F450397

General Info

Members Datasets Scaffolds Average Seq Length
470 279 940 164

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10000492|Ga0099795_100004926
Length 193
Sequence MNEPTVTTETTESARKPVQPTLSLKFLSHGTLESKDLDFTRKFYEEFLGLEVVRASKVSIWCRLGGAHIYVVVQVPEGKKAEMPFLNHNGIDVETEDDVDECHRLAVRDAAIWKLHKISKPMVQHGTYSFYFWDADDNSWEILANPPGGYSWMFERGDQEGVGHMSRKFDRPTSTLRKAPKGSPQGPEGSSQG

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 1.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.91
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10000492 3300007788 Bacteria 7402
2 JGI24742J22300_10012382 3300002244 Bacteria 1421
3 rootH1_10286775 3300003323 Unclassified 2058
4 Ga0058861_11689562 3300004800 Bacteria 666
5 Ga0058860_11407751 3300004801 Bacteria 1044
6 Ga0065704_10116414 3300005289 Bacteria 1854
7 Ga0065707_10391137 3300005295 Bacteria 864
8 Ga0065707_10402014 3300005295 Unclassified 851
9 Ga0070683_100423834 3300005329 Bacteria 1269
10 Ga0070690_100000860 3300005330 Bacteria 15413
11 Ga0068869_100000089 3300005334 Bacteria 41752
12 Ga0070680_100000992 3300005336 Bacteria 20153
13 Ga0070680_100248831 3300005336 Bacteria 1503
14 Ga0070680_100660621 3300005336 Unclassified 899
15 Ga0070682_100054665 3300005337 Bacteria 2506
16 Ga0070682_101303470 3300005337 Bacteria 617
17 Ga0070689_100000185 3300005340 Bacteria 37751
18 Ga0070691_10001436 3300005341 Bacteria 10189
19 Ga0070691_10146490 3300005341 Bacteria 1207
20 Ga0070687_100000160 3300005343 Bacteria 23224
21 Ga0070692_10016739 3300005345 Bacteria 3493
22 Ga0070692_10137846 3300005345 Unclassified 1378
23 Ga0070673_101647428 3300005364 Unclassified 607
24 Ga0070667_100030517 3300005367 Bacteria 4496
25 Ga0070714_100680882 3300005435 Unclassified 991
26 Ga0070713_100264102 3300005436 Bacteria 1574
27 Ga0070713_100980859 3300005436 Bacteria 815
28 Ga0070710_10629355 3300005437 Bacteria 750
29 Ga0070711_100201169 3300005439 Unclassified 1537
30 Ga0070705_100003800 3300005440 Bacteria 7388
31 Ga0070705_100596044 3300005440 Bacteria 854
32 Ga0070705_100843032 3300005440 Unclassified 733
33 Ga0070700_100001045 3300005441 Bacteria 13706
34 Ga0070700_101433018 3300005441 Bacteria 585
35 Ga0070694_100000089 3300005444 Bacteria 43372
36 Ga0070694_100007910 3300005444 Bacteria 6492
37 Ga0070694_100095979 3300005444 Bacteria 2089
38 Ga0070694_100111927 3300005444 Bacteria 1946
39 Ga0070708_100169923 3300005445 Bacteria 2035
40 Ga0070681_10248990 3300005458 Bacteria 1690
41 Ga0070681_10329186 3300005458 Bacteria 1437
42 Ga0070681_10451546 3300005458 Bacteria 1197
43 Ga0070681_10755360 3300005458 Bacteria 889
44 Ga0068867_100001296 3300005459 Bacteria 17265
45 Ga0070706_100097800 3300005467 Bacteria 2726
46 Ga0070707_100266177 3300005468 Bacteria 1667
47 Ga0070699_100049683 3300005518 Bacteria 3630
48 Ga0070699_100261741 3300005518 Bacteria 1547
49 Ga0070699_100889517 3300005518 Bacteria 816
50 Ga0070679_100002498 3300005530 Bacteria 16660
51 Ga0070697_100228373 3300005536 Bacteria 1587
52 Ga0070697_101258611 3300005536 Bacteria 660
53 Ga0068853_100161141 3300005539 Bacteria 2024
54 Ga0070686_100001902 3300005544 Bacteria 11616
55 Ga0070695_100000187 3300005545 Bacteria 29864
56 Ga0070695_100012911 3300005545 Bacteria 5014
57 Ga0070695_100079648 3300005545 Bacteria 2163
58 Ga0070695_100713209 3300005545 Bacteria 797
59 Ga0070695_101681524 3300005545 Unclassified 531
60 Ga0070696_100000077 3300005546 Bacteria 48139
61 Ga0070696_101234400 3300005546 Bacteria 632
62 Ga0070693_100000125 3300005547 Bacteria 34456
63 Ga0070665_100187655 3300005548 Bacteria 2068
64 Ga0070704_100000051 3300005549 Bacteria 37969
65 Ga0070704_100009724 3300005549 Bacteria 5829
66 Ga0070704_100487774 3300005549 Bacteria 1067
67 Ga0070704_100618784 3300005549 Bacteria 953
68 Ga0070704_100984472 3300005549 Bacteria 762
69 Ga0068855_100000741 3300005563 Bacteria 40118
70 Ga0068855_100900104 3300005563 Bacteria 935
71 Ga0068854_100028793 3300005578 Bacteria 3841
72 Ga0068856_100020707 3300005614 Bacteria 6389
73 Ga0070702_100000279 3300005615 Bacteria 17421
74 Ga0068852_100054134 3300005616 Bacteria 3458
75 Ga0068852_101906932 3300005616 Bacteria 616
76 Ga0068859_100095835 3300005617 Bacteria 3020
77 Ga0068859_100297517 3300005617 Unclassified 1707
78 Ga0068864_100246444 3300005618 Bacteria 1657
79 Ga0068864_100603474 3300005618 Bacteria 1065
80 Ga0068866_10001003 3300005718 Bacteria 12396
81 Ga0068861_100002682 3300005719 Bacteria 11658
82 Ga0068861_100019170 3300005719 Bacteria 4886
83 Ga0068861_101016078 3300005719 Bacteria 792
84 Ga0068870_10122733 3300005840 Bacteria 1498
85 Ga0068863_100167053 3300005841 Bacteria 2110
86 Ga0068863_100181739 3300005841 Bacteria 2019
87 Ga0068858_100008811 3300005842 Bacteria 9673
88 Ga0068858_100368641 3300005842 Bacteria 1377
89 Ga0068860_100000810 3300005843 Bacteria 34973
90 Ga0068862_100000622 3300005844 Bacteria 36814
91 Ga0068862_100108172 3300005844 Bacteria 2438
92 Ga0068862_100828921 3300005844 Bacteria 905
93 Ga0081539_10002070 3300005985 Bacteria 30041
94 Ga0070717_11724436 3300006028 Bacteria 567
95 Ga0070715_10121759 3300006163 Bacteria 1245
96 Ga0070716_100443209 3300006173 Unclassified 945
97 Ga0070716_100499518 3300006173 Bacteria 897
98 Ga0070712_100942905 3300006175 Unclassified 745
99 Ga0075367_10688557 3300006178 Bacteria 650
100 Ga0097621_100001434 3300006237 Bacteria 16354
101 Ga0097621_100001482 3300006237 Bacteria 16097
102 Ga0068871_100000440 3300006358 Bacteria 28666
103 Ga0068871_100028092 3300006358 Bacteria 4407
104 Ga0068871_100764360 3300006358 Bacteria 889
105 Ga0075428_100000835 3300006844 Bacteria 32292
106 Ga0075428_100003747 3300006844 Bacteria 16662
107 Ga0075428_100007029 3300006844 Bacteria 12481
108 Ga0075428_100013667 3300006844 Bacteria 9038
109 Ga0075428_100968590 3300006844 Bacteria 901
110 Ga0075430_100006002 3300006846 Bacteria 10253
111 Ga0075430_100135270 3300006846 Bacteria 2054
112 Ga0075430_100172072 3300006846 Bacteria 1802
113 Ga0075430_100507609 3300006846 Bacteria 995
114 Ga0075431_100053056 3300006847 Bacteria 4180
115 Ga0075431_100105693 3300006847 Bacteria 2904
116 Ga0075433_10005345 3300006852 Bacteria 10080
117 Ga0075433_10162035 3300006852 Bacteria 1991
118 Ga0075433_10597828 3300006852 Bacteria 969
119 Ga0075433_11109821 3300006852 Bacteria 688
120 Ga0075434_100000621 3300006871 Bacteria 27353
121 Ga0075434_100444670 3300006871 Bacteria 1317
122 Ga0075434_100498371 3300006871 Bacteria 1239
123 Ga0075434_101203824 3300006871 Bacteria 769
124 Ga0075429_100000096 3300006880 Bacteria 47975
125 Ga0075429_100002189 3300006880 Bacteria 16335
126 Ga0075429_100184364 3300006880 Bacteria 1829
127 Ga0068865_100000149 3300006881 Bacteria 37769
128 Ga0075436_100000816 3300006914 Bacteria 20743
129 Ga0075436_100004243 3300006914 Bacteria 9838
130 Ga0075436_100017171 3300006914 Bacteria 4953
131 Ga0075436_100017505 3300006914 Bacteria 4908
132 Ga0075436_100073560 3300006914 Bacteria 2366
133 Ga0075436_100111971 3300006914 Bacteria 1905
134 Ga0075436_100113533 3300006914 Bacteria 1892
135 Ga0075436_100431587 3300006914 Bacteria 958
136 Ga0075436_100787020 3300006914 Bacteria 708
137 Ga0097620_100095824 3300006931 Bacteria 3020
138 Ga0097620_100297517 3300006931 Unclassified 1707
139 Ga0075435_100000485 3300007076 Bacteria 24143
140 Ga0075435_100479973 3300007076 Bacteria 1074
141 Ga0075435_100703310 3300007076 Bacteria 878
142 Ga0099794_10022318 3300007265 Bacteria 2885
143 Ga0099794_10186835 3300007265 Bacteria 1059
144 Ga0099795_10003252 3300007788 Bacteria 3996
145 Ga0099795_10023076 3300007788 Bacteria 2061
146 Ga0099795_10058906 3300007788 Bacteria 1419
147 Ga0099795_10105280 3300007788 Bacteria 1112
148 Ga0105240_10014876 3300009093 Bacteria 10603
149 Ga0111539_10002236 3300009094 Bacteria 25841
150 Ga0111539_10011170 3300009094 Bacteria 11293
151 Ga0111539_10059879 3300009094 Bacteria 4514
152 Ga0111539_10269961 3300009094 Bacteria 1980
153 Ga0111539_10305262 3300009094 Bacteria 1852
154 Ga0111539_10900023 3300009094 Bacteria 1029
155 Ga0105245_10001124 3300009098 Bacteria 24188
156 Ga0114129_10001405 3300009147 Bacteria 32472
157 Ga0114129_10247277 3300009147 Bacteria 2395
158 Ga0114129_10546229 3300009147 Bacteria 1507
159 Ga0114129_11631338 3300009147 Bacteria 789
160 Ga0114129_11880953 3300009147 Bacteria 726
161 Ga0105243_10000577 3300009148 Bacteria 36910
162 Ga0105241_10108585 3300009174 Bacteria 2218
163 Ga0105248_10071215 3300009177 Bacteria 3905
164 Ga0105248_10667145 3300009177 Bacteria 1173
165 Ga0105237_10385448 3300009545 Unclassified 1406
166 Ga0105237_10465161 3300009545 Bacteria 1271
167 Ga0105238_10035004 3300009551 Bacteria 5108
168 Ga0105238_10268044 3300009551 Bacteria 1688
169 Ga0105238_10831119 3300009551 Bacteria 940
170 Ga0105249_10004287 3300009553 Bacteria 12329
171 Ga0105249_10024471 3300009553 Bacteria 5427
172 Ga0105249_10239532 3300009553 Bacteria 1793
173 Ga0099796_10000631 3300010159 Bacteria 6118
174 Ga0099796_10005641 3300010159 Bacteria 3135
175 Ga0099796_10035371 3300010159 Bacteria 1656
176 Ga0105239_10033302 3300010375 Bacteria 5659
177 Ga0105246_10461604 3300011119 Bacteria 1070
178 Ga0157373_10331235 3300013100 Unclassified 1084
179 Ga0157370_10139492 3300013104 Bacteria 2259
180 Ga0157369_10103733 3300013105 Unclassified 3029
181 Ga0157374_10127898 3300013296 Unclassified 2457
182 Ga0157374_10214402 3300013296 Bacteria 1888
183 Ga0157378_10000498 3300013297 Bacteria 37271
184 Ga0163162_10001032 3300013306 Bacteria 25916
185 Ga0163162_10056768 3300013306 Bacteria 3943
186 Ga0163162_10488994 3300013306 Bacteria 1362
187 Ga0157372_10099411 3300013307 Unclassified 3319
188 Ga0157375_10079271 3300013308 Bacteria 3319
189 Ga0182008_10009089 3300014497 Bacteria 5380
190 Ga0157377_10476294 3300014745 Bacteria 867
191 Ga0157379_10358515 3300014968 Bacteria 1336
192 Ga0157379_11337174 3300014968 Bacteria 693
193 Ga0157376_10000657 3300014969 Bacteria 22340
194 Ga0157376_10002186 3300014969 Bacteria 13177
195 Ga0157376_12057874 3300014969 Unclassified 609
196 Ga0182007_10129245 3300015262 Unclassified 849
197 Ga0197907_11475660 3300020069 Bacteria 841
198 Ga0206356_11549264 3300020070 Bacteria 623
199 Ga0206349_1696049 3300020075 Bacteria 701
200 Ga0206352_11087509 3300020078 Unclassified 874
201 Ga0206350_11266269 3300020080 Unclassified 908
202 Ga0206354_10456289 3300020081 Bacteria 663
203 Ga0213871_10076735 3300021441 Bacteria 952
204 Ga0224712_10065807 3300022467 Bacteria 1458
205 Ga0207688_10023634 3300025901 Bacteria 3368
206 Ga0207643_10137256 3300025908 Bacteria 1459
207 Ga0207684_10132626 3300025910 Bacteria 2138
208 Ga0207684_10500025 3300025910 Bacteria 1042
209 Ga0207654_10056253 3300025911 Bacteria 2281
210 Ga0207654_10170926 3300025911 Unclassified 1411
211 Ga0207707_10523060 3300025912 Unclassified 1010
212 Ga0207707_11118434 3300025912 Bacteria 641
213 Ga0207695_10160598 3300025913 Bacteria 2179
214 Ga0207671_10357531 3300025914 Unclassified 1158
215 Ga0207671_11041832 3300025914 Unclassified 644
216 Ga0207663_10449434 3300025916 Bacteria 994
217 Ga0207660_10520851 3300025917 Bacteria 966
218 Ga0207662_10000099 3300025918 Bacteria 40931
219 Ga0207662_10632405 3300025918 Bacteria 746
220 Ga0207652_10033727 3300025921 Bacteria 4312
221 Ga0207694_10137578 3300025924 Bacteria 1963
222 Ga0207694_10239883 3300025924 Bacteria 1481
223 Ga0207687_10001780 3300025927 Bacteria 14818
224 Ga0207664_10166679 3300025929 Bacteria 1883
225 Ga0207690_10326318 3300025932 Bacteria 1208
226 Ga0207686_10000295 3300025934 Bacteria 36702
227 Ga0207709_10001189 3300025935 Bacteria 18792
228 Ga0207670_10002969 3300025936 Bacteria 8956
229 Ga0207670_10003177 3300025936 Bacteria 8697
230 Ga0207704_10000643 3300025938 Bacteria 15451
231 Ga0207665_10067279 3300025939 Bacteria 2439
232 Ga0207665_10237435 3300025939 Bacteria 1342
233 Ga0207665_10709462 3300025939 Bacteria 791
234 Ga0207711_10380024 3300025941 Bacteria 1310
235 Ga0207689_10000432 3300025942 Bacteria 39235
236 Ga0207689_10262437 3300025942 Bacteria 1429
237 Ga0207667_10002062 3300025949 Bacteria 25186
238 Ga0207712_10002597 3300025961 Bacteria 11596
239 Ga0207640_10023637 3300025981 Bacteria 3696
240 Ga0207658_10038171 3300025986 Bacteria 3458
241 Ga0207677_10000957 3300026023 Bacteria 16029
242 Ga0207677_10158589 3300026023 Bacteria 1755
243 Ga0207703_10000781 3300026035 Bacteria 31328
244 Ga0207639_10500614 3300026041 Bacteria 1110
245 Ga0207639_10944915 3300026041 Bacteria 806
246 Ga0207708_10000412 3300026075 Bacteria 33576
247 Ga0207708_10663207 3300026075 Bacteria 889
248 Ga0207708_11561057 3300026075 Bacteria 580
249 Ga0207702_10033654 3300026078 Bacteria 4282
250 Ga0207702_10168267 3300026078 Bacteria 2007
251 Ga0207702_10859047 3300026078 Unclassified 898
252 Ga0207641_10903091 3300026088 Bacteria 877
253 Ga0207648_10000603 3300026089 Bacteria 40455
254 Ga0207676_10258767 3300026095 Bacteria 1570
255 Ga0207675_100000509 3300026118 Bacteria 37679
256 Ga0207675_100050940 3300026118 Bacteria 3864
257 Ga0207698_10455130 3300026142 Bacteria 1236
258 Ga0207698_11574211 3300026142 Bacteria 673
259 Ga0209179_1012988 3300027512 Bacteria 1505
260 Ga0209179_1087269 3300027512 Bacteria 690
261 Ga0209588_1019337 3300027671 Bacteria 2125
262 Ga0209588_1052629 3300027671 Bacteria 1317
263 Ga0207428_10001166 3300027907 Bacteria 28282
264 Ga0207428_10002355 3300027907 Bacteria 18877
265 Ga0207428_10357706 3300027907 Bacteria 1073
266 Ga0268266_10002056 3300028379 Bacteria 22316
267 Ga0268265_10077538 3300028380 Bacteria 2610
268 Ga0268265_10132994 3300028380 Bacteria 2070
269 Ga0268264_10003270 3300028381 Bacteria 14013
270 Ga0268264_12068407 3300028381 Bacteria 578
271 Ga0307515_10107076 3300028794 Bacteria 3309
272 Ga0307515_10161617 3300028794 Bacteria 2281
273 Ga0265338_10009227 3300028800 Bacteria 11807
274 Ga0307511_10000037 3300030521 Bacteria 103008
275 Ga0307513_10076951 3300031456 Bacteria 3458
276 Ga0307509_10000034 3300031507 Bacteria 193380
277 Ga0307516_10000405 3300031730 Bacteria 56495
278 Ga0307411_10556133 3300032005 Unclassified 980
279 Ga0307510_10000017 3300033180 Bacteria 195521
280 Ga0373948_0015591 3300034817 Bacteria 1397
281 Ga0373926_0109358 3300035083 Bacteria 1037
282 Ga0373929_0079750 3300035085 Bacteria 796
283 Ga0373929_0136479 3300035085 Bacteria 647
284 Ga0373934_0000261 3300035086 Bacteria 18894
285 Ga0373934_0079909 3300035086 Bacteria 1313
286 Ga0373940_0002562 3300035088 Bacteria 3556
287 Ga0373944_0007164 3300035089 Bacteria 2982
288 Ga0373944_0064818 3300035089 Bacteria 1179
289 Ga0373949_0038401 3300035090 Bacteria 1168
290 Ga0373951_0009204 3300035091 Bacteria 2225
291 Ga0373952_0002352 3300035092 Bacteria 3405
292 Ga0373923_0025167 3300035111 Bacteria 2356
293 Ga0373932_0020217 3300035112 Bacteria 1743
294 Ga0373936_0003251 3300035113 Bacteria 6090
295 Ga0373936_0019128 3300035113 Bacteria 2652
296 Ga0373936_0030740 3300035113 Unclassified 2118
297 Ga0373941_0322876 3300035115 Bacteria 621
298 Ga0373945_0000602 3300035116 Bacteria 10312
299 Ga0373953_0030998 3300035117 Bacteria 2077
300 Ga0373954_0000624 3300035118 Bacteria 13491
301 Ga0373954_0019279 3300035118 Bacteria 3076
302 Ga0373954_0146851 3300035118 Bacteria 1151
303 Ga0373956_0000228 3300035119 Bacteria 22321
304 Ga0373956_0078337 3300035119 Bacteria 1513
305 Ga0373960_0005881 3300035121 Bacteria 2855
306 Ga0373943_0001169 3300035170 Bacteria 11703
307 Ga0373943_0264772 3300035170 Bacteria 968
308 Ga0373946_0013960 3300035171 Bacteria 3025
309 Ga0373946_0038216 3300035171 Bacteria 1954
310 Ga0373955_0001679 3300035172 Bacteria 9462
311 Ga0373955_0050066 3300035172 Bacteria 2270
312 Ga0373955_0085015 3300035172 Bacteria 1795
313 Ga0373955_0113230 3300035172 Bacteria 1570
314 Ga0373942_0005539 3300035207 Bacteria 2925
315 Ga0373942_0099341 3300035207 Bacteria 887
316 Ga0373961_0002916 3300035241 Bacteria 4333
317 Ga0373962_0027604 3300035242 Bacteria 1536
318 Ga0373924_0002936 3300035410 Bacteria 5787
319 Ga0373931_0000606 3300035691 Bacteria 14835
320 Ga0373931_0022809 3300035691 Bacteria 3153
321 Ga0373935_0021934 3300035692 Bacteria 3910
322 Ga0373935_0123912 3300035692 Unclassified 1729
323 Ga0373935_0844691 3300035692 Unclassified 677
324 Ga0373927_0004471 3300035695 Bacteria 9781
325 Ga0373933_0000949 3300035724 Bacteria 17679
326 Ga0373933_0045246 3300035724 Bacteria 2609
327 Ga0373947_0055464 3300035725 Bacteria 2393
328 Ga0373937_0001064 3300036401 Bacteria 23171
329 Ga0373937_0049498 3300036401 Bacteria 3848
330 Ga0373937_0063925 3300036401 Bacteria 3384
331 Ga0373925_0890525 3300037068 Bacteria 733
332 Ga0395898_0680885 3300037466 Bacteria 971
333 Ga0395901_0948743 3300038443 Bacteria 839
334 Ga0436365_1408220 3300039437 Bacteria 1664
335 Ga0436360_0931085 3300039438 Bacteria 722
336 Ga0436360_1374889 3300039438 Unclassified 936
337 Ga0436361_0867018 3300039447 Unclassified 1448
338 Ga0436363_1079999 3300039450 Bacteria 876
339 Ga0436363_1643033 3300039450 Bacteria 886
340 Ga0436362_0281401 3300039453 Bacteria 3315
341 Ga0439460_0025926 3300042461 Unclassified 1637
342 Ga0450893_0038782 3300042532 Bacteria 868
343 Ga0451577_0052167 3300042876 Bacteria 3652
344 Ga0466960_0885399 3300044901 Bacteria 544
345 Ga0451576_0086333 3300045051 Bacteria 3263
346 Ga0451576_0489558 3300045051 Bacteria 1292
347 Ga0451576_1046601 3300045051 Bacteria 855
348 Ga0466967_0292296 3300045976 Unclassified 1566
349 Ga0495592_0058878 3300046454 Bacteria 2831
350 Ga0495603_0100275 3300046455 Bacteria 1691
351 Ga0495629_0075499 3300046459 Bacteria 2354
352 Ga0495638_0021365 3300046460 Bacteria 4268
353 Ga0495651_0000326 3300046462 Bacteria 36974
354 Ga0495651_0129674 3300046462 Bacteria 1842
355 Ga0495651_0504817 3300046462 Unclassified 774
356 Ga0495653_0130993 3300046463 Bacteria 1775
357 Ga0495653_0296428 3300046463 Bacteria 1056
358 Ga0495580_0007277 3300046472 Bacteria 8900
359 Ga0495580_0259446 3300046472 Bacteria 1188
360 Ga0495639_0045601 3300046475 Bacteria 1983
361 Ga0495664_0064700 3300046477 Bacteria 2180
362 Ga0495618_0162432 3300046514 Bacteria 1423
363 Ga0495628_0006239 3300046516 Bacteria 10418
364 Ga0495630_0002086 3300046517 Bacteria 13901
365 Ga0495630_0718623 3300046517 Bacteria 764
366 Ga0495666_0019471 3300046526 Bacteria 3368
367 Ga0495652_0053645 3300046529 Bacteria 3435
368 Ga0495586_0003378 3300046535 Bacteria 8561
369 Ga0495586_0011335 3300046535 Bacteria 4740
370 Ga0495587_0010269 3300046536 Bacteria 5968
371 Ga0495598_0198640 3300046537 Bacteria 723
372 Ga0495622_0057478 3300046557 Bacteria 1803
373 Ga0495667_0032102 3300046559 Bacteria 3521
374 Ga0495656_0241925 3300046615 Bacteria 909
375 Ga0495634_0006738 3300046642 Bacteria 8701
376 Ga0495611_0106525 3300046648 Unclassified 1304
377 Ga0495625_0255178 3300046660 Bacteria 1137
378 Ga0495635_0034834 3300046663 Bacteria 3492
379 Ga0495659_0069319 3300046664 Bacteria 1319
380 Ga0495659_0326400 3300046664 Bacteria 652
381 Ga0495588_0068442 3300046674 Bacteria 1844
382 Ga0495657_0050015 3300046675 Bacteria 2812
383 Ga0495599_0062236 3300046678 Bacteria 2331
384 Ga0495599_0645910 3300046678 Unclassified 613
385 Ga0495646_0072598 3300046680 Bacteria 2024
386 Ga0495647_0000224 3300046681 Bacteria 15334
387 Ga0495647_0000729 3300046681 Bacteria 9723
388 Ga0495658_0002293 3300046683 Bacteria 9651
389 Ga0495600_0025721 3300046809 Bacteria 3793
390 Ga0495604_0097170 3300047317 Bacteria 2172
391 Ga0495604_0103843 3300047317 Bacteria 2084
392 Ga0495636_0122593 3300047318 Bacteria 1151
393 Ga0495674_0004157 3300047319 Bacteria 13973
394 Ga0495676_0028037 3300047321 Bacteria 4819
395 Ga0495680_0015504 3300047322 Bacteria 6573
396 Ga0495680_0096424 3300047322 Bacteria 2209
397 Ga0495680_0935402 3300047322 Bacteria 558
398 Ga0495675_0069741 3300047444 Bacteria 2219
399 Ga0495675_0116712 3300047444 Bacteria 1664
400 Ga0495684_0021786 3300047471 Bacteria 4933
401 Ga0496101_0798624 3300048904 Unclassified 744
402 Ga0496102_0239909 3300048905 Bacteria 1709
403 Ga0496104_0116910 3300048907 Unclassified 2559
404 Ga0496105_0393121 3300048908 Bacteria 1102
405 Ga0496106_0092034 3300048909 Bacteria 2342
406 Ga0496106_0371787 3300048909 Bacteria 1149
407 Ga0496110_0828606 3300048913 Unclassified 830
408 Ga0496115_0012120 3300048918 Bacteria 6483
409 Ga0496115_0089230 3300048918 Bacteria 2518
410 Ga0496116_0044113 3300048919 Bacteria 3032
411 Ga0496117_0000110 3300048920 Bacteria 184627
412 Ga0496118_0000170 3300048921 Bacteria 117661
413 Ga0496119_0044898 3300048922 Bacteria 2776
414 Ga0496121_0261833 3300048924 Bacteria 1193
415 Ga0496124_0077445 3300048927 Bacteria 2742
416 Ga0496125_0008193 3300048928 Bacteria 10996
417 Ga0501031_0084450 3300049568 Unclassified 2070
418 Ga0501036_0057802 3300049572 Unclassified 3286
419 Ga0501036_0609690 3300049572 Bacteria 905
420 Ga0501042_0844985 3300049578 Bacteria 666
421 Ga0501047_0065521 3300049581 Bacteria 3502
422 Ga0501048_0455389 3300049582 Bacteria 916
423 Ga0501069_0163831 3300049585 Bacteria 1281
424 Ga0501069_0198621 3300049585 Bacteria 1162
425 Ga0501073_0781721 3300049589 Bacteria 658
426 Ga0501073_0896624 3300049589 Unclassified 611
427 Ga0501076_0146247 3300049592 Unclassified 1922
428 Ga0501080_0442644 3300049742 Bacteria 1166
429 Ga0501044_0056279 3300049823 Bacteria 4038
430 Ga0501045_1002235 3300049824 Unclassified 612
431 nmdc:mga06z11_222064_c1 3300050494 Bacteria 1104
432 nmdc:mga05p37_331_c1 3300050507 Bacteria 50709
433 nmdc:mga05p37_950894_c1 3300050507 Bacteria 919
434 nmdc:mga09592_11958_c1 3300050508 Bacteria 7061
435 nmdc:mga09592_27331_c1 3300050508 Bacteria 4734
436 nmdc:mga09592_618_c1 3300050508 Bacteria 27081
437 nmdc:mga09592_73244_c1 3300050508 Bacteria 2910
438 nmdc:mga0qj67_367938_c1 3300050509 Bacteria 1161
439 nmdc:mga0qj67_37210_c1 3300050509 Bacteria 3811
440 nmdc:mga0qj67_449487_c1 3300050509 Bacteria 1038
441 nmdc:mga0qj67_89219_c1 3300050509 Bacteria 2476
442 nmdc:mga06r32_128167_c1 3300050510 Bacteria 2508
443 nmdc:mga06r32_84325_c1 3300050510 Bacteria 3097
444 nmdc:mga08y16_10906_c1 3300050511 Bacteria 9545
445 nmdc:mga08y16_127415_c1 3300050511 Bacteria 2648
446 nmdc:mga08y16_319300_c1 3300050511 Bacteria 1599
447 nmdc:mga08y16_4836_c1 3300050511 Bacteria 14056
448 nmdc:mga08y16_631_c1 3300050511 Bacteria 33026
449 nmdc:mga0n895_125746_c1 3300050512 Bacteria 2588
450 nmdc:mga0n895_1564037_c1 3300050512 Bacteria 624
451 nmdc:mga0n895_221776_c1 3300050512 Bacteria 1919
452 nmdc:mga0n895_298808_c1 3300050512 Bacteria 1632
453 nmdc:mga0n895_330859_c1 3300050512 Bacteria 1544
454 nmdc:mga0n895_614565_c1 3300050512 Unclassified 1088
455 nmdc:mga0rr50_206279_c1 3300050513 Unclassified 1282
456 nmdc:mga0rr50_792432_c1 3300050513 Bacteria 809
457 nmdc:mga08x19_140127_c1 3300050514 Unclassified 1633
458 nmdc:mga08x19_2046_c1 3300050514 Bacteria 12365
459 nmdc:mga08x19_40153_c1 3300050514 Bacteria 2977
460 nmdc:mga08x19_50991_c1 3300050514 Bacteria 2657
461 nmdc:mga08x19_568464_c1 3300050514 Bacteria 803
462 nmdc:mga08x19_6631_c1 3300050514 Bacteria 6865
463 nmdc:mga08x19_79825_c1 3300050514 Bacteria 2146
464 nmdc:mga0a205_215429_c1 3300050515 Bacteria 1807
465 nmdc:mga0a205_23471_c1 3300050515 Bacteria 5852
466 nmdc:mga0a205_577109_c1 3300050515 Bacteria 978
467 nmdc:mga0a205_584666_c1 3300050515 Bacteria 970
468 Ga0495612_0062404 3300053078 Bacteria 1545
469 Ga0495595_0040214 3300053084 Bacteria 2136
470 Ga0495619_0080401 3300053085 Bacteria 2193
471 Ga0099795_10000492
472 JGI24742J22300_10012382
473 rootH1_10286775
474 Ga0058861_11689562
475 Ga0058860_11407751
476 Ga0065704_10116414
477 Ga0065707_10391137
478 Ga0065707_10402014
479 Ga0070683_100423834
480 Ga0070690_100000860
481 Ga0068869_100000089
482 Ga0070680_100000992
483 Ga0070680_100248831
484 Ga0070680_100660621
485 Ga0070682_100054665
486 Ga0070682_101303470
487 Ga0070689_100000185
488 Ga0070691_10001436
489 Ga0070691_10146490
490 Ga0070687_100000160
491 Ga0070692_10016739
492 Ga0070692_10137846
493 Ga0070673_101647428
494 Ga0070667_100030517
495 Ga0070714_100680882
496 Ga0070713_100264102
497 Ga0070713_100980859
498 Ga0070710_10629355
499 Ga0070711_100201169
500 Ga0070705_100003800
501 Ga0070705_100596044
502 Ga0070705_100843032
503 Ga0070700_100001045
504 Ga0070700_101433018
505 Ga0070694_100000089
506 Ga0070694_100007910
507 Ga0070694_100095979
508 Ga0070694_100111927
509 Ga0070708_100169923
510 Ga0070681_10248990
511 Ga0070681_10329186
512 Ga0070681_10451546
513 Ga0070681_10755360
514 Ga0068867_100001296
515 Ga0070706_100097800
516 Ga0070707_100266177
517 Ga0070699_100049683
518 Ga0070699_100261741
519 Ga0070699_100889517
520 Ga0070679_100002498
521 Ga0070697_100228373
522 Ga0070697_101258611
523 Ga0068853_100161141
524 Ga0070686_100001902
525 Ga0070695_100000187
526 Ga0070695_100012911
527 Ga0070695_100079648
528 Ga0070695_100713209
529 Ga0070695_101681524
530 Ga0070696_100000077
531 Ga0070696_101234400
532 Ga0070693_100000125
533 Ga0070665_100187655
534 Ga0070704_100000051
535 Ga0070704_100009724
536 Ga0070704_100487774
537 Ga0070704_100618784
538 Ga0070704_100984472
539 Ga0068855_100000741
540 Ga0068855_100900104
541 Ga0068854_100028793
542 Ga0068856_100020707
543 Ga0070702_100000279
544 Ga0068852_100054134
545 Ga0068852_101906932
546 Ga0068859_100095835
547 Ga0068859_100297517
548 Ga0068864_100246444
549 Ga0068864_100603474
550 Ga0068866_10001003
551 Ga0068861_100002682
552 Ga0068861_100019170
553 Ga0068861_101016078
554 Ga0068870_10122733
555 Ga0068863_100167053
556 Ga0068863_100181739
557 Ga0068858_100008811
558 Ga0068858_100368641
559 Ga0068860_100000810
560 Ga0068862_100000622
561 Ga0068862_100108172
562 Ga0068862_100828921
563 Ga0081539_10002070
564 Ga0070717_11724436
565 Ga0070715_10121759
566 Ga0070716_100443209
567 Ga0070716_100499518
568 Ga0070712_100942905
569 Ga0075367_10688557
570 Ga0097621_100001434
571 Ga0097621_100001482
572 Ga0068871_100000440
573 Ga0068871_100028092
574 Ga0068871_100764360
575 Ga0075428_100000835
576 Ga0075428_100003747
577 Ga0075428_100007029
578 Ga0075428_100013667
579 Ga0075428_100968590
580 Ga0075430_100006002
581 Ga0075430_100135270
582 Ga0075430_100172072
583 Ga0075430_100507609
584 Ga0075431_100053056
585 Ga0075431_100105693
586 Ga0075433_10005345
587 Ga0075433_10162035
588 Ga0075433_10597828
589 Ga0075433_11109821
590 Ga0075434_100000621
591 Ga0075434_100444670
592 Ga0075434_100498371
593 Ga0075434_101203824
594 Ga0075429_100000096
595 Ga0075429_100002189
596 Ga0075429_100184364
597 Ga0068865_100000149
598 Ga0075436_100000816
599 Ga0075436_100004243
600 Ga0075436_100017171
601 Ga0075436_100017505
602 Ga0075436_100073560
603 Ga0075436_100111971
604 Ga0075436_100113533
605 Ga0075436_100431587
606 Ga0075436_100787020
607 Ga0097620_100095824
608 Ga0097620_100297517
609 Ga0075435_100000485
610 Ga0075435_100479973
611 Ga0075435_100703310
612 Ga0099794_10022318
613 Ga0099794_10186835
614 Ga0099795_10003252
615 Ga0099795_10023076
616 Ga0099795_10058906
617 Ga0099795_10105280
618 Ga0105240_10014876
619 Ga0111539_10002236
620 Ga0111539_10011170
621 Ga0111539_10059879
622 Ga0111539_10269961
623 Ga0111539_10305262
624 Ga0111539_10900023
625 Ga0105245_10001124
626 Ga0114129_10001405
627 Ga0114129_10247277
628 Ga0114129_10546229
629 Ga0114129_11631338
630 Ga0114129_11880953
631 Ga0105243_10000577
632 Ga0105241_10108585
633 Ga0105248_10071215
634 Ga0105248_10667145
635 Ga0105237_10385448
636 Ga0105237_10465161
637 Ga0105238_10035004
638 Ga0105238_10268044
639 Ga0105238_10831119
640 Ga0105249_10004287
641 Ga0105249_10024471
642 Ga0105249_10239532
643 Ga0099796_10000631
644 Ga0099796_10005641
645 Ga0099796_10035371
646 Ga0105239_10033302
647 Ga0105246_10461604
648 Ga0157373_10331235
649 Ga0157370_10139492
650 Ga0157369_10103733
651 Ga0157374_10127898
652 Ga0157374_10214402
653 Ga0157378_10000498
654 Ga0163162_10001032
655 Ga0163162_10056768
656 Ga0163162_10488994
657 Ga0157372_10099411
658 Ga0157375_10079271
659 Ga0182008_10009089
660 Ga0157377_10476294
661 Ga0157379_10358515
662 Ga0157379_11337174
663 Ga0157376_10000657
664 Ga0157376_10002186
665 Ga0157376_12057874
666 Ga0182007_10129245
667 Ga0197907_11475660
668 Ga0206356_11549264
669 Ga0206349_1696049
670 Ga0206352_11087509
671 Ga0206350_11266269
672 Ga0206354_10456289
673 Ga0213871_10076735
674 Ga0224712_10065807
675 Ga0207688_10023634
676 Ga0207643_10137256
677 Ga0207684_10132626
678 Ga0207684_10500025
679 Ga0207654_10056253
680 Ga0207654_10170926
681 Ga0207707_10523060
682 Ga0207707_11118434
683 Ga0207695_10160598
684 Ga0207671_10357531
685 Ga0207671_11041832
686 Ga0207663_10449434
687 Ga0207660_10520851
688 Ga0207662_10000099
689 Ga0207662_10632405
690 Ga0207652_10033727
691 Ga0207694_10137578
692 Ga0207694_10239883
693 Ga0207687_10001780
694 Ga0207664_10166679
695 Ga0207690_10326318
696 Ga0207686_10000295
697 Ga0207709_10001189
698 Ga0207670_10002969
699 Ga0207670_10003177
700 Ga0207704_10000643
701 Ga0207665_10067279
702 Ga0207665_10237435
703 Ga0207665_10709462
704 Ga0207711_10380024
705 Ga0207689_10000432
706 Ga0207689_10262437
707 Ga0207667_10002062
708 Ga0207712_10002597
709 Ga0207640_10023637
710 Ga0207658_10038171
711 Ga0207677_10000957
712 Ga0207677_10158589
713 Ga0207703_10000781
714 Ga0207639_10500614
715 Ga0207639_10944915
716 Ga0207708_10000412
717 Ga0207708_10663207
718 Ga0207708_11561057
719 Ga0207702_10033654
720 Ga0207702_10168267
721 Ga0207702_10859047
722 Ga0207641_10903091
723 Ga0207648_10000603
724 Ga0207676_10258767
725 Ga0207675_100000509
726 Ga0207675_100050940
727 Ga0207698_10455130
728 Ga0207698_11574211
729 Ga0209179_1012988
730 Ga0209179_1087269
731 Ga0209588_1019337
732 Ga0209588_1052629
733 Ga0207428_10001166
734 Ga0207428_10002355
735 Ga0207428_10357706
736 Ga0268266_10002056
737 Ga0268265_10077538
738 Ga0268265_10132994
739 Ga0268264_10003270
740 Ga0268264_12068407
741 Ga0307515_10107076
742 Ga0307515_10161617
743 Ga0265338_10009227
744 Ga0307511_10000037
745 Ga0307513_10076951
746 Ga0307509_10000034
747 Ga0307516_10000405
748 Ga0307411_10556133
749 Ga0307510_10000017
750 Ga0373948_0015591
751 Ga0373926_0109358
752 Ga0373929_0079750
753 Ga0373929_0136479
754 Ga0373934_0000261
755 Ga0373934_0079909
756 Ga0373940_0002562
757 Ga0373944_0007164
758 Ga0373944_0064818
759 Ga0373949_0038401
760 Ga0373951_0009204
761 Ga0373952_0002352
762 Ga0373923_0025167
763 Ga0373932_0020217
764 Ga0373936_0003251
765 Ga0373936_0019128
766 Ga0373936_0030740
767 Ga0373941_0322876
768 Ga0373945_0000602
769 Ga0373953_0030998
770 Ga0373954_0000624
771 Ga0373954_0019279
772 Ga0373954_0146851
773 Ga0373956_0000228
774 Ga0373956_0078337
775 Ga0373960_0005881
776 Ga0373943_0001169
777 Ga0373943_0264772
778 Ga0373946_0013960
779 Ga0373946_0038216
780 Ga0373955_0001679
781 Ga0373955_0050066
782 Ga0373955_0085015
783 Ga0373955_0113230
784 Ga0373942_0005539
785 Ga0373942_0099341
786 Ga0373961_0002916
787 Ga0373962_0027604
788 Ga0373924_0002936
789 Ga0373931_0000606
790 Ga0373931_0022809
791 Ga0373935_0021934
792 Ga0373935_0123912
793 Ga0373935_0844691
794 Ga0373927_0004471
795 Ga0373933_0000949
796 Ga0373933_0045246
797 Ga0373947_0055464
798 Ga0373937_0001064
799 Ga0373937_0049498
800 Ga0373937_0063925
801 Ga0373925_0890525
802 Ga0395898_0680885
803 Ga0395901_0948743
804 Ga0436365_1408220
805 Ga0436360_0931085
806 Ga0436360_1374889
807 Ga0436361_0867018
808 Ga0436363_1079999
809 Ga0436363_1643033
810 Ga0436362_0281401
811 Ga0439460_0025926
812 Ga0450893_0038782
813 Ga0451577_0052167
814 Ga0466960_0885399
815 Ga0451576_0086333
816 Ga0451576_0489558
817 Ga0451576_1046601
818 Ga0466967_0292296
819 Ga0495592_0058878
820 Ga0495603_0100275
821 Ga0495629_0075499
822 Ga0495638_0021365
823 Ga0495651_0000326
824 Ga0495651_0129674
825 Ga0495651_0504817
826 Ga0495653_0130993
827 Ga0495653_0296428
828 Ga0495580_0007277
829 Ga0495580_0259446
830 Ga0495639_0045601
831 Ga0495664_0064700
832 Ga0495618_0162432
833 Ga0495628_0006239
834 Ga0495630_0002086
835 Ga0495630_0718623
836 Ga0495666_0019471
837 Ga0495652_0053645
838 Ga0495586_0003378
839 Ga0495586_0011335
840 Ga0495587_0010269
841 Ga0495598_0198640
842 Ga0495622_0057478
843 Ga0495667_0032102
844 Ga0495656_0241925
845 Ga0495634_0006738
846 Ga0495611_0106525
847 Ga0495625_0255178
848 Ga0495635_0034834
849 Ga0495659_0069319
850 Ga0495659_0326400
851 Ga0495588_0068442
852 Ga0495657_0050015
853 Ga0495599_0062236
854 Ga0495599_0645910
855 Ga0495646_0072598
856 Ga0495647_0000224
857 Ga0495647_0000729
858 Ga0495658_0002293
859 Ga0495600_0025721
860 Ga0495604_0097170
861 Ga0495604_0103843
862 Ga0495636_0122593
863 Ga0495674_0004157
864 Ga0495676_0028037
865 Ga0495680_0015504
866 Ga0495680_0096424
867 Ga0495680_0935402
868 Ga0495675_0069741
869 Ga0495675_0116712
870 Ga0495684_0021786
871 Ga0496101_0798624
872 Ga0496102_0239909
873 Ga0496104_0116910
874 Ga0496105_0393121
875 Ga0496106_0092034
876 Ga0496106_0371787
877 Ga0496110_0828606
878 Ga0496115_0012120
879 Ga0496115_0089230
880 Ga0496116_0044113
881 Ga0496117_0000110
882 Ga0496118_0000170
883 Ga0496119_0044898
884 Ga0496121_0261833
885 Ga0496124_0077445
886 Ga0496125_0008193
887 Ga0501031_0084450
888 Ga0501036_0057802
889 Ga0501036_0609690
890 Ga0501042_0844985
891 Ga0501047_0065521
892 Ga0501048_0455389
893 Ga0501069_0163831
894 Ga0501069_0198621
895 Ga0501073_0781721
896 Ga0501073_0896624
897 Ga0501076_0146247
898 Ga0501080_0442644
899 Ga0501044_0056279
900 Ga0501045_1002235
901 nmdc:mga06z11_222064_c1
902 nmdc:mga05p37_331_c1
903 nmdc:mga05p37_950894_c1
904 nmdc:mga09592_11958_c1
905 nmdc:mga09592_27331_c1
906 nmdc:mga09592_618_c1
907 nmdc:mga09592_73244_c1
908 nmdc:mga0qj67_367938_c1
909 nmdc:mga0qj67_37210_c1
910 nmdc:mga0qj67_449487_c1
911 nmdc:mga0qj67_89219_c1
912 nmdc:mga06r32_128167_c1
913 nmdc:mga06r32_84325_c1
914 nmdc:mga08y16_10906_c1
915 nmdc:mga08y16_127415_c1
916 nmdc:mga08y16_319300_c1
917 nmdc:mga08y16_4836_c1
918 nmdc:mga08y16_631_c1
919 nmdc:mga0n895_125746_c1
920 nmdc:mga0n895_1564037_c1
921 nmdc:mga0n895_221776_c1
922 nmdc:mga0n895_298808_c1
923 nmdc:mga0n895_330859_c1
924 nmdc:mga0n895_614565_c1
925 nmdc:mga0rr50_206279_c1
926 nmdc:mga0rr50_792432_c1
927 nmdc:mga08x19_140127_c1
928 nmdc:mga08x19_2046_c1
929 nmdc:mga08x19_40153_c1
930 nmdc:mga08x19_50991_c1
931 nmdc:mga08x19_568464_c1
932 nmdc:mga08x19_6631_c1
933 nmdc:mga08x19_79825_c1
934 nmdc:mga0a205_215429_c1
935 nmdc:mga0a205_23471_c1
936 nmdc:mga0a205_577109_c1
937 nmdc:mga0a205_584666_c1
938 Ga0495612_0062404
939 Ga0495595_0040214
940 Ga0495619_0080401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

142

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zd7-assembly1.cif.gz_A crystal structure of the r24e/e352t double mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.8279 35 57
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.8207 11 124
5m67-assembly1.cif.gz_B crystal structure of s-adenosyl-l-homocysteine hydrolase from bradyrhizobium elkanii in complex with adenine and 2'-deoxyadenosine 0.8114 34 57
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.7884 11 124
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7832 16 125
ID Description Score Start End Superfamily
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8101 11 123 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7916 16 125 3.10.180.10
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7903 11 123 3.10.180.10
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.763 72 124 3.30.720.110
3sk2B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7616 14 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V6PJ74-F1-model_v4 VOC domain-containing protein 0.9219 15 124 GO:0004462
GO:0046872
AF-A0A537FW86-F1-model_v4 VOC family protein 0.9189 16 143
AF-A0A6I1QU01-F1-model_v4 VOC domain-containing protein 0.903 12 124
AF-A0A535BAS9-F1-model_v4 VOC family protein 0.9002 12 127
AF-A0A2E7I243-F1-model_v4 VOC domain-containing protein 0.8965 9 148

Map