga0068869_100001906 Ga0068869_1000019069 342
86 3300005334 Ga0068869_100007868 Ga0068869_1000078682 342
87 3300005334 Ga0068869_100029433 Ga0068869_1000294331 342
88 3300005335 Ga0070666_10036422 Ga0070666_100364224 342
89 3300005340 Ga0070689_100067632 Ga0070689_1000676322 342
90 3300005341 Ga0070691_10009930 Ga0070691_100099302 342
91 3300005344 Ga0070661_100028450 Ga0070661_1000284502 342
92 3300005344 Ga0070661_100066587 Ga0070661_1000665872 342
93 3300005347 Ga0070668_100025836 Ga0070668_1000258363 342
94 3300005353 Ga0070669_100068823 Ga0070669_1000688232 342
95 3300005354 Ga0070675_100011231 Ga0070675_1000112316 342
96 3300005354 Ga0070675_100035733 Ga0070675_1000357333 342
97 3300005355 Ga0070671_100218772 Ga0070671_1002187721 342
98 3300005364 Ga0070673_100092267 Ga0070673_1000922672 342
99 3300005365 Ga0070688_100093577 Ga0070688_1000935772 342
100 3300005367 Ga0070667_100010842 Ga0070667_1000108427 342
101 3300005367 Ga0070667_100128680 Ga0070667_1001286802 342
102 3300005436 Ga0070713_100151708 Ga0070713_1001517082 342
103 3300005440 Ga0070705_100059677 Ga0070705_1000596772 342
104 3300005441 Ga0070700_100059164 Ga0070700_1000591641 342
105 3300005457 Ga0070662_100013048 Ga0070662_1000130482 342
106 3300005458 Ga0070681_10000213 Ga0070681_100002132 342
107 3300005458 Ga0070681_10063742 Ga0070681_100637422 342
108 3300005459 Ga0068867_100031185 Ga0068867_1000311851 342
109 3300005459 Ga0068867_100031756 Ga0068867_1000317563 342
110 3300005466 Ga0070685_10047704 Ga0070685_100477042 342
111 3300005535 Ga0070684_100006131 Ga0070684_1000061312 342
112 3300005539 Ga0068853_100007541 Ga0068853_1000075417 342
113 3300005543 Ga0070672_100010704 Ga0070672_1000107046 342
114 3300005548 Ga0070665_100010676 Ga0070665_1000106765 342
115 3300005548 Ga0070665_100015917 Ga0070665_1000159177 342
116 3300005549 Ga0070704_100093157 Ga0070704_1000931571 342
117 3300005563 Ga0068855_100008507 Ga0068855_1000085075 342
118 3300005564 Ga0070664_100012704 Ga0070664_1000127046 342
119 3300005577 Ga0068857_100008579 Ga0068857_1000085792 342
120 3300005577 Ga0068857_100010692 Ga0068857_1000106926 342
121 3300005577 Ga0068857_100052316 Ga0068857_1000523162 342
122 3300005615 Ga0070702_100009956 Ga0070702_1000099563 342
123 3300005617 Ga0068859_100006352 Ga0068859_1000063522 342
124 3300005617 Ga0068859_100026976 Ga0068859_1000269766 342
125 3300005617 Ga0068859_100082792 Ga0068859_1000827921 342
126 3300005617 Ga0068859_100116961 Ga0068859_1001169612 342
127 3300005617 Ga0068859_100220424 Ga0068859_1002204242 342
128 3300005618 Ga0068864_100009835 Ga0068864_1000098356 342
129 3300005618 Ga0068864_100140380 Ga0068864_1001403802 342
130 3300005719 Ga0068861_100001029 Ga0068861_10000102913 342
131 3300005719 Ga0068861_100079984 Ga0068861_1000799842 342
132 3300005719 Ga0068861_100414302 Ga0068861_1004143021 342
133 3300005841 Ga0068863_100001391 Ga0068863_10000139120 342
134 3300005841 Ga0068863_100011421 Ga0068863_1000114216 342
135 3300005841 Ga0068863_100157359 Ga0068863_1001573592 342
136 3300005841 Ga0068863_100159775 Ga0068863_1001597753 342
137 3300005842 Ga0068858_100046353 Ga0068858_1000463533 342
138 3300005843 Ga0068860_100012899 Ga0068860_1000128997 342
139 3300005843 Ga0068860_100038631 Ga0068860_1000386312 342
140 3300005843 Ga0068860_100040194 Ga0068860_1000401941 342
141 3300005843 Ga0068860_100083571 Ga0068860_1000835714 342
142 3300005843 Ga0068860_100134835 Ga0068860_1001348352 342
143 3300005844 Ga0068862_100001992 Ga0068862_1000019926 342
144 3300005844 Ga0068862_100048706 Ga0068862_1000487062 342
145 3300005844 Ga0068862_100134407 Ga0068862_1001344072 342
146 3300005937 Ga0081455_10000347 Ga0081455_1000034732 342
147 3300005937 Ga0081455_10002115 Ga0081455_100021156 342
148 3300005937 Ga0081455_10030259 Ga0081455_100302596 342
149 3300005981 Ga0081538_10018402 Ga0081538_100184023 342
150 3300006237 Ga0097621_100006196 Ga0097621_1000061966 342
151 3300006237 Ga0097621_100008103 Ga0097621_1000081032 342
152 3300006237 Ga0097621_100254431 Ga0097621_1002544311 342
153 3300006358 Ga0068871_100006155 Ga0068871_1000061556 342
154 3300006358 Ga0068871_100231707 Ga0068871_1002317072 342
155 3300006358 Ga0068871_100255882 Ga0068871_1002558822 342
156 3300006844 Ga0075428_100001014 Ga0075428_1000010142 342
157 3300006844 Ga0075428_100004912 Ga0075428_10000491212 342
158 3300006844 Ga0075428_100054639 Ga0075428_1000546392 342
159 3300006844 Ga0075428_100101160 Ga0075428_1001011602 342
160 3300006844 Ga0075428_100136743 Ga0075428_1001367432 342
161 3300006846 Ga0075430_100018809 Ga0075430_1000188095 342
162 3300006847 Ga0075431_100000030 Ga0075431_10000003051 342
163 3300006847 Ga0075431_100114324 Ga0075431_1001143242 342
164 3300006871 Ga0075434_100000154 Ga0075434_10000015421 342
165 3300006880 Ga0075429_100001752 Ga0075429_1000017529 342
166 3300006880 Ga0075429_100002466 Ga0075429_1000024669 342
167 3300006881 Ga0068865_100035407 Ga0068865_1000354072 342
168 3300006881 Ga0068865_100092532 Ga0068865_1000925322 342
169 3300006881 Ga0068865_100116272 Ga0068865_1001162722 342
170 3300006914 Ga0075436_100146742 Ga0075436_1001467421 342
171 3300006931 Ga0097620_100006352 Ga0097620_1000063522 342
172 3300006931 Ga0097620_100026976 Ga0097620_1000269766 342
173 3300006931 Ga0097620_100082790 Ga0097620_1000827901 342
174 3300006931 Ga0097620_100116958 Ga0097620_1001169582 342
175 3300006931 Ga0097620_100220419 Ga0097620_1002204192 342
176 3300009093 Ga0105240_10372374 Ga0105240_103723742 342
177 3300009094 Ga0111539_10004009 Ga0111539_100040094 342
178 3300009094 Ga0111539_10004730 Ga0111539_1000473020 342
179 3300009094 Ga0111539_10200042 Ga0111539_102000422 342
180 3300009094 Ga0111539_10244392 Ga0111539_102443922 342
181 3300009094 Ga0111539_10307670 Ga0111539_103076702 342
182 3300009098 Ga0105245_10006170 Ga0105245_100061708 342
183 3300009101 Ga0105247_10089564 Ga0105247_100895642 342
184 3300009147 Ga0114129_10004229 Ga0114129_1000422913 342
185 3300009147 Ga0114129_10015376 Ga0114129_100153767 342
186 3300009147 Ga0114129_10022290 Ga0114129_100222909 342
187 3300009174 Ga0105241_10020212 Ga0105241_100202126 342
188 3300009176 Ga0105242_10013402 Ga0105242_100134024 342
189 3300009177 Ga0105248_10000417 Ga0105248_1000041724 342
190 3300009177 Ga0105248_10003913 Ga0105248_1000391311 342
191 3300009177 Ga0105248_10004863 Ga0105248_100048632 342
192 3300009545 Ga0105237_10040208 Ga0105237_100402083 342
193 3300009551 Ga0105238_10303927 Ga0105238_103039271 342
194 3300009553 Ga0105249_10008214 Ga0105249_100082146 342
195 3300009553 Ga0105249_10082490 Ga0105249_100824902 342
196 3300010159 Ga0099796_10000033 Ga0099796_1000003325 342
197 3300010159 Ga0099796_10020680 Ga0099796_100206802 342
198 3300011119 Ga0105246_10087212 Ga0105246_100872122 342
199 3300013296 Ga0157374_10038823 Ga0157374_100388234 342
200 3300013307 Ga0157372_10022136 Ga0157372_100221362 342
201 3300013307 Ga0157372_10133632 Ga0157372_101336323 342
202 3300013307 Ga0157372_10187815 Ga0157372_101878152 342
203 3300013308 Ga0157375_10013845 Ga0157375_100138456 342
204 3300013308 Ga0157375_10039336 Ga0157375_100393362 342
205 3300013308 Ga0157375_10067992 Ga0157375_100679923 342
206 3300013308 Ga0157375_10444344 Ga0157375_104443441 342
207 3300014325 Ga0163163_10024323 Ga0163163_100243233 342
208 3300014325 Ga0163163_10048110 Ga0163163_100481104 342
209 3300014325 Ga0163163_10075394 Ga0163163_100753944 342
210 3300014325 Ga0163163_10086052 Ga0163163_100860522 342
211 3300014326 Ga0157380_10009987 Ga0157380_100099876 342
212 3300014326 Ga0157380_10020174 Ga0157380_100201742 342
213 3300014745 Ga0157377_10023226 Ga0157377_100232262 342
214 3300014968 Ga0157379_10010858 Ga0157379_100108582 342
215 3300014968 Ga0157379_10067275 Ga0157379_100672752 342
216 3300014968 Ga0157379_10172414 Ga0157379_101724142 342
217 3300014968 Ga0157379_10175686 Ga0157379_101756862 342
218 3300014969 Ga0157376_10006638 Ga0157376_100066385 342
219 3300014969 Ga0157376_10015671 Ga0157376_100156712 342
220 3300021361 Ga0213872_10049442 Ga0213872_100494422 342
221 3300021377 Ga0213874_10008350 Ga0213874_100083502 342
222 3300021384 Ga0213876_10000115 Ga0213876_1000011570 342
223 3300021384 Ga0213876_10006737 Ga0213876_100067377 342
224 3300025291 Ga0209675_1003156 Ga0209675_10031562 342
225 3300025901 Ga0207688_10073634 Ga0207688_100736342 342
226 3300025903 Ga0207680_10007639 Ga0207680_100076392 342
227 3300025907 Ga0207645_10133476 Ga0207645_101334762 342
228 3300025907 Ga0207645_10190118 Ga0207645_101901182 342
229 3300025909 Ga0207705_10035640 Ga0207705_100356403 342
230 3300025911 Ga0207654_10057815 Ga0207654_100578152 342
231 3300025912 Ga0207707_10007070 Ga0207707_100070706 342
232 3300025913 Ga0207695_10151824 Ga0207695_101518242 342
233 3300025914 Ga0207671_10027687 Ga0207671_100276873 342
234 3300025917 Ga0207660_10002463 Ga0207660_1000246314 342
235 3300025920 Ga0207649_10033489 Ga0207649_100334892 342
236 3300025923 Ga0207681_10010252 Ga0207681_100102522 342
237 3300025923 Ga0207681_10040921 Ga0207681_100409213 342
238 3300025923 Ga0207681_10059895 Ga0207681_100598952 342
239 3300025923 Ga0207681_10141404 Ga0207681_101414042 342
240 3300025925 Ga0207650_10027428 Ga0207650_100274284 342
241 3300025925 Ga0207650_10087461 Ga0207650_100874612 342
242 3300025926 Ga0207659_10002224 Ga0207659_100022241 342
243 3300025926 Ga0207659_10045166 Ga0207659_100451662 342
244 3300025926 Ga0207659_10063792 Ga0207659_100637922 342
245 3300025931 Ga0207644_10229071 Ga0207644_102290712 342
246 3300025931 Ga0207644_10314168 Ga0207644_103141681 342
247 3300025933 Ga0207706_10008999 Ga0207706_100089994 342
248 3300025933 Ga0207706_10126607 Ga0207706_101266072 342
249 3300025933 Ga0207706_10192334 Ga0207706_101923342 342
250 3300025933 Ga0207706_10199719 Ga0207706_101997192 342
251 3300025934 Ga0207686_10059985 Ga0207686_100599852 342
252 3300025936 Ga0207670_10214582 Ga0207670_102145822 342
253 3300025938 Ga0207704_10046540 Ga0207704_100465403 342
254 3300025940 Ga0207691_10012272 Ga0207691_100122722 342
255 3300025940 Ga0207691_10019933 Ga0207691_100199334 342
256 3300025940 Ga0207691_10023600 Ga0207691_100236002 342
257 3300025941 Ga0207711_10016947 Ga0207711_100169472 342
258 3300025941 Ga0207711_10097775 Ga0207711_100977752 342
259 3300025942 Ga0207689_10001586 Ga0207689_1000158614 342
260 3300025942 Ga0207689_10006575 Ga0207689_100065757 342
261 3300025942 Ga0207689_10037057 Ga0207689_100370574 342
262 3300025945 Ga0207679_10007670 Ga0207679_100076704 342
263 3300025949 Ga0207667_10115583 Ga0207667_101155833 342
264 3300025960 Ga0207651_10016436 Ga0207651_100164362 342
265 3300025961 Ga0207712_10003847 Ga0207712_100038474 342
266 3300025961 Ga0207712_10025217 Ga0207712_100252172 342
267 3300025986 Ga0207658_10085209 Ga0207658_100852092 342
268 3300025986 Ga0207658_10211062 Ga0207658_102110622 342
269 3300026035 Ga0207703_10029230 Ga0207703_100292303 342
270 3300026041 Ga0207639_10001641 Ga0207639_1000164112 342
271 3300026075 Ga0207708_10132676 Ga0207708_101326761 342
272 3300026075 Ga0207708_10227216 Ga0207708_102272162 342
273 3300026088 Ga0207641_10044066 Ga0207641_100440662 342
274 3300026088 Ga0207641_10060603 Ga0207641_100606033 342
275 3300026088 Ga0207641_10139894 Ga0207641_101398943 342
276 3300026089 Ga0207648_10043569 Ga0207648_100435692 342
277 3300026095 Ga0207676_10006221 Ga0207676_100062214 342
278 3300026095 Ga0207676_10007041 Ga0207676_100070414 342
279 3300026095 Ga0207676_10016908 Ga0207676_100169084 342
280 3300026116 Ga0207674_10015074 Ga0207674_100150744 342
281 3300026116 Ga0207674_10027912 Ga0207674_100279124 342
282 3300026116 Ga0207674_10067009 Ga0207674_100670094 342
283 3300026118 Ga0207675_100001358 Ga0207675_10000135813 342
284 3300026118 Ga0207675_100004919 Ga0207675_1000049195 342
285 3300026118 Ga0207675_100031410 Ga0207675_1000314104 342
286 3300026118 Ga0207675_100043990 Ga0207675_1000439905 342
287 3300026118 Ga0207675_100115914 Ga0207675_1001159142 342
288 3300026121 Ga0207683_10216298 Ga0207683_102162982 342
289 3300027512 Ga0209179_1000055 Ga0209179_100005513 342
290 3300027876 Ga0209974_10047290 Ga0209974_100472902 342
291 3300027907 Ga0207428_10000848 Ga0207428_1000084827 342
292 3300027907 Ga0207428_10001822 Ga0207428_1000182224 342
293 3300027907 Ga0207428_10018693 Ga0207428_100186932 342
294 3300027907 Ga0207428_10258223 Ga0207428_102582232 342
295 3300028379 Ga0268266_10021888 Ga0268266_100218882 342
296 3300028379 Ga0268266_10309302 Ga0268266_103093022 342
297 3300028380 Ga0268265_10039321 Ga0268265_100393212 342
298 3300028380 Ga0268265_10063318 Ga0268265_100633182 342
299 3300028380 Ga0268265_10249937 Ga0268265_102499372 342
300 3300028381 Ga0268264_10009015 Ga0268264_100090154 342
301 3300028381 Ga0268264_10016792 Ga0268264_100167924 342
302 3300028381 Ga0268264_10064910 Ga0268264_100649104 342
303 3300031238 Ga0265332_10001809 Ga0265332_1000180913 342
304 3300031239 Ga0265328_10001376 Ga0265328_100013763 342
305 3300031241 Ga0265325_10012767 Ga0265325_100127673 342
306 3300031247 Ga0265340_10001783 Ga0265340_100017836 342
307 3300031249 Ga0265339_10004680 Ga0265339_100046802 342
308 3300031250 Ga0265331_10015259 Ga0265331_100152593 342
309 3300031251 Ga0265327_10013661 Ga0265327_100136613 342
310 3300031344 Ga0265316_10057480 Ga0265316_100574801 342
311 3300031344 Ga0265316_10071859 Ga0265316_100718592 342
312 3300031456 Ga0307513_10091688 Ga0307513_100916882 342
313 3300031507 Ga0307509_10018026 Ga0307509_100180264 342
314 3300031548 Ga0307408_100005579 Ga0307408_1000055793 342
315 3300031548 Ga0307408_100093019 Ga0307408_1000930192 342
316 3300031548 Ga0307408_100134637 Ga0307408_1001346372 342
317 3300031665 Ga0316575_10016884 Ga0316575_100168842 342
318 3300031711 Ga0265314_10075075 Ga0265314_100750752 342
319 3300031712 Ga0265342_10000210 Ga0265342_1000021063 342
320 3300031712 Ga0265342_10087194 Ga0265342_100871942 342
321 3300031727 Ga0316576_10065269 Ga0316576_100652692 342
322 3300031727 Ga0316576_10143851 Ga0316576_101438512 342
323 3300031731 Ga0307405_10004202 Ga0307405_100042026 342
324 3300031852 Ga0307410_10073643 Ga0307410_100736432 342
325 3300031903 Ga0307407_10177203 Ga0307407_101772031 342
326 3300031995 Ga0307409_100172153 Ga0307409_1001721532 342
327 3300031995 Ga0307409_100212697 Ga0307409_1002126972 342
328 3300032002 Ga0307416_100003806 Ga0307416_1000038066 342
329 3300032002 Ga0307416_100062924 Ga0307416_1000629242 342
330 3300032004 Ga0307414_10284963 Ga0307414_102849632 342
331 3300035114 Ga0373939_0031264 Ga0373939_0031264_330_1457 342
332 3300037068 Ga0373925_0135397 Ga0373925_0135397_372_1520 342
333 3300037312 Ga0395899_0095228 Ga0395899_0095228_498_1646 342
334 3300037418 Ga0395900_0019725 Ga0395900_0019725_926_2074 342
335 3300037418 Ga0395900_0181023 Ga0395900_0181023_779_1915 342
336 3300037466 Ga0395898_0017545 Ga0395898_0017545_5133_6281 342
337 3300038443 Ga0395901_0020486 Ga0395901_0020486_4867_6015 342
338 3300038443 Ga0395901_0097909 Ga0395901_0097909_675_1823 342
339 3300039437 Ga0436365_0507621 Ga0436365_0507621_58075_59199 342
340 3300039437 Ga0436365_0737310 Ga0436365_0737310_13369_14517 342
341 3300039438 Ga0436360_0477258 Ga0436360_0477258_12996_14144 342
342 3300039447 Ga0436361_0004926 Ga0436361_0004926_8687_9817 342
343 3300039447 Ga0436361_0814330 Ga0436361_0814330_701_1849 342
344 3300039450 Ga0436363_0571997 Ga0436363_0571997_12_1139 342
345 3300041410 Ga0439461_0007791 Ga0439461_0007791_719_1852 342
346 3300041413 Ga0439465_0027594 Ga0439465_0027594_63_1211 342
347 3300042009 Ga0439451_011533 Ga0439451_011533_446_1579 342
348 3300042131 Ga0450894_003826 Ga0450894_003826_549_1679 342
349 3300042156 Ga0439446_0001262 Ga0439446_0001262_4455_5588 342
350 3300042156 Ga0439446_0003380 Ga0439446_0003380_2794_3927 342
351 3300042435 Ga0439434_0002952 Ga0439434_0002952_2636_3769 342
352 3300042435 Ga0439434_0045178 Ga0439434_0045178_113_1240 342
353 3300042436 Ga0439435_0000169 Ga0439435_0000169_4033_5166 342
354 3300042437 Ga0439444_0007278 Ga0439444_0007278_231_1364 342
355 3300042461 Ga0439460_0000411 Ga0439460_0000411_4179_5312 342
356 3300042876 Ga0451577_0266116 Ga0451577_0266116_343_1476 342
357 3300044673 Ga0453683_0128238 Ga0453683_0128238_268_1482 342
358 3300044712 Ga0453684_0000163 Ga0453684_0000163_181394_182527 342
359 3300044712 Ga0453684_0348111 Ga0453684_0348111_301_1518 342
360 3300045051 Ga0451576_0002793 Ga0451576_0002793_19903_21036 342
361 3300045051 Ga0451576_0030042 Ga0451576_0030042_3935_5062 342
362 3300046460 Ga0495638_0002250 Ga0495638_0002250_6118_7254 342
363 3300046461 Ga0495641_0026684 Ga0495641_0026684_856_1983 342
364 3300046660 Ga0495625_0005703 Ga0495625_0005703_4015_5151 342
365 3300048903 Ga0496100_0126841 Ga0496100_0126841_27_1148 342
366 3300048905 Ga0496102_0193327 Ga0496102_0193327_729_1862 342
367 3300048907 Ga0496104_0178178 Ga0496104_0178178_123_1250 342
368 3300048907 Ga0496104_0187281 Ga0496104_0187281_615_1739 342
369 3300048908 Ga0496105_0090126 Ga0496105_0090126_1059_2183 342
370 3300048909 Ga0496106_0119623 Ga0496106_0119623_696_1820 342
371 3300048911 Ga0496108_0027380 Ga0496108_0027380_1635_2759 342
372 3300048911 Ga0496108_0174594 Ga0496108_0174594_113_1234 342
373 3300048912 Ga0496109_0045048 Ga0496109_0045048_872_1999 342
374 3300048913 Ga0496110_0009800 Ga0496110_0009800_4231_5355 342
375 3300048914 Ga0496111_0008249 Ga0496111_0008249_1883_3007 342
376 3300048916 Ga0496113_0066492 Ga0496113_0066492_194_1321 342
377 3300048917 Ga0496114_0014914 Ga0496114_0014914_1108_2232 342
378 3300048917 Ga0496114_0033870 Ga0496114_0033870_820_1941 342
379 3300049568 Ga0501031_0030379 Ga0501031_0030379_141_1310 342
380 3300049574 Ga0501038_0043837 Ga0501038_0043837_578_1747 342
381 3300049576 Ga0501040_0029637 Ga0501040_0029637_2217_3386 342
382 3300049578 Ga0501042_0032619 Ga0501042_0032619_1287_2456 342
383 3300049579 Ga0501043_0014030 Ga0501043_0014030_1525_2694 342
384 3300049580 Ga0501046_0073951 Ga0501046_0073951_856_1983 342
385 3300049580 Ga0501046_0199208 Ga0501046_0199208_110_1279 342
386 3300049582 Ga0501048_0037869 Ga0501048_0037869_1842_3011 342
387 3300049583 Ga0501067_0024222 Ga0501067_0024222_1013_2140 342
388 3300049584 Ga0501068_0001133 Ga0501068_0001133_5059_6186 342
389 3300049586 Ga0501070_0029647 Ga0501070_0029647_2010_3137 342
390 3300049586 Ga0501070_0127182 Ga0501070_0127182_286_1416 342
391 3300049586 Ga0501070_0143371 Ga0501070_0143371_682_1851 342
392 3300049587 Ga0501071_0015620 Ga0501071_0015620_3791_4918 342
393 3300049587 Ga0501071_0051723 Ga0501071_0051723_155_1324 342
394 3300049588 Ga0501072_0016781 Ga0501072_0016781_2551_3720 342
395 3300049589 Ga0501073_0001730 Ga0501073_0001730_9041_10168 342
396 3300049590 Ga0501074_0004326 Ga0501074_0004326_3829_4956 342
397 3300049591 Ga0501075_0040464 Ga0501075_0040464_421_1590 342
398 3300049592 Ga0501076_0003513 Ga0501076_0003513_567_1694 342
399 3300049592 Ga0501076_0109849 Ga0501076_0109849_661_1788 342
400 3300049593 Ga0501077_0007747 Ga0501077_0007747_1658_2785 342
401 3300049593 Ga0501077_0033444 Ga0501077_0033444_2019_3146 342
402 3300049593 Ga0501077_0040108 Ga0501077_0040108_554_1723 342
403 3300049661 Ga0501217_014671 Ga0501217_014671_267_1406 342
404 3300049741 Ga0501079_0000176 Ga0501079_0000176_31196_32323 342
405 3300049741 Ga0501079_0278000 Ga0501079_0278000_20_1192 342
406 3300049742 Ga0501080_0028968 Ga0501080_0028968_3860_4987 342
407 3300049743 Ga0501081_0027405 Ga0501081_0027405_1937_3106 342
408 3300049744 Ga0501083_0045311 Ga0501083_0045311_1224_2393 342
409 3300049823 Ga0501044_0138984 Ga0501044_0138984_1004_2155 342
410 3300049824 Ga0501045_0020041 Ga0501045_0020041_1517_2686 342
411 3300050489 nmdc:mga03683_7872_c1 nmdc:mga03683_7872_c1_1722_2870 342
412 3300050492 nmdc:mga0yw44_93766_c1 nmdc:mga0yw44_93766_c1_396_1544 342
413 3300050494 nmdc:mga06z11_32040_c1 nmdc:mga06z11_32040_c1_977_2125 342
414 3300050507 nmdc:mga05p37_117884_c1 nmdc:mga05p37_117884_c1_958_2088 342
415 3300050507 nmdc:mga05p37_2104_c1 nmdc:mga05p37_2104_c1_11381_12508 342
416 3300050507 nmdc:mga05p37_42043_c1 nmdc:mga05p37_42043_c1_183_1310 342
417 3300050508 nmdc:mga09592_1337_c1 nmdc:mga09592_1337_c1_15367_16494 342
418 3300050508 nmdc:mga09592_8636_c1 nmdc:mga09592_8636_c1_3275_4402 342
419 3300050508 nmdc:mga09592_92997_c1 nmdc:mga09592_92997_c1_179_1306 342
420 3300050509 nmdc:mga0qj67_117743_c1 nmdc:mga0qj67_117743_c1_130_1257 342
421 3300050509 nmdc:mga0qj67_3666_c1 nmdc:mga0qj67_3666_c1_3022_4149 342
422 3300050510 nmdc:mga06r32_159_c1 nmdc:mga06r32_159_c1_22964_24091 342
423 3300050510 nmdc:mga06r32_2646_c1 nmdc:mga06r32_2646_c1_2642_3769 342
424 3300050511 nmdc:mga08y16_1034_c1 nmdc:mga08y16_1034_c1_19104_20231 342
425 3300050511 nmdc:mga08y16_127890_c1 nmdc:mga08y16_127890_c1_1291_2418 342
426 3300050511 nmdc:mga08y16_2874_c1 nmdc:mga08y16_2874_c1_4058_5188 342
427 3300050511 nmdc:mga08y16_66970_c1 nmdc:mga08y16_66970_c1_646_1773 342
428 3300050512 nmdc:mga0n895_3358_c1 nmdc:mga0n895_3358_c1_4417_5547 342
429 3300050514 nmdc:mga08x19_135384_c1 nmdc:mga08x19_135384_c1_499_1620 342
430 3300050515 nmdc:mga0a205_17458_c1 nmdc:mga0a205_17458_c1_4436_5566 342
431 3300053088 Ga0500644_0013867 Ga0500644_0013867_699_1829 342
432 3300053130 Ga0500642_0001037 Ga0500642_0001037_3548_4705 342
433 3300053139 Ga0500568_0057870 Ga0500568_0057870_111_1259 342
434 3300053153 Ga0500616_0001125 Ga0500616_0001125_10322_11470 342
435 3300053733 Ga0500552_007454 Ga0500552_007454_100_1248 342
436 3300054114 Ga0501084_0024470 Ga0501084_0024470_56_1183 342
437 3300054114 Ga0501084_0048334 Ga0501084_0048334_782_1951 342
438 3300060353 Ga0501082_0006979 Ga0501082_0006979_3815_4942 342
439 3300060353 Ga0501082_0027241 Ga0501082_0027241_532_1659 342
440 3300060353 Ga0501082_0050210 Ga0501082_0050210_1698_2867 342
441 3300061734 Ga0530510_0002737 Ga0530510_0002737_2789_3958 342
442 3300005563 Ga0068855_100160004 Ga0068855_1001600042 343
443 3300005985 Ga0081539_10004851 Ga0081539_1000485114 343
444 3300005985 Ga0081539_10007682 Ga0081539_100076823 343
445 3300006177 Ga0075362_10024628 Ga0075362_100246282 343
446 3300006178 Ga0075367_10059615 Ga0075367_100596152 343
447 3300006353 Ga0075370_10034583 Ga0075370_100345833 343
448 3300009093 Ga0105240_10177010 Ga0105240_101770102 343
449 3300022467 Ga0224712_10093175 Ga0224712_100931751 343
450 3300025949 Ga0207667_10232668 Ga0207667_102326682 343
451 3300026142 Ga0207698_10066351 Ga0207698_100663512 343
452 3300027907 Ga0207428_10174941 Ga0207428_101749411 343
453 3300031241 Ga0265325_10057365 Ga0265325_100573652 343
454 3300031247 Ga0265340_10076977 Ga0265340_100769771 343
455 3300035692 Ga0373935_0054683 Ga0373935_0054683_828_1988 343
456 3300037312 Ga0395899_0001973 Ga0395899_0001973_15650_16813 343
457 3300037418 Ga0395900_0004286 Ga0395900_0004286_44_1297 343
458 3300037418 Ga0395900_0017572 Ga0395900_0017572_4030_5193 343
459 3300037466 Ga0395898_0017884 Ga0395898_0017884_2500_3753 343
460 3300038443 Ga0395901_0002102 Ga0395901_0002102_12199_13452 343
461 3300038443 Ga0395901_0033895 Ga0395901_0033895_3980_5143 343
462 3300042005 Ga0439448_0038855 Ga0439448_0038855_133_1296 343
463 3300049571 Ga0501034_0001803 Ga0501034_0001803_24370_25533 343
464 3300049571 Ga0501034_0147207 Ga0501034_0147207_476_1636 343
465 3300049578 Ga0501042_0127385 Ga0501042_0127385_623_1783 343
466 3300049584 Ga0501068_0002018 Ga0501068_0002018_157_1317 343
467 3300050493 nmdc:mga0k408_15659_c1 nmdc:mga0k408_15659_c1_595_1755 343
468 3300050516 nmdc:mga0sz30_4264_c1 nmdc:mga0sz30_4264_c1_456_1616 343
469 3300053093 Ga0500651_0123373 Ga0500651_0123373_30_1316 343
470 3300003322 rootL2_10000116 rootL2_100001169 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

47

258

0.85

PF04209

HgmA_C

Homogentisate 1,2-dioxygenase C-terminal

268

406

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5njn-assembly1.cif.gz_A roll out the beta-barrel: structure and mechanism of pac13, a unique nucleoside dehydratase 0.8908 82 164
5ooa-assembly1.cif.gz_A streptomyces pac13 (y89f) with uridine 0.8892 82 164
5oo8-assembly1.cif.gz_A streptomyces pac13 (h42q) with uridine 0.8886 82 164
5oo9-assembly1.cif.gz_A streptomyces pac13 (y55f) with uridine 0.8855 82 164
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8854 86 158
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.906 78 159 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9034 77 159 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8871 78 159 2.60.120.10
af_A0A0R0J2E3_68_132_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8865 107 155 2.60.120.10
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8806 84 156 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2D7ZH39-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9721 1 302 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A539DXS1-F1-model_v4 Homogentisate 1 2-dioxygenase 0.9687 1 230 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A539DXS1-F1-model_v4 Homogentisate 1 2-dioxygenase 0.9565 1 230 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A258VDI6-F1-model_v4 deleted 0.9559 2 331
AF-A0A2D7ZH39-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9535 1 302 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872

Feature Viewer

pLDDT pTM Quality
81.99 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map