F450449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 470 | 246 | 468 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0004286|Ga0395900_0004286_44_1297 |
| Length | 409 |
| Sequence | MSLTPSVAGYRDTSPEDGRRNEMAKNWIPLRQVEGTASRQAHVRLPEGTYEREISKEGFFGPSAQFHHKHKPTDWSDFDGPIRPRAFDLNKLVTAHANPWQAELVMNNPHLQMRIWKLDQAMPELARNSDGDQLLFVHEGAGDLFCDYGHLEYRDGDYIVIPRGTMWRLAPKQPTTTLMIEATNDHFTLPEKGIVGRHAIFDPAMLDTPHIDDAFKAQQDERPWKVSVKRRHALSTVTFPFNPLDAIGWHGDLSVVRINWRDIRPVMSHRAHLPPSAHTTFVAGRFVVCTFVPRPLESDPEALRLPFFHNNDDFDEVIFYHKGSFFSRDNIHPGMMTVHPSGFTHGPHPKAFDAATKTSVQSGGKAETDEVAVMVDTRDAIDIAAMPAGVEFEGYVKSWRPAEMKQAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 2 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 139 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 171 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 172 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 173 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 174 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 175 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 178 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 179 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 226 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 227 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 239 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 240 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 241 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 243 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 2.98 |
| Rhizosphere | 90.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10000116 | 3300003322 | Bacteria | 29881 |
| 2 | Ga0065712_10095512 | 3300005290 | Bacteria | 2207 |
| 3 | Ga0065715_10110976 | 3300005293 | Bacteria | 2594 |
| 4 | Ga0065707_10081743 | 3300005295 | Bacteria | 52414 |
| 5 | Ga0070658_10007220 | 3300005327 | Bacteria | 8966 |
| 6 | Ga0070658_10016126 | 3300005327 | Bacteria | 5976 |
| 7 | Ga0070690_100009545 | 3300005330 | Bacteria | 5624 |
| 8 | Ga0070670_100012090 | 3300005331 | Bacteria | 7381 |
| 9 | Ga0070670_100161939 | 3300005331 | Bacteria | 1939 |
| 10 | Ga0068869_100001906 | 3300005334 | Bacteria | 12536 |
| 11 | Ga0068869_100007868 | 3300005334 | Bacteria | 6840 |
| 12 | Ga0068869_100029433 | 3300005334 | Bacteria | 3848 |
| 13 | Ga0070666_10001642 | 3300005335 | Bacteria | 13628 |
| 14 | Ga0070666_10036422 | 3300005335 | Bacteria | 3266 |
| 15 | Ga0070689_100067632 | 3300005340 | Bacteria | 2785 |
| 16 | Ga0070691_10001763 | 3300005341 | Bacteria | 9416 |
| 17 | Ga0070691_10009930 | 3300005341 | Bacteria | 4338 |
| 18 | Ga0070661_100028450 | 3300005344 | Bacteria | 4032 |
| 19 | Ga0070661_100066587 | 3300005344 | Bacteria | 2647 |
| 20 | Ga0070668_100017012 | 3300005347 | Bacteria | 5440 |
| 21 | Ga0070668_100025836 | 3300005347 | Bacteria | 4454 |
| 22 | Ga0070669_100006253 | 3300005353 | Bacteria | 8595 |
| 23 | Ga0070669_100068823 | 3300005353 | Bacteria | 2613 |
| 24 | Ga0070675_100011231 | 3300005354 | Bacteria | 7011 |
| 25 | Ga0070675_100035733 | 3300005354 | Bacteria | 4040 |
| 26 | Ga0070675_100103162 | 3300005354 | Bacteria | 2404 |
| 27 | Ga0070675_100123024 | 3300005354 | Bacteria | 2205 |
| 28 | Ga0070671_100078425 | 3300005355 | Bacteria | 2761 |
| 29 | Ga0070671_100218772 | 3300005355 | Bacteria | 1616 |
| 30 | Ga0070673_100007877 | 3300005364 | Bacteria | 7059 |
| 31 | Ga0070673_100092267 | 3300005364 | Bacteria | 2477 |
| 32 | Ga0070688_100093577 | 3300005365 | Bacteria | 1969 |
| 33 | Ga0070667_100010842 | 3300005367 | Bacteria | 7535 |
| 34 | Ga0070667_100128680 | 3300005367 | Bacteria | 2208 |
| 35 | Ga0070713_100151708 | 3300005436 | Bacteria | 2062 |
| 36 | Ga0070705_100059677 | 3300005440 | Bacteria | 2260 |
| 37 | Ga0070700_100059164 | 3300005441 | Bacteria | 2411 |
| 38 | Ga0070662_100013048 | 3300005457 | Bacteria | 5522 |
| 39 | Ga0070662_100154519 | 3300005457 | Bacteria | 1790 |
| 40 | Ga0070681_10000213 | 3300005458 | Bacteria | 45271 |
| 41 | Ga0070681_10063742 | 3300005458 | Bacteria | 3658 |
| 42 | Ga0068867_100031185 | 3300005459 | Bacteria | 3847 |
| 43 | Ga0068867_100031756 | 3300005459 | Bacteria | 3815 |
| 44 | Ga0068867_100033635 | 3300005459 | Bacteria | 3714 |
| 45 | Ga0070685_10047704 | 3300005466 | Bacteria | 2464 |
| 46 | Ga0070699_100144710 | 3300005518 | Bacteria | 2100 |
| 47 | Ga0070699_100244907 | 3300005518 | Bacteria | 1601 |
| 48 | Ga0070684_100006131 | 3300005535 | Bacteria | 9265 |
| 49 | Ga0068853_100007541 | 3300005539 | Bacteria | 8708 |
| 50 | Ga0070672_100010704 | 3300005543 | Bacteria | 6372 |
| 51 | Ga0070672_100301487 | 3300005543 | Bacteria | 1358 |
| 52 | Ga0070665_100010676 | 3300005548 | Bacteria | 9297 |
| 53 | Ga0070665_100015917 | 3300005548 | Bacteria | 7549 |
| 54 | Ga0070665_100130213 | 3300005548 | Bacteria | 2518 |
| 55 | Ga0070704_100093157 | 3300005549 | Bacteria | 2251 |
| 56 | Ga0068855_100008507 | 3300005563 | Bacteria | 12406 |
| 57 | Ga0068855_100160004 | 3300005563 | Bacteria | 2556 |
| 58 | Ga0070664_100012704 | 3300005564 | Bacteria | 6855 |
| 59 | Ga0068857_100008579 | 3300005577 | Bacteria | 8841 |
| 60 | Ga0068857_100010692 | 3300005577 | Bacteria | 7984 |
| 61 | Ga0068857_100052316 | 3300005577 | Bacteria | 3624 |
| 62 | Ga0070702_100009956 | 3300005615 | Bacteria | 4667 |
| 63 | Ga0068859_100006352 | 3300005617 | Bacteria | 11993 |
| 64 | Ga0068859_100026976 | 3300005617 | Bacteria | 5762 |
| 65 | Ga0068859_100082792 | 3300005617 | Bacteria | 3251 |
| 66 | Ga0068859_100116961 | 3300005617 | Bacteria | 2731 |
| 67 | Ga0068859_100220424 | 3300005617 | Bacteria | 1985 |
| 68 | Ga0068864_100009835 | 3300005618 | Bacteria | 7885 |
| 69 | Ga0068864_100116017 | 3300005618 | Bacteria | 2389 |
| 70 | Ga0068864_100140380 | 3300005618 | Bacteria | 2179 |
| 71 | Ga0068861_100001029 | 3300005719 | Bacteria | 17066 |
| 72 | Ga0068861_100023444 | 3300005719 | Bacteria | 4451 |
| 73 | Ga0068861_100079984 | 3300005719 | Bacteria | 2556 |
| 74 | Ga0068861_100414302 | 3300005719 | Bacteria | 1199 |
| 75 | Ga0068863_100001391 | 3300005841 | Bacteria | 23993 |
| 76 | Ga0068863_100011421 | 3300005841 | Bacteria | 8590 |
| 77 | Ga0068863_100157359 | 3300005841 | Bacteria | 2176 |
| 78 | Ga0068863_100159775 | 3300005841 | Bacteria | 2159 |
| 79 | Ga0068858_100046353 | 3300005842 | Bacteria | 4030 |
| 80 | Ga0068860_100012899 | 3300005843 | Bacteria | 8213 |
| 81 | Ga0068860_100038631 | 3300005843 | Bacteria | 4567 |
| 82 | Ga0068860_100040194 | 3300005843 | Bacteria | 4471 |
| 83 | Ga0068860_100083571 | 3300005843 | Bacteria | 3037 |
| 84 | Ga0068860_100101162 | 3300005843 | Bacteria | 2750 |
| 85 | Ga0068860_100134835 | 3300005843 | Bacteria | 2371 |
| 86 | Ga0068862_100001992 | 3300005844 | Bacteria | 18521 |
| 87 | Ga0068862_100040378 | 3300005844 | Bacteria | 3966 |
| 88 | Ga0068862_100048706 | 3300005844 | Bacteria | 3618 |
| 89 | Ga0068862_100134407 | 3300005844 | Bacteria | 2191 |
| 90 | Ga0081455_10000347 | 3300005937 | Bacteria | 60756 |
| 91 | Ga0081455_10002115 | 3300005937 | Bacteria | 23647 |
| 92 | Ga0081455_10030259 | 3300005937 | Bacteria | 4921 |
| 93 | Ga0081538_10018402 | 3300005981 | Bacteria | 5247 |
| 94 | Ga0081539_10004851 | 3300005985 | Bacteria | 14381 |
| 95 | Ga0081539_10007682 | 3300005985 | Bacteria | 9691 |
| 96 | Ga0075368_10000907 | 3300006042 | Bacteria | 9191 |
| 97 | Ga0075362_10024628 | 3300006177 | Bacteria | 2554 |
| 98 | Ga0075367_10004458 | 3300006178 | Bacteria | 6840 |
| 99 | Ga0075367_10059615 | 3300006178 | Bacteria | 2273 |
| 100 | Ga0097621_100006196 | 3300006237 | Bacteria | 8480 |
| 101 | Ga0097621_100008103 | 3300006237 | Bacteria | 7549 |
| 102 | Ga0097621_100211089 | 3300006237 | Bacteria | 1689 |
| 103 | Ga0097621_100254431 | 3300006237 | Bacteria | 1539 |
| 104 | Ga0075370_10034583 | 3300006353 | Bacteria | 2832 |
| 105 | Ga0068871_100006155 | 3300006358 | Bacteria | 8456 |
| 106 | Ga0068871_100231707 | 3300006358 | Bacteria | 1603 |
| 107 | Ga0068871_100255882 | 3300006358 | Bacteria | 1526 |
| 108 | Ga0075428_100001014 | 3300006844 | Bacteria | 29769 |
| 109 | Ga0075428_100004912 | 3300006844 | Bacteria | 14853 |
| 110 | Ga0075428_100054639 | 3300006844 | Bacteria | 4376 |
| 111 | Ga0075428_100091973 | 3300006844 | Bacteria | 3308 |
| 112 | Ga0075428_100101160 | 3300006844 | Bacteria | 3142 |
| 113 | Ga0075428_100136743 | 3300006844 | Bacteria | 2664 |
| 114 | Ga0075430_100018809 | 3300006846 | Bacteria | 5877 |
| 115 | Ga0075431_100000030 | 3300006847 | Bacteria | 72683 |
| 116 | Ga0075431_100114324 | 3300006847 | Bacteria | 2786 |
| 117 | Ga0075434_100000154 | 3300006871 | Bacteria | 42762 |
| 118 | Ga0075429_100001752 | 3300006880 | Bacteria | 17974 |
| 119 | Ga0075429_100002466 | 3300006880 | Bacteria | 15563 |
| 120 | Ga0068865_100035407 | 3300006881 | Bacteria | 3357 |
| 121 | Ga0068865_100092532 | 3300006881 | Bacteria | 2197 |
| 122 | Ga0068865_100116272 | 3300006881 | Bacteria | 1981 |
| 123 | Ga0075436_100146742 | 3300006914 | Bacteria | 1659 |
| 124 | Ga0097620_100006352 | 3300006931 | Bacteria | 11993 |
| 125 | Ga0097620_100026976 | 3300006931 | Bacteria | 5762 |
| 126 | Ga0097620_100082790 | 3300006931 | Bacteria | 3251 |
| 127 | Ga0097620_100116958 | 3300006931 | Bacteria | 2731 |
| 128 | Ga0097620_100220419 | 3300006931 | Bacteria | 1985 |
| 129 | Ga0105240_10007263 | 3300009093 | Bacteria | 16126 |
| 130 | Ga0105240_10177010 | 3300009093 | Bacteria | 2521 |
| 131 | Ga0105240_10177017 | 3300009093 | Bacteria | 2521 |
| 132 | Ga0105240_10372374 | 3300009093 | Bacteria | 1614 |
| 133 | Ga0111539_10004009 | 3300009094 | Bacteria | 19329 |
| 134 | Ga0111539_10004730 | 3300009094 | Bacteria | 17791 |
| 135 | Ga0111539_10200042 | 3300009094 | Bacteria | 2330 |
| 136 | Ga0111539_10244392 | 3300009094 | Bacteria | 2089 |
| 137 | Ga0111539_10307670 | 3300009094 | Bacteria | 1844 |
| 138 | Ga0105245_10006170 | 3300009098 | Bacteria | 10548 |
| 139 | Ga0105247_10089564 | 3300009101 | Bacteria | 1951 |
| 140 | Ga0105247_10288100 | 3300009101 | Bacteria | 1135 |
| 141 | Ga0114129_10004229 | 3300009147 | Bacteria | 20289 |
| 142 | Ga0114129_10015376 | 3300009147 | Bacteria | 10890 |
| 143 | Ga0114129_10022290 | 3300009147 | Bacteria | 8992 |
| 144 | Ga0114129_10312791 | 3300009147 | Bacteria | 2090 |
| 145 | Ga0105241_10020212 | 3300009174 | Bacteria | 4919 |
| 146 | Ga0105242_10013402 | 3300009176 | Bacteria | 6335 |
| 147 | Ga0105248_10000417 | 3300009177 | Bacteria | 48821 |
| 148 | Ga0105248_10003913 | 3300009177 | Bacteria | 16471 |
| 149 | Ga0105248_10004863 | 3300009177 | Bacteria | 14873 |
| 150 | Ga0105237_10040208 | 3300009545 | Bacteria | 4716 |
| 151 | Ga0105238_10034325 | 3300009551 | Bacteria | 5162 |
| 152 | Ga0105238_10303927 | 3300009551 | Bacteria | 1579 |
| 153 | Ga0105249_10008214 | 3300009553 | Bacteria | 9094 |
| 154 | Ga0105249_10082490 | 3300009553 | Bacteria | 2991 |
| 155 | Ga0099796_10000033 | 3300010159 | Bacteria | 31267 |
| 156 | Ga0099796_10020680 | 3300010159 | Bacteria | 2015 |
| 157 | Ga0105239_10044346 | 3300010375 | Bacteria | 4876 |
| 158 | Ga0105239_10100766 | 3300010375 | Bacteria | 3195 |
| 159 | Ga0105246_10087212 | 3300011119 | Bacteria | 2240 |
| 160 | Ga0157374_10038823 | 3300013296 | Bacteria | 4379 |
| 161 | Ga0163162_10091827 | 3300013306 | Bacteria | 3119 |
| 162 | Ga0157372_10022136 | 3300013307 | Bacteria | 6876 |
| 163 | Ga0157372_10133632 | 3300013307 | Bacteria | 2856 |
| 164 | Ga0157372_10187815 | 3300013307 | Bacteria | 2393 |
| 165 | Ga0157375_10003565 | 3300013308 | Bacteria | 13513 |
| 166 | Ga0157375_10013845 | 3300013308 | Bacteria | 7190 |
| 167 | Ga0157375_10039336 | 3300013308 | Bacteria | 4552 |
| 168 | Ga0157375_10067992 | 3300013308 | Bacteria | 3562 |
| 169 | Ga0157375_10444344 | 3300013308 | Bacteria | 1462 |
| 170 | Ga0163163_10024323 | 3300014325 | Bacteria | 5764 |
| 171 | Ga0163163_10048110 | 3300014325 | Bacteria | 4192 |
| 172 | Ga0163163_10075394 | 3300014325 | Bacteria | 3367 |
| 173 | Ga0163163_10086052 | 3300014325 | Bacteria | 3152 |
| 174 | Ga0163163_10114562 | 3300014325 | Bacteria | 2727 |
| 175 | Ga0157380_10009987 | 3300014326 | Bacteria | 6813 |
| 176 | Ga0157380_10020174 | 3300014326 | Bacteria | 4980 |
| 177 | Ga0157377_10023226 | 3300014745 | Bacteria | 3285 |
| 178 | Ga0157379_10010858 | 3300014968 | Bacteria | 7940 |
| 179 | Ga0157379_10067275 | 3300014968 | Bacteria | 3203 |
| 180 | Ga0157379_10172414 | 3300014968 | Bacteria | 1953 |
| 181 | Ga0157379_10175686 | 3300014968 | Bacteria | 1934 |
| 182 | Ga0157376_10006638 | 3300014969 | Bacteria | 8192 |
| 183 | Ga0157376_10015671 | 3300014969 | Bacteria | 5733 |
| 184 | Ga0157376_10423692 | 3300014969 | Bacteria | 1292 |
| 185 | Ga0163161_10112357 | 3300017792 | Bacteria | 2038 |
| 186 | Ga0213872_10049442 | 3300021361 | Bacteria | 1910 |
| 187 | Ga0213874_10008350 | 3300021377 | Bacteria | 2523 |
| 188 | Ga0213876_10000115 | 3300021384 | Bacteria | 87113 |
| 189 | Ga0213876_10006737 | 3300021384 | Bacteria | 6272 |
| 190 | Ga0224712_10093175 | 3300022467 | Bacteria | 1265 |
| 191 | Ga0209675_1003156 | 3300025291 | Bacteria | 8012 |
| 192 | Ga0207688_10073634 | 3300025901 | Bacteria | 1942 |
| 193 | Ga0207680_10007639 | 3300025903 | Bacteria | 5281 |
| 194 | Ga0207680_10142131 | 3300025903 | Bacteria | 1592 |
| 195 | Ga0207645_10133476 | 3300025907 | Bacteria | 1616 |
| 196 | Ga0207645_10190118 | 3300025907 | Bacteria | 1349 |
| 197 | Ga0207705_10035640 | 3300025909 | Bacteria | 3559 |
| 198 | Ga0207705_10044444 | 3300025909 | Bacteria | 3192 |
| 199 | Ga0207654_10057815 | 3300025911 | Bacteria | 2255 |
| 200 | Ga0207707_10007070 | 3300025912 | Bacteria | 9783 |
| 201 | Ga0207695_10040372 | 3300025913 | Bacteria | 5005 |
| 202 | Ga0207695_10151824 | 3300025913 | Bacteria | 2255 |
| 203 | Ga0207671_10027687 | 3300025914 | Bacteria | 4237 |
| 204 | Ga0207660_10002463 | 3300025917 | Bacteria | 12163 |
| 205 | Ga0207649_10033489 | 3300025920 | Bacteria | 3070 |
| 206 | Ga0207652_10090860 | 3300025921 | Bacteria | 2684 |
| 207 | Ga0207681_10010252 | 3300025923 | Bacteria | 5738 |
| 208 | Ga0207681_10040921 | 3300025923 | Bacteria | 3087 |
| 209 | Ga0207681_10059895 | 3300025923 | Bacteria | 2611 |
| 210 | Ga0207681_10141404 | 3300025923 | Bacteria | 1793 |
| 211 | Ga0207650_10027428 | 3300025925 | Bacteria | 4077 |
| 212 | Ga0207650_10087461 | 3300025925 | Bacteria | 2374 |
| 213 | Ga0207650_10154528 | 3300025925 | Bacteria | 1814 |
| 214 | Ga0207659_10002224 | 3300025926 | Bacteria | 11553 |
| 215 | Ga0207659_10045166 | 3300025926 | Bacteria | 3104 |
| 216 | Ga0207659_10063792 | 3300025926 | Bacteria | 2665 |
| 217 | Ga0207659_10139061 | 3300025926 | Bacteria | 1883 |
| 218 | Ga0207644_10227720 | 3300025931 | Bacteria | 1480 |
| 219 | Ga0207644_10229071 | 3300025931 | Bacteria | 1476 |
| 220 | Ga0207644_10314168 | 3300025931 | Bacteria | 1266 |
| 221 | Ga0207706_10008999 | 3300025933 | Bacteria | 9191 |
| 222 | Ga0207706_10111711 | 3300025933 | Bacteria | 2404 |
| 223 | Ga0207706_10126607 | 3300025933 | Bacteria | 2246 |
| 224 | Ga0207706_10192334 | 3300025933 | Bacteria | 1791 |
| 225 | Ga0207706_10199719 | 3300025933 | Bacteria | 1754 |
| 226 | Ga0207686_10059985 | 3300025934 | Bacteria | 2406 |
| 227 | Ga0207670_10214582 | 3300025936 | Bacteria | 1469 |
| 228 | Ga0207704_10046540 | 3300025938 | Bacteria | 2586 |
| 229 | Ga0207704_10268935 | 3300025938 | Bacteria | 1289 |
| 230 | Ga0207691_10003560 | 3300025940 | Bacteria | 15152 |
| 231 | Ga0207691_10012272 | 3300025940 | Bacteria | 8214 |
| 232 | Ga0207691_10019933 | 3300025940 | Bacteria | 6344 |
| 233 | Ga0207691_10023600 | 3300025940 | Bacteria | 5792 |
| 234 | Ga0207691_10162503 | 3300025940 | Bacteria | 1958 |
| 235 | Ga0207711_10016947 | 3300025941 | Bacteria | 6051 |
| 236 | Ga0207711_10097775 | 3300025941 | Bacteria | 2592 |
| 237 | Ga0207689_10001586 | 3300025942 | Bacteria | 21539 |
| 238 | Ga0207689_10006575 | 3300025942 | Bacteria | 10249 |
| 239 | Ga0207689_10037057 | 3300025942 | Bacteria | 4047 |
| 240 | Ga0207679_10007670 | 3300025945 | Bacteria | 6855 |
| 241 | Ga0207667_10115583 | 3300025949 | Bacteria | 2765 |
| 242 | Ga0207667_10232668 | 3300025949 | Bacteria | 1887 |
| 243 | Ga0207651_10016436 | 3300025960 | Bacteria | 4334 |
| 244 | Ga0207712_10003847 | 3300025961 | Bacteria | 9479 |
| 245 | Ga0207712_10025217 | 3300025961 | Bacteria | 3949 |
| 246 | Ga0207668_10086608 | 3300025972 | Bacteria | 2289 |
| 247 | Ga0207658_10085209 | 3300025986 | Bacteria | 2433 |
| 248 | Ga0207658_10211062 | 3300025986 | Bacteria | 1627 |
| 249 | Ga0207703_10029230 | 3300026035 | Bacteria | 4347 |
| 250 | Ga0207639_10001641 | 3300026041 | Bacteria | 15068 |
| 251 | Ga0207708_10132676 | 3300026075 | Bacteria | 1948 |
| 252 | Ga0207708_10227216 | 3300026075 | Bacteria | 1497 |
| 253 | Ga0207641_10044066 | 3300026088 | Bacteria | 3750 |
| 254 | Ga0207641_10060603 | 3300026088 | Bacteria | 3225 |
| 255 | Ga0207641_10083662 | 3300026088 | Bacteria | 2776 |
| 256 | Ga0207641_10102064 | 3300026088 | Bacteria | 2529 |
| 257 | Ga0207641_10139894 | 3300026088 | Bacteria | 2183 |
| 258 | Ga0207648_10043569 | 3300026089 | Bacteria | 3939 |
| 259 | Ga0207648_10113470 | 3300026089 | Bacteria | 2380 |
| 260 | Ga0207676_10006221 | 3300026095 | Bacteria | 8429 |
| 261 | Ga0207676_10007041 | 3300026095 | Bacteria | 7969 |
| 262 | Ga0207676_10016908 | 3300026095 | Bacteria | 5282 |
| 263 | Ga0207676_10110070 | 3300026095 | Bacteria | 2303 |
| 264 | Ga0207674_10015074 | 3300026116 | Bacteria | 8509 |
| 265 | Ga0207674_10027912 | 3300026116 | Bacteria | 5964 |
| 266 | Ga0207674_10067009 | 3300026116 | Bacteria | 3615 |
| 267 | Ga0207674_10147188 | 3300026116 | Bacteria | 2314 |
| 268 | Ga0207675_100001358 | 3300026118 | Bacteria | 24514 |
| 269 | Ga0207675_100004919 | 3300026118 | Bacteria | 12872 |
| 270 | Ga0207675_100031410 | 3300026118 | Bacteria | 4948 |
| 271 | Ga0207675_100043990 | 3300026118 | Bacteria | 4170 |
| 272 | Ga0207675_100102422 | 3300026118 | Bacteria | 2698 |
| 273 | Ga0207675_100115914 | 3300026118 | Bacteria | 2531 |
| 274 | Ga0207683_10216298 | 3300026121 | Bacteria | 1745 |
| 275 | Ga0207698_10066351 | 3300026142 | Bacteria | 2840 |
| 276 | Ga0209179_1000055 | 3300027512 | Bacteria | 21337 |
| 277 | Ga0209974_10047290 | 3300027876 | Bacteria | 1441 |
| 278 | Ga0207428_10000848 | 3300027907 | Bacteria | 34448 |
| 279 | Ga0207428_10001822 | 3300027907 | Bacteria | 21820 |
| 280 | Ga0207428_10018693 | 3300027907 | Bacteria | 5915 |
| 281 | Ga0207428_10174941 | 3300027907 | Bacteria | 1624 |
| 282 | Ga0207428_10258223 | 3300027907 | Bacteria | 1298 |
| 283 | Ga0268266_10021888 | 3300028379 | Bacteria | 5447 |
| 284 | Ga0268266_10085728 | 3300028379 | Bacteria | 2752 |
| 285 | Ga0268266_10309302 | 3300028379 | Bacteria | 1476 |
| 286 | Ga0268265_10039321 | 3300028380 | Bacteria | 3486 |
| 287 | Ga0268265_10063318 | 3300028380 | Bacteria | 2845 |
| 288 | Ga0268265_10249937 | 3300028380 | Bacteria | 1570 |
| 289 | Ga0268265_10258244 | 3300028380 | Bacteria | 1547 |
| 290 | Ga0268264_10009015 | 3300028381 | Bacteria | 8275 |
| 291 | Ga0268264_10016792 | 3300028381 | Bacteria | 5990 |
| 292 | Ga0268264_10064910 | 3300028381 | Bacteria | 3074 |
| 293 | Ga0265332_10001809 | 3300031238 | Bacteria | 11496 |
| 294 | Ga0265328_10001376 | 3300031239 | Bacteria | 11228 |
| 295 | Ga0265325_10012767 | 3300031241 | Bacteria | 4794 |
| 296 | Ga0265325_10057365 | 3300031241 | Bacteria | 1986 |
| 297 | Ga0265340_10001783 | 3300031247 | Bacteria | 12282 |
| 298 | Ga0265340_10076977 | 3300031247 | Bacteria | 1575 |
| 299 | Ga0265339_10004680 | 3300031249 | Bacteria | 9291 |
| 300 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 301 | Ga0265331_10015259 | 3300031250 | Bacteria | 4063 |
| 302 | Ga0265327_10013661 | 3300031251 | Bacteria | 5377 |
| 303 | Ga0265316_10057480 | 3300031344 | Bacteria | 3033 |
| 304 | Ga0265316_10071859 | 3300031344 | Bacteria | 2667 |
| 305 | Ga0307513_10091688 | 3300031456 | Bacteria | 3096 |
| 306 | Ga0307509_10018026 | 3300031507 | Bacteria | 8106 |
| 307 | Ga0307408_100005579 | 3300031548 | Bacteria | 8413 |
| 308 | Ga0307408_100093019 | 3300031548 | Bacteria | 2280 |
| 309 | Ga0307408_100134637 | 3300031548 | Bacteria | 1932 |
| 310 | Ga0307408_100138358 | 3300031548 | Bacteria | 1908 |
| 311 | Ga0316575_10016884 | 3300031665 | Bacteria | 2767 |
| 312 | Ga0265314_10075075 | 3300031711 | Bacteria | 2250 |
| 313 | Ga0265314_10085981 | 3300031711 | Bacteria | 2060 |
| 314 | Ga0265342_10000210 | 3300031712 | Bacteria | 65961 |
| 315 | Ga0265342_10087194 | 3300031712 | Bacteria | 1794 |
| 316 | Ga0316576_10065269 | 3300031727 | Bacteria | 2675 |
| 317 | Ga0316576_10143851 | 3300031727 | Bacteria | 1795 |
| 318 | Ga0307405_10004202 | 3300031731 | Bacteria | 6780 |
| 319 | Ga0307410_10073643 | 3300031852 | Bacteria | 2376 |
| 320 | Ga0307407_10177203 | 3300031903 | Bacteria | 1409 |
| 321 | Ga0307409_100172153 | 3300031995 | Bacteria | 1907 |
| 322 | Ga0307409_100212697 | 3300031995 | Bacteria | 1739 |
| 323 | Ga0307416_100003806 | 3300032002 | Bacteria | 8963 |
| 324 | Ga0307416_100062924 | 3300032002 | Bacteria | 3036 |
| 325 | Ga0307414_10284963 | 3300032004 | Bacteria | 1390 |
| 326 | Ga0373939_0031264 | 3300035114 | Bacteria | 1538 |
| 327 | Ga0373935_0054683 | 3300035692 | Bacteria | 2543 |
| 328 | Ga0373927_0135441 | 3300035695 | Bacteria | 1610 |
| 329 | Ga0373937_0154297 | 3300036401 | Bacteria | 2152 |
| 330 | Ga0373937_0226998 | 3300036401 | Bacteria | 1758 |
| 331 | Ga0373925_0135397 | 3300037068 | Bacteria | 1925 |
| 332 | Ga0395899_0001973 | 3300037312 | Bacteria | 16872 |
| 333 | Ga0395899_0095228 | 3300037312 | Bacteria | 2154 |
| 334 | Ga0395899_0238216 | 3300037312 | Bacteria | 1253 |
| 335 | Ga0395900_0004286 | 3300037418 | Bacteria | 15134 |
| 336 | Ga0395900_0017572 | 3300037418 | Bacteria | 7298 |
| 337 | Ga0395900_0019725 | 3300037418 | Bacteria | 6873 |
| 338 | Ga0395900_0065795 | 3300037418 | Bacteria | 3724 |
| 339 | Ga0395900_0181023 | 3300037418 | Bacteria | 2142 |
| 340 | Ga0395898_0017545 | 3300037466 | Bacteria | 7306 |
| 341 | Ga0395898_0017884 | 3300037466 | Bacteria | 7231 |
| 342 | Ga0395898_0111771 | 3300037466 | Bacteria | 2618 |
| 343 | Ga0395901_0002102 | 3300038443 | Bacteria | 20446 |
| 344 | Ga0395901_0020486 | 3300038443 | Bacteria | 6768 |
| 345 | Ga0395901_0033895 | 3300038443 | Bacteria | 5273 |
| 346 | Ga0395901_0097909 | 3300038443 | Bacteria | 3075 |
| 347 | Ga0436365_0507621 | 3300039437 | Bacteria | 122643 |
| 348 | Ga0436365_0737310 | 3300039437 | Bacteria | 23715 |
| 349 | Ga0436360_0477258 | 3300039438 | Bacteria | 17690 |
| 350 | Ga0436361_0004926 | 3300039447 | Bacteria | 16512 |
| 351 | Ga0436361_0814330 | 3300039447 | Bacteria | 2789 |
| 352 | Ga0436363_0550910 | 3300039450 | Bacteria | 12229 |
| 353 | Ga0436363_0571997 | 3300039450 | Bacteria | 7484 |
| 354 | Ga0436363_0923907 | 3300039450 | Bacteria | 1849 |
| 355 | Ga0439461_0007791 | 3300041410 | Bacteria | 1908 |
| 356 | Ga0439465_0027594 | 3300041413 | Bacteria | 1799 |
| 357 | Ga0439448_0038855 | 3300042005 | Bacteria | 1533 |
| 358 | Ga0439451_011533 | 3300042009 | Bacteria | 1783 |
| 359 | Ga0450894_003826 | 3300042131 | Bacteria | 1967 |
| 360 | Ga0439446_0001262 | 3300042156 | Bacteria | 5687 |
| 361 | Ga0439446_0003380 | 3300042156 | Bacteria | 3953 |
| 362 | Ga0439434_0002952 | 3300042435 | Bacteria | 4969 |
| 363 | Ga0439434_0045178 | 3300042435 | Bacteria | 1358 |
| 364 | Ga0439435_0000169 | 3300042436 | Bacteria | 9067 |
| 365 | Ga0439444_0007278 | 3300042437 | Bacteria | 1696 |
| 366 | Ga0439460_0000411 | 3300042461 | Bacteria | 9149 |
| 367 | Ga0451577_0266116 | 3300042876 | Bacteria | 1552 |
| 368 | Ga0453683_0128238 | 3300044673 | Bacteria | 1598 |
| 369 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 370 | Ga0453684_0348111 | 3300044712 | Bacteria | 1672 |
| 371 | Ga0451576_0002793 | 3300045051 | Bacteria | 25197 |
| 372 | Ga0451576_0030042 | 3300045051 | Bacteria | 5811 |
| 373 | Ga0495638_0002250 | 3300046460 | Bacteria | 15996 |
| 374 | Ga0495641_0026684 | 3300046461 | Bacteria | 2816 |
| 375 | Ga0495625_0005703 | 3300046660 | Bacteria | 11270 |
| 376 | Ga0496100_0126841 | 3300048903 | Bacteria | 1792 |
| 377 | Ga0496102_0193327 | 3300048905 | Bacteria | 1918 |
| 378 | Ga0496104_0178178 | 3300048907 | Bacteria | 2036 |
| 379 | Ga0496104_0187281 | 3300048907 | Bacteria | 1980 |
| 380 | Ga0496105_0090126 | 3300048908 | Bacteria | 2533 |
| 381 | Ga0496106_0119623 | 3300048909 | Bacteria | 2058 |
| 382 | Ga0496108_0027380 | 3300048911 | Bacteria | 4706 |
| 383 | Ga0496108_0174594 | 3300048911 | Bacteria | 1860 |
| 384 | Ga0496109_0045048 | 3300048912 | Bacteria | 4003 |
| 385 | Ga0496110_0009800 | 3300048913 | Bacteria | 7758 |
| 386 | Ga0496111_0008249 | 3300048914 | Bacteria | 6887 |
| 387 | Ga0496113_0066492 | 3300048916 | Bacteria | 2731 |
| 388 | Ga0496114_0014914 | 3300048917 | Bacteria | 6246 |
| 389 | Ga0496114_0033870 | 3300048917 | Bacteria | 4211 |
| 390 | Ga0501031_0030379 | 3300049568 | Bacteria | 3524 |
| 391 | Ga0501034_0001803 | 3300049571 | Bacteria | 27303 |
| 392 | Ga0501034_0147207 | 3300049571 | Bacteria | 2332 |
| 393 | Ga0501038_0043837 | 3300049574 | Bacteria | 3889 |
| 394 | Ga0501040_0029637 | 3300049576 | Bacteria | 3695 |
| 395 | Ga0501042_0032619 | 3300049578 | Bacteria | 3689 |
| 396 | Ga0501042_0127385 | 3300049578 | Bacteria | 1834 |
| 397 | Ga0501043_0014030 | 3300049579 | Bacteria | 6271 |
| 398 | Ga0501046_0073951 | 3300049580 | Bacteria | 2644 |
| 399 | Ga0501046_0199208 | 3300049580 | Bacteria | 1490 |
| 400 | Ga0501048_0037869 | 3300049582 | Bacteria | 3463 |
| 401 | Ga0501048_0190637 | 3300049582 | Bacteria | 1453 |
| 402 | Ga0501067_0024222 | 3300049583 | Bacteria | 3366 |
| 403 | Ga0501068_0001133 | 3300049584 | Bacteria | 14117 |
| 404 | Ga0501068_0002018 | 3300049584 | Bacteria | 10801 |
| 405 | Ga0501070_0029647 | 3300049586 | Bacteria | 4586 |
| 406 | Ga0501070_0106166 | 3300049586 | Bacteria | 2321 |
| 407 | Ga0501070_0127182 | 3300049586 | Bacteria | 2105 |
| 408 | Ga0501070_0143371 | 3300049586 | Bacteria | 1972 |
| 409 | Ga0501071_0015620 | 3300049587 | Bacteria | 5213 |
| 410 | Ga0501071_0051723 | 3300049587 | Bacteria | 2961 |
| 411 | Ga0501072_0016781 | 3300049588 | Bacteria | 5622 |
| 412 | Ga0501073_0001730 | 3300049589 | Bacteria | 16225 |
| 413 | Ga0501074_0004326 | 3300049590 | Bacteria | 10143 |
| 414 | Ga0501075_0040464 | 3300049591 | Bacteria | 3490 |
| 415 | Ga0501075_0056735 | 3300049591 | Bacteria | 2949 |
| 416 | Ga0501076_0003513 | 3300049592 | Bacteria | 11015 |
| 417 | Ga0501076_0109849 | 3300049592 | Bacteria | 2229 |
| 418 | Ga0501077_0007747 | 3300049593 | Bacteria | 6627 |
| 419 | Ga0501077_0033444 | 3300049593 | Bacteria | 3272 |
| 420 | Ga0501077_0040108 | 3300049593 | Bacteria | 2983 |
| 421 | Ga0501077_0118318 | 3300049593 | Bacteria | 1679 |
| 422 | Ga0501217_014671 | 3300049661 | Bacteria | 1774 |
| 423 | Ga0501079_0000176 | 3300049741 | Bacteria | 36131 |
| 424 | Ga0501079_0181498 | 3300049741 | Bacteria | 1642 |
| 425 | Ga0501079_0278000 | 3300049741 | Bacteria | 1309 |
| 426 | Ga0501080_0028968 | 3300049742 | Bacteria | 5155 |
| 427 | Ga0501081_0027405 | 3300049743 | Bacteria | 3844 |
| 428 | Ga0501083_0045311 | 3300049744 | Bacteria | 2976 |
| 429 | Ga0501044_0138984 | 3300049823 | Bacteria | 2418 |
| 430 | Ga0501045_0020041 | 3300049824 | Bacteria | 4774 |
| 431 | nmdc:mga03683_7872_c1 | 3300050489 | Bacteria | 3721 |
| 432 | nmdc:mga0yw44_93766_c1 | 3300050492 | Bacteria | 1902 |
| 433 | nmdc:mga0k408_15659_c1 | 3300050493 | Bacteria | 4197 |
| 434 | nmdc:mga06z11_32040_c1 | 3300050494 | Bacteria | 2560 |
| 435 | nmdc:mga07m45_3954_c1 | 3300050496 | Bacteria | 7203 |
| 436 | nmdc:mga05p37_117884_c1 | 3300050507 | Bacteria | 3262 |
| 437 | nmdc:mga05p37_2104_c1 | 3300050507 | Bacteria | 23255 |
| 438 | nmdc:mga05p37_42043_c1 | 3300050507 | Bacteria | 5614 |
| 439 | nmdc:mga09592_1337_c1 | 3300050508 | Bacteria | 19755 |
| 440 | nmdc:mga09592_8636_c1 | 3300050508 | Bacteria | 8288 |
| 441 | nmdc:mga09592_92997_c1 | 3300050508 | Bacteria | 2578 |
| 442 | nmdc:mga0qj67_117743_c1 | 3300050509 | Bacteria | 2147 |
| 443 | nmdc:mga0qj67_3666_c1 | 3300050509 | Bacteria | 11087 |
| 444 | nmdc:mga0qj67_88634_c1 | 3300050509 | Bacteria | 2484 |
| 445 | nmdc:mga06r32_159_c1 | 3300050510 | Bacteria | 51926 |
| 446 | nmdc:mga06r32_2646_c1 | 3300050510 | Bacteria | 15998 |
| 447 | nmdc:mga08y16_1034_c1 | 3300050511 | Bacteria | 27262 |
| 448 | nmdc:mga08y16_127890_c1 | 3300050511 | Bacteria | 2643 |
| 449 | nmdc:mga08y16_2874_c1 | 3300050511 | Bacteria | 17720 |
| 450 | nmdc:mga08y16_66970_c1 | 3300050511 | Bacteria | 3747 |
| 451 | nmdc:mga0n895_3358_c1 | 3300050512 | Bacteria | 12869 |
| 452 | nmdc:mga08x19_135384_c1 | 3300050514 | Bacteria | 1660 |
| 453 | nmdc:mga0a205_17458_c1 | 3300050515 | Bacteria | 6729 |
| 454 | nmdc:mga0sz30_4264_c1 | 3300050516 | Bacteria | 5156 |
| 455 | Ga0500644_0013867 | 3300053088 | Bacteria | 2261 |
| 456 | Ga0500651_0123373 | 3300053093 | Bacteria | 1571 |
| 457 | Ga0500595_002165 | 3300053119 | Bacteria | 9988 |
| 458 | Ga0500642_0001037 | 3300053130 | Bacteria | 8007 |
| 459 | Ga0500568_0057870 | 3300053139 | Bacteria | 1507 |
| 460 | Ga0500616_0001125 | 3300053153 | Bacteria | 27512 |
| 461 | Ga0500552_007454 | 3300053733 | Bacteria | 1263 |
| 462 | Ga0501084_0024470 | 3300054114 | Bacteria | 5037 |
| 463 | Ga0501084_0048334 | 3300054114 | Bacteria | 3561 |
| 464 | Ga0501084_0049799 | 3300054114 | Bacteria | 3507 |
| 465 | Ga0501082_0006979 | 3300060353 | Bacteria | 9752 |
| 466 | Ga0501082_0027241 | 3300060353 | Bacteria | 4921 |
| 467 | Ga0501082_0050210 | 3300060353 | Bacteria | 3597 |
| 468 | Ga0530510_0002737 | 3300061734 | Bacteria | 12117 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025903 | Ga0207680_10142131 | Ga0207680_101421312 | 294 |
| 2 | 3300049582 | Ga0501048_0190637 | Ga0501048_0190637_409_1404 | 301 |
| 3 | 3300039450 | Ga0436363_0923907 | Ga0436363_0923907_100_1233 | 305 |
| 4 | 3300005844 | Ga0068862_100040378 | Ga0068862_1000403783 | 310 |
| 5 | 3300025938 | Ga0207704_10268935 | Ga0207704_102689351 | 313 |
| 6 | 3300009101 | Ga0105247_10288100 | Ga0105247_102881001 | 316 |
| 7 | 3300049591 | Ga0501075_0056735 | Ga0501075_0056735_1276_2442 | 325 |
| 8 | 3300049593 | Ga0501077_0118318 | Ga0501077_0118318_385_1551 | 325 |
| 9 | 3300049741 | Ga0501079_0181498 | Ga0501079_0181498_464_1630 | 325 |
| 10 | 3300054114 | Ga0501084_0049799 | Ga0501084_0049799_2032_3198 | 325 |
| 11 | 3300005354 | Ga0070675_100103162 | Ga0070675_1001031622 | 330 |
| 12 | 3300025940 | Ga0207691_10162503 | Ga0207691_101625032 | 330 |
| 13 | 3300006237 | Ga0097621_100211089 | Ga0097621_1002110891 | 332 |
| 14 | 3300025931 | Ga0207644_10227720 | Ga0207644_102277201 | 332 |
| 15 | 3300005327 | Ga0070658_10016126 | Ga0070658_100161264 | 334 |
| 16 | 3300005548 | Ga0070665_100130213 | Ga0070665_1001302132 | 334 |
| 17 | 3300009093 | Ga0105240_10177017 | Ga0105240_101770172 | 334 |
| 18 | 3300009551 | Ga0105238_10034325 | Ga0105238_100343256 | 334 |
| 19 | 3300010375 | Ga0105239_10100766 | Ga0105239_101007663 | 334 |
| 20 | 3300025909 | Ga0207705_10044444 | Ga0207705_100444443 | 334 |
| 21 | 3300025913 | Ga0207695_10040372 | Ga0207695_100403722 | 334 |
| 22 | 3300026116 | Ga0207674_10147188 | Ga0207674_101471882 | 334 |
| 23 | 3300028379 | Ga0268266_10085728 | Ga0268266_100857282 | 334 |
| 24 | 3300037418 | Ga0395900_0065795 | Ga0395900_0065795_1141_2262 | 334 |
| 25 | 3300037466 | Ga0395898_0111771 | Ga0395898_0111771_1248_2369 | 334 |
| 26 | 3300050509 | nmdc:mga0qj67_88634_c1 | nmdc:mga0qj67_88634_c1_638_1741 | 334 |
| 27 | 3300005518 | Ga0070699_100244907 | Ga0070699_1002449072 | 336 |
| 28 | 3300005347 | Ga0070668_100017012 | Ga0070668_1000170124 | 337 |
| 29 | 3300005353 | Ga0070669_100006253 | Ga0070669_1000062538 | 337 |
| 30 | 3300005354 | Ga0070675_100123024 | Ga0070675_1001230242 | 337 |
| 31 | 3300005355 | Ga0070671_100078425 | Ga0070671_1000784253 | 337 |
| 32 | 3300005364 | Ga0070673_100007877 | Ga0070673_1000078774 | 337 |
| 33 | 3300005457 | Ga0070662_100154519 | Ga0070662_1001545192 | 337 |
| 34 | 3300005459 | Ga0068867_100033635 | Ga0068867_1000336354 | 337 |
| 35 | 3300005518 | Ga0070699_100144710 | Ga0070699_1001447103 | 337 |
| 36 | 3300005543 | Ga0070672_100301487 | Ga0070672_1003014872 | 337 |
| 37 | 3300005618 | Ga0068864_100116017 | Ga0068864_1001160172 | 337 |
| 38 | 3300005719 | Ga0068861_100023444 | Ga0068861_1000234444 | 337 |
| 39 | 3300005843 | Ga0068860_100101162 | Ga0068860_1001011622 | 337 |
| 40 | 3300006844 | Ga0075428_100091973 | Ga0075428_1000919732 | 337 |
| 41 | 3300013306 | Ga0163162_10091827 | Ga0163162_100918272 | 337 |
| 42 | 3300013308 | Ga0157375_10003565 | Ga0157375_100035658 | 337 |
| 43 | 3300014325 | Ga0163163_10114562 | Ga0163163_101145621 | 337 |
| 44 | 3300014969 | Ga0157376_10423692 | Ga0157376_104236922 | 337 |
| 45 | 3300017792 | Ga0163161_10112357 | Ga0163161_101123572 | 337 |
| 46 | 3300025925 | Ga0207650_10154528 | Ga0207650_101545282 | 337 |
| 47 | 3300025926 | Ga0207659_10139061 | Ga0207659_101390612 | 337 |
| 48 | 3300025933 | Ga0207706_10111711 | Ga0207706_101117112 | 337 |
| 49 | 3300025940 | Ga0207691_10003560 | Ga0207691_100035607 | 337 |
| 50 | 3300025972 | Ga0207668_10086608 | Ga0207668_100866083 | 337 |
| 51 | 3300026088 | Ga0207641_10083662 | Ga0207641_100836622 | 337 |
| 52 | 3300026088 | Ga0207641_10102064 | Ga0207641_101020643 | 337 |
| 53 | 3300026089 | Ga0207648_10113470 | Ga0207648_101134702 | 337 |
| 54 | 3300026095 | Ga0207676_10110070 | Ga0207676_101100702 | 337 |
| 55 | 3300026118 | Ga0207675_100102422 | Ga0207675_1001024222 | 337 |
| 56 | 3300028380 | Ga0268265_10258244 | Ga0268265_102582442 | 337 |
| 57 | 3300035695 | Ga0373927_0135441 | Ga0373927_0135441_151_1281 | 337 |
| 58 | 3300036401 | Ga0373937_0154297 | Ga0373937_0154297_742_1872 | 337 |
| 59 | iso_pu_bacteria | 2883291878 | 2883295038 | 339 |
| 60 | 3300005335 | Ga0070666_10001642 | Ga0070666_100016429 | 340 |
| 61 | 3300005341 | Ga0070691_10001763 | Ga0070691_100017636 | 340 |
| 62 | 3300009093 | Ga0105240_10007263 | Ga0105240_100072634 | 340 |
| 63 | 3300010375 | Ga0105239_10044346 | Ga0105239_100443463 | 340 |
| 64 | 3300031548 | Ga0307408_100138358 | Ga0307408_1001383582 | 340 |
| 65 | 3300036401 | Ga0373937_0226998 | Ga0373937_0226998_588_1712 | 340 |
| 66 | 3300037312 | Ga0395899_0238216 | Ga0395899_0238216_38_1081 | 340 |
| 67 | 3300039450 | Ga0436363_0550910 | Ga0436363_0550910_5663_6787 | 340 |
| 68 | 3300049586 | Ga0501070_0106166 | Ga0501070_0106166_304_1428 | 340 |
| 69 | 3300053119 | Ga0500595_002165 | Ga0500595_002165_8540_9667 | 340 |
| 70 | iso_pu_bacteria | 2894772417 | 2894776139 | 340 |
| 71 | 3300006042 | Ga0075368_10000907 | Ga0075368_1000090712 | 341 |
| 72 | 3300006178 | Ga0075367_10004458 | Ga0075367_100044588 | 341 |
| 73 | 3300009147 | Ga0114129_10312791 | Ga0114129_103127911 | 341 |
| 74 | 3300025921 | Ga0207652_10090860 | Ga0207652_100908602 | 341 |
| 75 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003401 | 341 |
| 76 | 3300031711 | Ga0265314_10085981 | Ga0265314_100859812 | 341 |
| 77 | 3300050496 | nmdc:mga07m45_3954_c1 | nmdc:mga07m45_3954_c1_4244_5371 | 341 |
| 78 | 3300005290 | Ga0065712_10095512 | Ga0065712_100955122 | 342 |
| 79 | 3300005293 | Ga0065715_10110976 | Ga0065715_101109761 | 342 |
| 80 | 3300005295 | Ga0065707_10081743 | Ga0065707_1008174324 | 342 |
| 81 | 3300005327 | Ga0070658_10007220 | Ga0070658_100072203 | 342 |
| 82 | 3300005330 | Ga0070690_100009545 | Ga0070690_1000095454 | 342 |
| 83 | 3300005331 | Ga0070670_100012090 | Ga0070670_1000120902 | 342 |
| 84 | 3300005331 | Ga0070670_100161939 | Ga0070670_1001619392 | 342 |
| 85 | 3300005334 | Ga0068869_100001906 | Ga0068869_1000019069 | 342 |
| 86 | 3300005334 | Ga0068869_100007868 | Ga0068869_1000078682 | 342 |
| 87 | 3300005334 | Ga0068869_100029433 | Ga0068869_1000294331 | 342 |
| 88 | 3300005335 | Ga0070666_10036422 | Ga0070666_100364224 | 342 |
| 89 | 3300005340 | Ga0070689_100067632 | Ga0070689_1000676322 | 342 |
| 90 | 3300005341 | Ga0070691_10009930 | Ga0070691_100099302 | 342 |
| 91 | 3300005344 | Ga0070661_100028450 | Ga0070661_1000284502 | 342 |
| 92 | 3300005344 | Ga0070661_100066587 | Ga0070661_1000665872 | 342 |
| 93 | 3300005347 | Ga0070668_100025836 | Ga0070668_1000258363 | 342 |
| 94 | 3300005353 | Ga0070669_100068823 | Ga0070669_1000688232 | 342 |
| 95 | 3300005354 | Ga0070675_100011231 | Ga0070675_1000112316 | 342 |
| 96 | 3300005354 | Ga0070675_100035733 | Ga0070675_1000357333 | 342 |
| 97 | 3300005355 | Ga0070671_100218772 | Ga0070671_1002187721 | 342 |
| 98 | 3300005364 | Ga0070673_100092267 | Ga0070673_1000922672 | 342 |
| 99 | 3300005365 | Ga0070688_100093577 | Ga0070688_1000935772 | 342 |
| 100 | 3300005367 | Ga0070667_100010842 | Ga0070667_1000108427 | 342 |
| 101 | 3300005367 | Ga0070667_100128680 | Ga0070667_1001286802 | 342 |
| 102 | 3300005436 | Ga0070713_100151708 | Ga0070713_1001517082 | 342 |
| 103 | 3300005440 | Ga0070705_100059677 | Ga0070705_1000596772 | 342 |
| 104 | 3300005441 | Ga0070700_100059164 | Ga0070700_1000591641 | 342 |
| 105 | 3300005457 | Ga0070662_100013048 | Ga0070662_1000130482 | 342 |
| 106 | 3300005458 | Ga0070681_10000213 | Ga0070681_100002132 | 342 |
| 107 | 3300005458 | Ga0070681_10063742 | Ga0070681_100637422 | 342 |
| 108 | 3300005459 | Ga0068867_100031185 | Ga0068867_1000311851 | 342 |
| 109 | 3300005459 | Ga0068867_100031756 | Ga0068867_1000317563 | 342 |
| 110 | 3300005466 | Ga0070685_10047704 | Ga0070685_100477042 | 342 |
| 111 | 3300005535 | Ga0070684_100006131 | Ga0070684_1000061312 | 342 |
| 112 | 3300005539 | Ga0068853_100007541 | Ga0068853_1000075417 | 342 |
| 113 | 3300005543 | Ga0070672_100010704 | Ga0070672_1000107046 | 342 |
| 114 | 3300005548 | Ga0070665_100010676 | Ga0070665_1000106765 | 342 |
| 115 | 3300005548 | Ga0070665_100015917 | Ga0070665_1000159177 | 342 |
| 116 | 3300005549 | Ga0070704_100093157 | Ga0070704_1000931571 | 342 |
| 117 | 3300005563 | Ga0068855_100008507 | Ga0068855_1000085075 | 342 |
| 118 | 3300005564 | Ga0070664_100012704 | Ga0070664_1000127046 | 342 |
| 119 | 3300005577 | Ga0068857_100008579 | Ga0068857_1000085792 | 342 |
| 120 | 3300005577 | Ga0068857_100010692 | Ga0068857_1000106926 | 342 |
| 121 | 3300005577 | Ga0068857_100052316 | Ga0068857_1000523162 | 342 |
| 122 | 3300005615 | Ga0070702_100009956 | Ga0070702_1000099563 | 342 |
| 123 | 3300005617 | Ga0068859_100006352 | Ga0068859_1000063522 | 342 |
| 124 | 3300005617 | Ga0068859_100026976 | Ga0068859_1000269766 | 342 |
| 125 | 3300005617 | Ga0068859_100082792 | Ga0068859_1000827921 | 342 |
| 126 | 3300005617 | Ga0068859_100116961 | Ga0068859_1001169612 | 342 |
| 127 | 3300005617 | Ga0068859_100220424 | Ga0068859_1002204242 | 342 |
| 128 | 3300005618 | Ga0068864_100009835 | Ga0068864_1000098356 | 342 |
| 129 | 3300005618 | Ga0068864_100140380 | Ga0068864_1001403802 | 342 |
| 130 | 3300005719 | Ga0068861_100001029 | Ga0068861_10000102913 | 342 |
| 131 | 3300005719 | Ga0068861_100079984 | Ga0068861_1000799842 | 342 |
| 132 | 3300005719 | Ga0068861_100414302 | Ga0068861_1004143021 | 342 |
| 133 | 3300005841 | Ga0068863_100001391 | Ga0068863_10000139120 | 342 |
| 134 | 3300005841 | Ga0068863_100011421 | Ga0068863_1000114216 | 342 |
| 135 | 3300005841 | Ga0068863_100157359 | Ga0068863_1001573592 | 342 |
| 136 | 3300005841 | Ga0068863_100159775 | Ga0068863_1001597753 | 342 |
| 137 | 3300005842 | Ga0068858_100046353 | Ga0068858_1000463533 | 342 |
| 138 | 3300005843 | Ga0068860_100012899 | Ga0068860_1000128997 | 342 |
| 139 | 3300005843 | Ga0068860_100038631 | Ga0068860_1000386312 | 342 |
| 140 | 3300005843 | Ga0068860_100040194 | Ga0068860_1000401941 | 342 |
| 141 | 3300005843 | Ga0068860_100083571 | Ga0068860_1000835714 | 342 |
| 142 | 3300005843 | Ga0068860_100134835 | Ga0068860_1001348352 | 342 |
| 143 | 3300005844 | Ga0068862_100001992 | Ga0068862_1000019926 | 342 |
| 144 | 3300005844 | Ga0068862_100048706 | Ga0068862_1000487062 | 342 |
| 145 | 3300005844 | Ga0068862_100134407 | Ga0068862_1001344072 | 342 |
| 146 | 3300005937 | Ga0081455_10000347 | Ga0081455_1000034732 | 342 |
| 147 | 3300005937 | Ga0081455_10002115 | Ga0081455_100021156 | 342 |
| 148 | 3300005937 | Ga0081455_10030259 | Ga0081455_100302596 | 342 |
| 149 | 3300005981 | Ga0081538_10018402 | Ga0081538_100184023 | 342 |
| 150 | 3300006237 | Ga0097621_100006196 | Ga0097621_1000061966 | 342 |
| 151 | 3300006237 | Ga0097621_100008103 | Ga0097621_1000081032 | 342 |
| 152 | 3300006237 | Ga0097621_100254431 | Ga0097621_1002544311 | 342 |
| 153 | 3300006358 | Ga0068871_100006155 | Ga0068871_1000061556 | 342 |
| 154 | 3300006358 | Ga0068871_100231707 | Ga0068871_1002317072 | 342 |
| 155 | 3300006358 | Ga0068871_100255882 | Ga0068871_1002558822 | 342 |
| 156 | 3300006844 | Ga0075428_100001014 | Ga0075428_1000010142 | 342 |
| 157 | 3300006844 | Ga0075428_100004912 | Ga0075428_10000491212 | 342 |
| 158 | 3300006844 | Ga0075428_100054639 | Ga0075428_1000546392 | 342 |
| 159 | 3300006844 | Ga0075428_100101160 | Ga0075428_1001011602 | 342 |
| 160 | 3300006844 | Ga0075428_100136743 | Ga0075428_1001367432 | 342 |
| 161 | 3300006846 | Ga0075430_100018809 | Ga0075430_1000188095 | 342 |
| 162 | 3300006847 | Ga0075431_100000030 | Ga0075431_10000003051 | 342 |
| 163 | 3300006847 | Ga0075431_100114324 | Ga0075431_1001143242 | 342 |
| 164 | 3300006871 | Ga0075434_100000154 | Ga0075434_10000015421 | 342 |
| 165 | 3300006880 | Ga0075429_100001752 | Ga0075429_1000017529 | 342 |
| 166 | 3300006880 | Ga0075429_100002466 | Ga0075429_1000024669 | 342 |
| 167 | 3300006881 | Ga0068865_100035407 | Ga0068865_1000354072 | 342 |
| 168 | 3300006881 | Ga0068865_100092532 | Ga0068865_1000925322 | 342 |
| 169 | 3300006881 | Ga0068865_100116272 | Ga0068865_1001162722 | 342 |
| 170 | 3300006914 | Ga0075436_100146742 | Ga0075436_1001467421 | 342 |
| 171 | 3300006931 | Ga0097620_100006352 | Ga0097620_1000063522 | 342 |
| 172 | 3300006931 | Ga0097620_100026976 | Ga0097620_1000269766 | 342 |
| 173 | 3300006931 | Ga0097620_100082790 | Ga0097620_1000827901 | 342 |
| 174 | 3300006931 | Ga0097620_100116958 | Ga0097620_1001169582 | 342 |
| 175 | 3300006931 | Ga0097620_100220419 | Ga0097620_1002204192 | 342 |
| 176 | 3300009093 | Ga0105240_10372374 | Ga0105240_103723742 | 342 |
| 177 | 3300009094 | Ga0111539_10004009 | Ga0111539_100040094 | 342 |
| 178 | 3300009094 | Ga0111539_10004730 | Ga0111539_1000473020 | 342 |
| 179 | 3300009094 | Ga0111539_10200042 | Ga0111539_102000422 | 342 |
| 180 | 3300009094 | Ga0111539_10244392 | Ga0111539_102443922 | 342 |
| 181 | 3300009094 | Ga0111539_10307670 | Ga0111539_103076702 | 342 |
| 182 | 3300009098 | Ga0105245_10006170 | Ga0105245_100061708 | 342 |
| 183 | 3300009101 | Ga0105247_10089564 | Ga0105247_100895642 | 342 |
| 184 | 3300009147 | Ga0114129_10004229 | Ga0114129_1000422913 | 342 |
| 185 | 3300009147 | Ga0114129_10015376 | Ga0114129_100153767 | 342 |
| 186 | 3300009147 | Ga0114129_10022290 | Ga0114129_100222909 | 342 |
| 187 | 3300009174 | Ga0105241_10020212 | Ga0105241_100202126 | 342 |
| 188 | 3300009176 | Ga0105242_10013402 | Ga0105242_100134024 | 342 |
| 189 | 3300009177 | Ga0105248_10000417 | Ga0105248_1000041724 | 342 |
| 190 | 3300009177 | Ga0105248_10003913 | Ga0105248_1000391311 | 342 |
| 191 | 3300009177 | Ga0105248_10004863 | Ga0105248_100048632 | 342 |
| 192 | 3300009545 | Ga0105237_10040208 | Ga0105237_100402083 | 342 |
| 193 | 3300009551 | Ga0105238_10303927 | Ga0105238_103039271 | 342 |
| 194 | 3300009553 | Ga0105249_10008214 | Ga0105249_100082146 | 342 |
| 195 | 3300009553 | Ga0105249_10082490 | Ga0105249_100824902 | 342 |
| 196 | 3300010159 | Ga0099796_10000033 | Ga0099796_1000003325 | 342 |
| 197 | 3300010159 | Ga0099796_10020680 | Ga0099796_100206802 | 342 |
| 198 | 3300011119 | Ga0105246_10087212 | Ga0105246_100872122 | 342 |
| 199 | 3300013296 | Ga0157374_10038823 | Ga0157374_100388234 | 342 |
| 200 | 3300013307 | Ga0157372_10022136 | Ga0157372_100221362 | 342 |
| 201 | 3300013307 | Ga0157372_10133632 | Ga0157372_101336323 | 342 |
| 202 | 3300013307 | Ga0157372_10187815 | Ga0157372_101878152 | 342 |
| 203 | 3300013308 | Ga0157375_10013845 | Ga0157375_100138456 | 342 |
| 204 | 3300013308 | Ga0157375_10039336 | Ga0157375_100393362 | 342 |
| 205 | 3300013308 | Ga0157375_10067992 | Ga0157375_100679923 | 342 |
| 206 | 3300013308 | Ga0157375_10444344 | Ga0157375_104443441 | 342 |
| 207 | 3300014325 | Ga0163163_10024323 | Ga0163163_100243233 | 342 |
| 208 | 3300014325 | Ga0163163_10048110 | Ga0163163_100481104 | 342 |
| 209 | 3300014325 | Ga0163163_10075394 | Ga0163163_100753944 | 342 |
| 210 | 3300014325 | Ga0163163_10086052 | Ga0163163_100860522 | 342 |
| 211 | 3300014326 | Ga0157380_10009987 | Ga0157380_100099876 | 342 |
| 212 | 3300014326 | Ga0157380_10020174 | Ga0157380_100201742 | 342 |
| 213 | 3300014745 | Ga0157377_10023226 | Ga0157377_100232262 | 342 |
| 214 | 3300014968 | Ga0157379_10010858 | Ga0157379_100108582 | 342 |
| 215 | 3300014968 | Ga0157379_10067275 | Ga0157379_100672752 | 342 |
| 216 | 3300014968 | Ga0157379_10172414 | Ga0157379_101724142 | 342 |
| 217 | 3300014968 | Ga0157379_10175686 | Ga0157379_101756862 | 342 |
| 218 | 3300014969 | Ga0157376_10006638 | Ga0157376_100066385 | 342 |
| 219 | 3300014969 | Ga0157376_10015671 | Ga0157376_100156712 | 342 |
| 220 | 3300021361 | Ga0213872_10049442 | Ga0213872_100494422 | 342 |
| 221 | 3300021377 | Ga0213874_10008350 | Ga0213874_100083502 | 342 |
| 222 | 3300021384 | Ga0213876_10000115 | Ga0213876_1000011570 | 342 |
| 223 | 3300021384 | Ga0213876_10006737 | Ga0213876_100067377 | 342 |
| 224 | 3300025291 | Ga0209675_1003156 | Ga0209675_10031562 | 342 |
| 225 | 3300025901 | Ga0207688_10073634 | Ga0207688_100736342 | 342 |
| 226 | 3300025903 | Ga0207680_10007639 | Ga0207680_100076392 | 342 |
| 227 | 3300025907 | Ga0207645_10133476 | Ga0207645_101334762 | 342 |
| 228 | 3300025907 | Ga0207645_10190118 | Ga0207645_101901182 | 342 |
| 229 | 3300025909 | Ga0207705_10035640 | Ga0207705_100356403 | 342 |
| 230 | 3300025911 | Ga0207654_10057815 | Ga0207654_100578152 | 342 |
| 231 | 3300025912 | Ga0207707_10007070 | Ga0207707_100070706 | 342 |
| 232 | 3300025913 | Ga0207695_10151824 | Ga0207695_101518242 | 342 |
| 233 | 3300025914 | Ga0207671_10027687 | Ga0207671_100276873 | 342 |
| 234 | 3300025917 | Ga0207660_10002463 | Ga0207660_1000246314 | 342 |
| 235 | 3300025920 | Ga0207649_10033489 | Ga0207649_100334892 | 342 |
| 236 | 3300025923 | Ga0207681_10010252 | Ga0207681_100102522 | 342 |
| 237 | 3300025923 | Ga0207681_10040921 | Ga0207681_100409213 | 342 |
| 238 | 3300025923 | Ga0207681_10059895 | Ga0207681_100598952 | 342 |
| 239 | 3300025923 | Ga0207681_10141404 | Ga0207681_101414042 | 342 |
| 240 | 3300025925 | Ga0207650_10027428 | Ga0207650_100274284 | 342 |
| 241 | 3300025925 | Ga0207650_10087461 | Ga0207650_100874612 | 342 |
| 242 | 3300025926 | Ga0207659_10002224 | Ga0207659_100022241 | 342 |
| 243 | 3300025926 | Ga0207659_10045166 | Ga0207659_100451662 | 342 |
| 244 | 3300025926 | Ga0207659_10063792 | Ga0207659_100637922 | 342 |
| 245 | 3300025931 | Ga0207644_10229071 | Ga0207644_102290712 | 342 |
| 246 | 3300025931 | Ga0207644_10314168 | Ga0207644_103141681 | 342 |
| 247 | 3300025933 | Ga0207706_10008999 | Ga0207706_100089994 | 342 |
| 248 | 3300025933 | Ga0207706_10126607 | Ga0207706_101266072 | 342 |
| 249 | 3300025933 | Ga0207706_10192334 | Ga0207706_101923342 | 342 |
| 250 | 3300025933 | Ga0207706_10199719 | Ga0207706_101997192 | 342 |
| 251 | 3300025934 | Ga0207686_10059985 | Ga0207686_100599852 | 342 |
| 252 | 3300025936 | Ga0207670_10214582 | Ga0207670_102145822 | 342 |
| 253 | 3300025938 | Ga0207704_10046540 | Ga0207704_100465403 | 342 |
| 254 | 3300025940 | Ga0207691_10012272 | Ga0207691_100122722 | 342 |
| 255 | 3300025940 | Ga0207691_10019933 | Ga0207691_100199334 | 342 |
| 256 | 3300025940 | Ga0207691_10023600 | Ga0207691_100236002 | 342 |
| 257 | 3300025941 | Ga0207711_10016947 | Ga0207711_100169472 | 342 |
| 258 | 3300025941 | Ga0207711_10097775 | Ga0207711_100977752 | 342 |
| 259 | 3300025942 | Ga0207689_10001586 | Ga0207689_1000158614 | 342 |
| 260 | 3300025942 | Ga0207689_10006575 | Ga0207689_100065757 | 342 |
| 261 | 3300025942 | Ga0207689_10037057 | Ga0207689_100370574 | 342 |
| 262 | 3300025945 | Ga0207679_10007670 | Ga0207679_100076704 | 342 |
| 263 | 3300025949 | Ga0207667_10115583 | Ga0207667_101155833 | 342 |
| 264 | 3300025960 | Ga0207651_10016436 | Ga0207651_100164362 | 342 |
| 265 | 3300025961 | Ga0207712_10003847 | Ga0207712_100038474 | 342 |
| 266 | 3300025961 | Ga0207712_10025217 | Ga0207712_100252172 | 342 |
| 267 | 3300025986 | Ga0207658_10085209 | Ga0207658_100852092 | 342 |
| 268 | 3300025986 | Ga0207658_10211062 | Ga0207658_102110622 | 342 |
| 269 | 3300026035 | Ga0207703_10029230 | Ga0207703_100292303 | 342 |
| 270 | 3300026041 | Ga0207639_10001641 | Ga0207639_1000164112 | 342 |
| 271 | 3300026075 | Ga0207708_10132676 | Ga0207708_101326761 | 342 |
| 272 | 3300026075 | Ga0207708_10227216 | Ga0207708_102272162 | 342 |
| 273 | 3300026088 | Ga0207641_10044066 | Ga0207641_100440662 | 342 |
| 274 | 3300026088 | Ga0207641_10060603 | Ga0207641_100606033 | 342 |
| 275 | 3300026088 | Ga0207641_10139894 | Ga0207641_101398943 | 342 |
| 276 | 3300026089 | Ga0207648_10043569 | Ga0207648_100435692 | 342 |
| 277 | 3300026095 | Ga0207676_10006221 | Ga0207676_100062214 | 342 |
| 278 | 3300026095 | Ga0207676_10007041 | Ga0207676_100070414 | 342 |
| 279 | 3300026095 | Ga0207676_10016908 | Ga0207676_100169084 | 342 |
| 280 | 3300026116 | Ga0207674_10015074 | Ga0207674_100150744 | 342 |
| 281 | 3300026116 | Ga0207674_10027912 | Ga0207674_100279124 | 342 |
| 282 | 3300026116 | Ga0207674_10067009 | Ga0207674_100670094 | 342 |
| 283 | 3300026118 | Ga0207675_100001358 | Ga0207675_10000135813 | 342 |
| 284 | 3300026118 | Ga0207675_100004919 | Ga0207675_1000049195 | 342 |
| 285 | 3300026118 | Ga0207675_100031410 | Ga0207675_1000314104 | 342 |
| 286 | 3300026118 | Ga0207675_100043990 | Ga0207675_1000439905 | 342 |
| 287 | 3300026118 | Ga0207675_100115914 | Ga0207675_1001159142 | 342 |
| 288 | 3300026121 | Ga0207683_10216298 | Ga0207683_102162982 | 342 |
| 289 | 3300027512 | Ga0209179_1000055 | Ga0209179_100005513 | 342 |
| 290 | 3300027876 | Ga0209974_10047290 | Ga0209974_100472902 | 342 |
| 291 | 3300027907 | Ga0207428_10000848 | Ga0207428_1000084827 | 342 |
| 292 | 3300027907 | Ga0207428_10001822 | Ga0207428_1000182224 | 342 |
| 293 | 3300027907 | Ga0207428_10018693 | Ga0207428_100186932 | 342 |
| 294 | 3300027907 | Ga0207428_10258223 | Ga0207428_102582232 | 342 |
| 295 | 3300028379 | Ga0268266_10021888 | Ga0268266_100218882 | 342 |
| 296 | 3300028379 | Ga0268266_10309302 | Ga0268266_103093022 | 342 |
| 297 | 3300028380 | Ga0268265_10039321 | Ga0268265_100393212 | 342 |
| 298 | 3300028380 | Ga0268265_10063318 | Ga0268265_100633182 | 342 |
| 299 | 3300028380 | Ga0268265_10249937 | Ga0268265_102499372 | 342 |
| 300 | 3300028381 | Ga0268264_10009015 | Ga0268264_100090154 | 342 |
| 301 | 3300028381 | Ga0268264_10016792 | Ga0268264_100167924 | 342 |
| 302 | 3300028381 | Ga0268264_10064910 | Ga0268264_100649104 | 342 |
| 303 | 3300031238 | Ga0265332_10001809 | Ga0265332_1000180913 | 342 |
| 304 | 3300031239 | Ga0265328_10001376 | Ga0265328_100013763 | 342 |
| 305 | 3300031241 | Ga0265325_10012767 | Ga0265325_100127673 | 342 |
| 306 | 3300031247 | Ga0265340_10001783 | Ga0265340_100017836 | 342 |
| 307 | 3300031249 | Ga0265339_10004680 | Ga0265339_100046802 | 342 |
| 308 | 3300031250 | Ga0265331_10015259 | Ga0265331_100152593 | 342 |
| 309 | 3300031251 | Ga0265327_10013661 | Ga0265327_100136613 | 342 |
| 310 | 3300031344 | Ga0265316_10057480 | Ga0265316_100574801 | 342 |
| 311 | 3300031344 | Ga0265316_10071859 | Ga0265316_100718592 | 342 |
| 312 | 3300031456 | Ga0307513_10091688 | Ga0307513_100916882 | 342 |
| 313 | 3300031507 | Ga0307509_10018026 | Ga0307509_100180264 | 342 |
| 314 | 3300031548 | Ga0307408_100005579 | Ga0307408_1000055793 | 342 |
| 315 | 3300031548 | Ga0307408_100093019 | Ga0307408_1000930192 | 342 |
| 316 | 3300031548 | Ga0307408_100134637 | Ga0307408_1001346372 | 342 |
| 317 | 3300031665 | Ga0316575_10016884 | Ga0316575_100168842 | 342 |
| 318 | 3300031711 | Ga0265314_10075075 | Ga0265314_100750752 | 342 |
| 319 | 3300031712 | Ga0265342_10000210 | Ga0265342_1000021063 | 342 |
| 320 | 3300031712 | Ga0265342_10087194 | Ga0265342_100871942 | 342 |
| 321 | 3300031727 | Ga0316576_10065269 | Ga0316576_100652692 | 342 |
| 322 | 3300031727 | Ga0316576_10143851 | Ga0316576_101438512 | 342 |
| 323 | 3300031731 | Ga0307405_10004202 | Ga0307405_100042026 | 342 |
| 324 | 3300031852 | Ga0307410_10073643 | Ga0307410_100736432 | 342 |
| 325 | 3300031903 | Ga0307407_10177203 | Ga0307407_101772031 | 342 |
| 326 | 3300031995 | Ga0307409_100172153 | Ga0307409_1001721532 | 342 |
| 327 | 3300031995 | Ga0307409_100212697 | Ga0307409_1002126972 | 342 |
| 328 | 3300032002 | Ga0307416_100003806 | Ga0307416_1000038066 | 342 |
| 329 | 3300032002 | Ga0307416_100062924 | Ga0307416_1000629242 | 342 |
| 330 | 3300032004 | Ga0307414_10284963 | Ga0307414_102849632 | 342 |
| 331 | 3300035114 | Ga0373939_0031264 | Ga0373939_0031264_330_1457 | 342 |
| 332 | 3300037068 | Ga0373925_0135397 | Ga0373925_0135397_372_1520 | 342 |
| 333 | 3300037312 | Ga0395899_0095228 | Ga0395899_0095228_498_1646 | 342 |
| 334 | 3300037418 | Ga0395900_0019725 | Ga0395900_0019725_926_2074 | 342 |
| 335 | 3300037418 | Ga0395900_0181023 | Ga0395900_0181023_779_1915 | 342 |
| 336 | 3300037466 | Ga0395898_0017545 | Ga0395898_0017545_5133_6281 | 342 |
| 337 | 3300038443 | Ga0395901_0020486 | Ga0395901_0020486_4867_6015 | 342 |
| 338 | 3300038443 | Ga0395901_0097909 | Ga0395901_0097909_675_1823 | 342 |
| 339 | 3300039437 | Ga0436365_0507621 | Ga0436365_0507621_58075_59199 | 342 |
| 340 | 3300039437 | Ga0436365_0737310 | Ga0436365_0737310_13369_14517 | 342 |
| 341 | 3300039438 | Ga0436360_0477258 | Ga0436360_0477258_12996_14144 | 342 |
| 342 | 3300039447 | Ga0436361_0004926 | Ga0436361_0004926_8687_9817 | 342 |
| 343 | 3300039447 | Ga0436361_0814330 | Ga0436361_0814330_701_1849 | 342 |
| 344 | 3300039450 | Ga0436363_0571997 | Ga0436363_0571997_12_1139 | 342 |
| 345 | 3300041410 | Ga0439461_0007791 | Ga0439461_0007791_719_1852 | 342 |
| 346 | 3300041413 | Ga0439465_0027594 | Ga0439465_0027594_63_1211 | 342 |
| 347 | 3300042009 | Ga0439451_011533 | Ga0439451_011533_446_1579 | 342 |
| 348 | 3300042131 | Ga0450894_003826 | Ga0450894_003826_549_1679 | 342 |
| 349 | 3300042156 | Ga0439446_0001262 | Ga0439446_0001262_4455_5588 | 342 |
| 350 | 3300042156 | Ga0439446_0003380 | Ga0439446_0003380_2794_3927 | 342 |
| 351 | 3300042435 | Ga0439434_0002952 | Ga0439434_0002952_2636_3769 | 342 |
| 352 | 3300042435 | Ga0439434_0045178 | Ga0439434_0045178_113_1240 | 342 |
| 353 | 3300042436 | Ga0439435_0000169 | Ga0439435_0000169_4033_5166 | 342 |
| 354 | 3300042437 | Ga0439444_0007278 | Ga0439444_0007278_231_1364 | 342 |
| 355 | 3300042461 | Ga0439460_0000411 | Ga0439460_0000411_4179_5312 | 342 |
| 356 | 3300042876 | Ga0451577_0266116 | Ga0451577_0266116_343_1476 | 342 |
| 357 | 3300044673 | Ga0453683_0128238 | Ga0453683_0128238_268_1482 | 342 |
| 358 | 3300044712 | Ga0453684_0000163 | Ga0453684_0000163_181394_182527 | 342 |
| 359 | 3300044712 | Ga0453684_0348111 | Ga0453684_0348111_301_1518 | 342 |
| 360 | 3300045051 | Ga0451576_0002793 | Ga0451576_0002793_19903_21036 | 342 |
| 361 | 3300045051 | Ga0451576_0030042 | Ga0451576_0030042_3935_5062 | 342 |
| 362 | 3300046460 | Ga0495638_0002250 | Ga0495638_0002250_6118_7254 | 342 |
| 363 | 3300046461 | Ga0495641_0026684 | Ga0495641_0026684_856_1983 | 342 |
| 364 | 3300046660 | Ga0495625_0005703 | Ga0495625_0005703_4015_5151 | 342 |
| 365 | 3300048903 | Ga0496100_0126841 | Ga0496100_0126841_27_1148 | 342 |
| 366 | 3300048905 | Ga0496102_0193327 | Ga0496102_0193327_729_1862 | 342 |
| 367 | 3300048907 | Ga0496104_0178178 | Ga0496104_0178178_123_1250 | 342 |
| 368 | 3300048907 | Ga0496104_0187281 | Ga0496104_0187281_615_1739 | 342 |
| 369 | 3300048908 | Ga0496105_0090126 | Ga0496105_0090126_1059_2183 | 342 |
| 370 | 3300048909 | Ga0496106_0119623 | Ga0496106_0119623_696_1820 | 342 |
| 371 | 3300048911 | Ga0496108_0027380 | Ga0496108_0027380_1635_2759 | 342 |
| 372 | 3300048911 | Ga0496108_0174594 | Ga0496108_0174594_113_1234 | 342 |
| 373 | 3300048912 | Ga0496109_0045048 | Ga0496109_0045048_872_1999 | 342 |
| 374 | 3300048913 | Ga0496110_0009800 | Ga0496110_0009800_4231_5355 | 342 |
| 375 | 3300048914 | Ga0496111_0008249 | Ga0496111_0008249_1883_3007 | 342 |
| 376 | 3300048916 | Ga0496113_0066492 | Ga0496113_0066492_194_1321 | 342 |
| 377 | 3300048917 | Ga0496114_0014914 | Ga0496114_0014914_1108_2232 | 342 |
| 378 | 3300048917 | Ga0496114_0033870 | Ga0496114_0033870_820_1941 | 342 |
| 379 | 3300049568 | Ga0501031_0030379 | Ga0501031_0030379_141_1310 | 342 |
| 380 | 3300049574 | Ga0501038_0043837 | Ga0501038_0043837_578_1747 | 342 |
| 381 | 3300049576 | Ga0501040_0029637 | Ga0501040_0029637_2217_3386 | 342 |
| 382 | 3300049578 | Ga0501042_0032619 | Ga0501042_0032619_1287_2456 | 342 |
| 383 | 3300049579 | Ga0501043_0014030 | Ga0501043_0014030_1525_2694 | 342 |
| 384 | 3300049580 | Ga0501046_0073951 | Ga0501046_0073951_856_1983 | 342 |
| 385 | 3300049580 | Ga0501046_0199208 | Ga0501046_0199208_110_1279 | 342 |
| 386 | 3300049582 | Ga0501048_0037869 | Ga0501048_0037869_1842_3011 | 342 |
| 387 | 3300049583 | Ga0501067_0024222 | Ga0501067_0024222_1013_2140 | 342 |
| 388 | 3300049584 | Ga0501068_0001133 | Ga0501068_0001133_5059_6186 | 342 |
| 389 | 3300049586 | Ga0501070_0029647 | Ga0501070_0029647_2010_3137 | 342 |
| 390 | 3300049586 | Ga0501070_0127182 | Ga0501070_0127182_286_1416 | 342 |
| 391 | 3300049586 | Ga0501070_0143371 | Ga0501070_0143371_682_1851 | 342 |
| 392 | 3300049587 | Ga0501071_0015620 | Ga0501071_0015620_3791_4918 | 342 |
| 393 | 3300049587 | Ga0501071_0051723 | Ga0501071_0051723_155_1324 | 342 |
| 394 | 3300049588 | Ga0501072_0016781 | Ga0501072_0016781_2551_3720 | 342 |
| 395 | 3300049589 | Ga0501073_0001730 | Ga0501073_0001730_9041_10168 | 342 |
| 396 | 3300049590 | Ga0501074_0004326 | Ga0501074_0004326_3829_4956 | 342 |
| 397 | 3300049591 | Ga0501075_0040464 | Ga0501075_0040464_421_1590 | 342 |
| 398 | 3300049592 | Ga0501076_0003513 | Ga0501076_0003513_567_1694 | 342 |
| 399 | 3300049592 | Ga0501076_0109849 | Ga0501076_0109849_661_1788 | 342 |
| 400 | 3300049593 | Ga0501077_0007747 | Ga0501077_0007747_1658_2785 | 342 |
| 401 | 3300049593 | Ga0501077_0033444 | Ga0501077_0033444_2019_3146 | 342 |
| 402 | 3300049593 | Ga0501077_0040108 | Ga0501077_0040108_554_1723 | 342 |
| 403 | 3300049661 | Ga0501217_014671 | Ga0501217_014671_267_1406 | 342 |
| 404 | 3300049741 | Ga0501079_0000176 | Ga0501079_0000176_31196_32323 | 342 |
| 405 | 3300049741 | Ga0501079_0278000 | Ga0501079_0278000_20_1192 | 342 |
| 406 | 3300049742 | Ga0501080_0028968 | Ga0501080_0028968_3860_4987 | 342 |
| 407 | 3300049743 | Ga0501081_0027405 | Ga0501081_0027405_1937_3106 | 342 |
| 408 | 3300049744 | Ga0501083_0045311 | Ga0501083_0045311_1224_2393 | 342 |
| 409 | 3300049823 | Ga0501044_0138984 | Ga0501044_0138984_1004_2155 | 342 |
| 410 | 3300049824 | Ga0501045_0020041 | Ga0501045_0020041_1517_2686 | 342 |
| 411 | 3300050489 | nmdc:mga03683_7872_c1 | nmdc:mga03683_7872_c1_1722_2870 | 342 |
| 412 | 3300050492 | nmdc:mga0yw44_93766_c1 | nmdc:mga0yw44_93766_c1_396_1544 | 342 |
| 413 | 3300050494 | nmdc:mga06z11_32040_c1 | nmdc:mga06z11_32040_c1_977_2125 | 342 |
| 414 | 3300050507 | nmdc:mga05p37_117884_c1 | nmdc:mga05p37_117884_c1_958_2088 | 342 |
| 415 | 3300050507 | nmdc:mga05p37_2104_c1 | nmdc:mga05p37_2104_c1_11381_12508 | 342 |
| 416 | 3300050507 | nmdc:mga05p37_42043_c1 | nmdc:mga05p37_42043_c1_183_1310 | 342 |
| 417 | 3300050508 | nmdc:mga09592_1337_c1 | nmdc:mga09592_1337_c1_15367_16494 | 342 |
| 418 | 3300050508 | nmdc:mga09592_8636_c1 | nmdc:mga09592_8636_c1_3275_4402 | 342 |
| 419 | 3300050508 | nmdc:mga09592_92997_c1 | nmdc:mga09592_92997_c1_179_1306 | 342 |
| 420 | 3300050509 | nmdc:mga0qj67_117743_c1 | nmdc:mga0qj67_117743_c1_130_1257 | 342 |
| 421 | 3300050509 | nmdc:mga0qj67_3666_c1 | nmdc:mga0qj67_3666_c1_3022_4149 | 342 |
| 422 | 3300050510 | nmdc:mga06r32_159_c1 | nmdc:mga06r32_159_c1_22964_24091 | 342 |
| 423 | 3300050510 | nmdc:mga06r32_2646_c1 | nmdc:mga06r32_2646_c1_2642_3769 | 342 |
| 424 | 3300050511 | nmdc:mga08y16_1034_c1 | nmdc:mga08y16_1034_c1_19104_20231 | 342 |
| 425 | 3300050511 | nmdc:mga08y16_127890_c1 | nmdc:mga08y16_127890_c1_1291_2418 | 342 |
| 426 | 3300050511 | nmdc:mga08y16_2874_c1 | nmdc:mga08y16_2874_c1_4058_5188 | 342 |
| 427 | 3300050511 | nmdc:mga08y16_66970_c1 | nmdc:mga08y16_66970_c1_646_1773 | 342 |
| 428 | 3300050512 | nmdc:mga0n895_3358_c1 | nmdc:mga0n895_3358_c1_4417_5547 | 342 |
| 429 | 3300050514 | nmdc:mga08x19_135384_c1 | nmdc:mga08x19_135384_c1_499_1620 | 342 |
| 430 | 3300050515 | nmdc:mga0a205_17458_c1 | nmdc:mga0a205_17458_c1_4436_5566 | 342 |
| 431 | 3300053088 | Ga0500644_0013867 | Ga0500644_0013867_699_1829 | 342 |
| 432 | 3300053130 | Ga0500642_0001037 | Ga0500642_0001037_3548_4705 | 342 |
| 433 | 3300053139 | Ga0500568_0057870 | Ga0500568_0057870_111_1259 | 342 |
| 434 | 3300053153 | Ga0500616_0001125 | Ga0500616_0001125_10322_11470 | 342 |
| 435 | 3300053733 | Ga0500552_007454 | Ga0500552_007454_100_1248 | 342 |
| 436 | 3300054114 | Ga0501084_0024470 | Ga0501084_0024470_56_1183 | 342 |
| 437 | 3300054114 | Ga0501084_0048334 | Ga0501084_0048334_782_1951 | 342 |
| 438 | 3300060353 | Ga0501082_0006979 | Ga0501082_0006979_3815_4942 | 342 |
| 439 | 3300060353 | Ga0501082_0027241 | Ga0501082_0027241_532_1659 | 342 |
| 440 | 3300060353 | Ga0501082_0050210 | Ga0501082_0050210_1698_2867 | 342 |
| 441 | 3300061734 | Ga0530510_0002737 | Ga0530510_0002737_2789_3958 | 342 |
| 442 | 3300005563 | Ga0068855_100160004 | Ga0068855_1001600042 | 343 |
| 443 | 3300005985 | Ga0081539_10004851 | Ga0081539_1000485114 | 343 |
| 444 | 3300005985 | Ga0081539_10007682 | Ga0081539_100076823 | 343 |
| 445 | 3300006177 | Ga0075362_10024628 | Ga0075362_100246282 | 343 |
| 446 | 3300006178 | Ga0075367_10059615 | Ga0075367_100596152 | 343 |
| 447 | 3300006353 | Ga0075370_10034583 | Ga0075370_100345833 | 343 |
| 448 | 3300009093 | Ga0105240_10177010 | Ga0105240_101770102 | 343 |
| 449 | 3300022467 | Ga0224712_10093175 | Ga0224712_100931751 | 343 |
| 450 | 3300025949 | Ga0207667_10232668 | Ga0207667_102326682 | 343 |
| 451 | 3300026142 | Ga0207698_10066351 | Ga0207698_100663512 | 343 |
| 452 | 3300027907 | Ga0207428_10174941 | Ga0207428_101749411 | 343 |
| 453 | 3300031241 | Ga0265325_10057365 | Ga0265325_100573652 | 343 |
| 454 | 3300031247 | Ga0265340_10076977 | Ga0265340_100769771 | 343 |
| 455 | 3300035692 | Ga0373935_0054683 | Ga0373935_0054683_828_1988 | 343 |
| 456 | 3300037312 | Ga0395899_0001973 | Ga0395899_0001973_15650_16813 | 343 |
| 457 | 3300037418 | Ga0395900_0004286 | Ga0395900_0004286_44_1297 | 343 |
| 458 | 3300037418 | Ga0395900_0017572 | Ga0395900_0017572_4030_5193 | 343 |
| 459 | 3300037466 | Ga0395898_0017884 | Ga0395898_0017884_2500_3753 | 343 |
| 460 | 3300038443 | Ga0395901_0002102 | Ga0395901_0002102_12199_13452 | 343 |
| 461 | 3300038443 | Ga0395901_0033895 | Ga0395901_0033895_3980_5143 | 343 |
| 462 | 3300042005 | Ga0439448_0038855 | Ga0439448_0038855_133_1296 | 343 |
| 463 | 3300049571 | Ga0501034_0001803 | Ga0501034_0001803_24370_25533 | 343 |
| 464 | 3300049571 | Ga0501034_0147207 | Ga0501034_0147207_476_1636 | 343 |
| 465 | 3300049578 | Ga0501042_0127385 | Ga0501042_0127385_623_1783 | 343 |
| 466 | 3300049584 | Ga0501068_0002018 | Ga0501068_0002018_157_1317 | 343 |
| 467 | 3300050493 | nmdc:mga0k408_15659_c1 | nmdc:mga0k408_15659_c1_595_1755 | 343 |
| 468 | 3300050516 | nmdc:mga0sz30_4264_c1 | nmdc:mga0sz30_4264_c1_456_1616 | 343 |
| 469 | 3300053093 | Ga0500651_0123373 | Ga0500651_0123373_30_1316 | 343 |
| 470 | 3300003322 | rootL2_10000116 | rootL2_100001169 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5njn-assembly1.cif.gz_A | roll out the beta-barrel: structure and mechanism of pac13, a unique nucleoside dehydratase | 0.8908 | 82 | 164 |
| 5ooa-assembly1.cif.gz_A | streptomyces pac13 (y89f) with uridine | 0.8892 | 82 | 164 |
| 5oo8-assembly1.cif.gz_A | streptomyces pac13 (h42q) with uridine | 0.8886 | 82 | 164 |
| 5oo9-assembly1.cif.gz_A | streptomyces pac13 (y55f) with uridine | 0.8855 | 82 | 164 |
| 2phd-assembly1.cif.gz_C | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.8854 | 86 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.906 | 78 | 159 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9034 | 77 | 159 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8871 | 78 | 159 | 2.60.120.10 |
| af_A0A0R0J2E3_68_132_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8865 | 107 | 155 | 2.60.120.10 |
| af_P09377_6_85_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8806 | 84 | 156 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7ZH39-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9721 | 1 | 302 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A539DXS1-F1-model_v4 | Homogentisate 1 2-dioxygenase | 0.9687 | 1 | 230 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A539DXS1-F1-model_v4 | Homogentisate 1 2-dioxygenase | 0.9565 | 1 | 230 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
| AF-A0A258VDI6-F1-model_v4 | deleted | 0.9559 | 2 | 331 |
|
| AF-A0A2D7ZH39-F1-model_v4 | Homogentisate 1,2-dioxygenase | 0.9535 | 1 | 302 |
GO:0004411
GO:0005737 GO:0006559 GO:0006570 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar