F449988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 468 | 298 | 465 | 91 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100497050|Ga0070706_1004970501 |
| Length | 106 |
| Sequence | MARSLRKGPFVDPSLQRKVDASLAGGSKQVIRTWSRRSMITPDFVGLTFHVHNGKLFVPVFVTENMVGHRLGEFSPTRKFTGHSGAKKVKTVAAPSSPMPVPGQKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 3 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 80 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 122 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 123 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 124 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 125 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 134 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 160 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 162 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 165 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 166 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 167 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 168 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 169 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 170 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 171 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 172 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 240 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 247 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 261 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 263 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 266 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 267 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 273 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300060244 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.58 |
| Metatranscriptomes | 27.78 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.48 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 87.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1037201 | 3300001904 | Bacteria | 750 |
| 2 | JGI24739J22299_10248889 | 3300001989 | Bacteria | 521 |
| 3 | JGI24737J22298_10001191 | 3300001990 | Bacteria | 9175 |
| 4 | JGI24735J21928_10001634 | 3300002067 | Bacteria | 7935 |
| 5 | JGI25157J39369_1012503 | 3300002741 | Bacteria | 1079 |
| 6 | JGI25157J39369_1036779 | 3300002741 | Bacteria | 547 |
| 7 | JGI25165J46597_1030395 | 3300003214 | Bacteria | 697 |
| 8 | rootL2_10134610 | 3300003322 | Bacteria | 2534 |
| 9 | rootH1_10116742 | 3300003323 | Bacteria | 1409 |
| 10 | Ga0055536_1006040 | 3300003781 | Bacteria | 5745 |
| 11 | Ga0055543_1023698 | 3300004625 | Bacteria | 1105 |
| 12 | Ga0058863_11894467 | 3300004799 | Bacteria | 1830 |
| 13 | Ga0058860_11979646 | 3300004801 | Bacteria | 978 |
| 14 | Ga0058862_11525955 | 3300004803 | Bacteria | 1479 |
| 15 | Ga0058862_12680365 | 3300004803 | Bacteria | 536 |
| 16 | Ga0058862_12740678 | 3300004803 | Bacteria | 703 |
| 17 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 18 | Ga0065704_10014908 | 3300005289 | Bacteria | 2005 |
| 19 | Ga0065704_10422899 | 3300005289 | Bacteria | 657 |
| 20 | Ga0065704_10426557 | 3300005289 | Bacteria | 727 |
| 21 | Ga0065707_10068828 | 3300005295 | Bacteria | 549 |
| 22 | Ga0065707_10484260 | 3300005295 | Bacteria | 771 |
| 23 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 24 | Ga0070676_10520477 | 3300005328 | Bacteria | 847 |
| 25 | Ga0070660_100007068 | 3300005339 | Bacteria | 7799 |
| 26 | Ga0070668_101518162 | 3300005347 | Bacteria | 613 |
| 27 | Ga0070668_102172490 | 3300005347 | Bacteria | 513 |
| 28 | Ga0070675_101428503 | 3300005354 | Bacteria | 638 |
| 29 | Ga0070671_100794976 | 3300005355 | Bacteria | 823 |
| 30 | Ga0070688_100302945 | 3300005365 | Bacteria | 1156 |
| 31 | Ga0070659_100008718 | 3300005366 | Bacteria | 7421 |
| 32 | Ga0070667_101665396 | 3300005367 | Bacteria | 600 |
| 33 | Ga0068867_101388288 | 3300005459 | Bacteria | 651 |
| 34 | Ga0070706_100497050 | 3300005467 | Bacteria | 1135 |
| 35 | Ga0070679_100510731 | 3300005530 | Bacteria | 1146 |
| 36 | Ga0068853_100081417 | 3300005539 | Bacteria | 2835 |
| 37 | Ga0070686_101728309 | 3300005544 | Bacteria | 531 |
| 38 | Ga0070695_100226104 | 3300005545 | Bacteria | 1350 |
| 39 | Ga0070696_100162632 | 3300005546 | Bacteria | 1645 |
| 40 | Ga0070704_100433128 | 3300005549 | Bacteria | 1129 |
| 41 | Ga0068855_100044845 | 3300005563 | Bacteria | 5231 |
| 42 | Ga0068855_100824591 | 3300005563 | Bacteria | 984 |
| 43 | Ga0068857_100038490 | 3300005577 | Bacteria | 4236 |
| 44 | Ga0068857_101087483 | 3300005577 | Bacteria | 772 |
| 45 | Ga0068854_100068418 | 3300005578 | Bacteria | 2589 |
| 46 | Ga0068854_101837642 | 3300005578 | Bacteria | 556 |
| 47 | Ga0068852_101353931 | 3300005616 | Bacteria | 734 |
| 48 | Ga0068859_100352672 | 3300005617 | Bacteria | 1566 |
| 49 | Ga0068861_100585687 | 3300005719 | Bacteria | 1022 |
| 50 | Ga0068870_10479651 | 3300005840 | Bacteria | 825 |
| 51 | Ga0068858_100779401 | 3300005842 | Bacteria | 932 |
| 52 | Ga0068858_101707600 | 3300005842 | Bacteria | 622 |
| 53 | Ga0068860_100326634 | 3300005843 | Bacteria | 1506 |
| 54 | Ga0070716_100178428 | 3300006173 | Bacteria | 1392 |
| 55 | Ga0070712_100565079 | 3300006175 | Bacteria | 960 |
| 56 | Ga0075362_10412817 | 3300006177 | Bacteria | 682 |
| 57 | Ga0075366_10000288 | 3300006195 | Bacteria | 22515 |
| 58 | Ga0075366_10077240 | 3300006195 | Bacteria | 1987 |
| 59 | Ga0075366_10106699 | 3300006195 | Bacteria | 1684 |
| 60 | Ga0075370_10063124 | 3300006353 | Bacteria | 2111 |
| 61 | Ga0075370_10450086 | 3300006353 | Bacteria | 775 |
| 62 | Ga0075370_10471947 | 3300006353 | Bacteria | 756 |
| 63 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 64 | Ga0075428_100272873 | 3300006844 | Bacteria | 1820 |
| 65 | Ga0075428_100335530 | 3300006844 | Bacteria | 1624 |
| 66 | Ga0075430_100455491 | 3300006846 | Bacteria | 1056 |
| 67 | Ga0075430_100666777 | 3300006846 | Bacteria | 858 |
| 68 | Ga0075431_100256533 | 3300006847 | Bacteria | 1775 |
| 69 | Ga0075431_100904296 | 3300006847 | Bacteria | 852 |
| 70 | Ga0075431_101697136 | 3300006847 | Bacteria | 588 |
| 71 | Ga0075433_11344379 | 3300006852 | Bacteria | 619 |
| 72 | Ga0075429_100317476 | 3300006880 | Bacteria | 1363 |
| 73 | Ga0075429_100392049 | 3300006880 | Bacteria | 1216 |
| 74 | Ga0068865_101650585 | 3300006881 | Bacteria | 577 |
| 75 | Ga0097620_100352668 | 3300006931 | Bacteria | 1566 |
| 76 | Ga0099794_10469421 | 3300007265 | Bacteria | 661 |
| 77 | Ga0105240_10041987 | 3300009093 | Bacteria | 5831 |
| 78 | Ga0105240_10048322 | 3300009093 | Bacteria | 5379 |
| 79 | Ga0105240_10404513 | 3300009093 | Bacteria | 1537 |
| 80 | Ga0105240_10661368 | 3300009093 | Bacteria | 1144 |
| 81 | Ga0105247_10743125 | 3300009101 | Bacteria | 743 |
| 82 | Ga0114129_10134996 | 3300009147 | Bacteria | 3386 |
| 83 | Ga0114129_10421592 | 3300009147 | Bacteria | 1755 |
| 84 | Ga0105241_10009907 | 3300009174 | Bacteria | 7004 |
| 85 | Ga0105241_10703499 | 3300009174 | Bacteria | 923 |
| 86 | Ga0105248_12476230 | 3300009177 | Bacteria | 591 |
| 87 | Ga0105237_10035876 | 3300009545 | Bacteria | 5016 |
| 88 | Ga0105237_11818087 | 3300009545 | Bacteria | 617 |
| 89 | Ga0105238_10248125 | 3300009551 | Bacteria | 1758 |
| 90 | Ga0105238_12366008 | 3300009551 | Bacteria | 567 |
| 91 | Ga0105249_12380731 | 3300009553 | Bacteria | 602 |
| 92 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 93 | Ga0105239_10122693 | 3300010375 | Bacteria | 2887 |
| 94 | Ga0105239_11570583 | 3300010375 | Bacteria | 761 |
| 95 | Ga0105239_11640035 | 3300010375 | Bacteria | 744 |
| 96 | Ga0157326_1016658 | 3300012513 | Bacteria | 872 |
| 97 | Ga0157371_10001664 | 3300013102 | Bacteria | 22687 |
| 98 | Ga0157371_11424422 | 3300013102 | Bacteria | 539 |
| 99 | Ga0157371_11587625 | 3300013102 | Bacteria | 512 |
| 100 | Ga0157370_10047165 | 3300013104 | Bacteria | 4130 |
| 101 | Ga0157370_11599843 | 3300013104 | Bacteria | 585 |
| 102 | Ga0157369_10007412 | 3300013105 | Bacteria | 12631 |
| 103 | Ga0157374_10173144 | 3300013296 | Bacteria | 2106 |
| 104 | Ga0157374_10609812 | 3300013296 | Bacteria | 1102 |
| 105 | Ga0157378_10058863 | 3300013297 | Bacteria | 3427 |
| 106 | Ga0163162_10379084 | 3300013306 | Bacteria | 1547 |
| 107 | Ga0157372_10064662 | 3300013307 | Bacteria | 4104 |
| 108 | Ga0157372_10269915 | 3300013307 | Bacteria | 1976 |
| 109 | Ga0157375_13077954 | 3300013308 | Bacteria | 556 |
| 110 | Ga0206356_10239140 | 3300020070 | Bacteria | 1146 |
| 111 | Ga0206356_11003395 | 3300020070 | Bacteria | 2327 |
| 112 | Ga0206349_1204727 | 3300020075 | Bacteria | 1249 |
| 113 | Ga0206355_1259448 | 3300020076 | Bacteria | 985 |
| 114 | Ga0206351_10512829 | 3300020077 | Bacteria | 15076 |
| 115 | Ga0206352_10935446 | 3300020078 | Bacteria | 1890 |
| 116 | Ga0206350_10752456 | 3300020080 | Bacteria | 3060 |
| 117 | Ga0206350_11611523 | 3300020080 | Bacteria | 576 |
| 118 | Ga0206354_11306986 | 3300020081 | Bacteria | 4239 |
| 119 | Ga0206353_10607448 | 3300020082 | Bacteria | 1144 |
| 120 | Ga0154015_1037437 | 3300020610 | Bacteria | 13281 |
| 121 | Ga0224712_10003182 | 3300022467 | Bacteria | 4212 |
| 122 | Ga0224712_10003582 | 3300022467 | Bacteria | 4061 |
| 123 | Ga0209026_1003238 | 3300025250 | Bacteria | 5483 |
| 124 | Ga0209026_1004981 | 3300025250 | Bacteria | 3723 |
| 125 | Ga0209148_1024264 | 3300025254 | Bacteria | 959 |
| 126 | Ga0209233_1001329 | 3300025261 | Bacteria | 9868 |
| 127 | Ga0209233_1003581 | 3300025261 | Bacteria | 5451 |
| 128 | Ga0209455_1013843 | 3300025272 | Bacteria | 1854 |
| 129 | Ga0209676_1000332 | 3300025292 | Bacteria | 90798 |
| 130 | Ga0209050_1038388 | 3300025298 | Bacteria | 1366 |
| 131 | Ga0207647_10000171 | 3300025904 | Bacteria | 51875 |
| 132 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 133 | Ga0207684_10086390 | 3300025910 | Bacteria | 2672 |
| 134 | Ga0207684_10402324 | 3300025910 | Bacteria | 1177 |
| 135 | Ga0207654_10014217 | 3300025911 | Bacteria | 4110 |
| 136 | Ga0207654_10319167 | 3300025911 | Bacteria | 1061 |
| 137 | Ga0207654_10534306 | 3300025911 | Bacteria | 831 |
| 138 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 139 | Ga0207695_10081967 | 3300025913 | Bacteria | 3263 |
| 140 | Ga0207695_10275711 | 3300025913 | Bacteria | 1576 |
| 141 | Ga0207695_10359162 | 3300025913 | Bacteria | 1343 |
| 142 | Ga0207671_10201010 | 3300025914 | Bacteria | 1556 |
| 143 | Ga0207671_10998199 | 3300025914 | Bacteria | 660 |
| 144 | Ga0207693_10769761 | 3300025915 | Bacteria | 743 |
| 145 | Ga0207660_10617026 | 3300025917 | Bacteria | 884 |
| 146 | Ga0207657_10105386 | 3300025919 | Bacteria | 2334 |
| 147 | Ga0207694_10154790 | 3300025924 | Bacteria | 1848 |
| 148 | Ga0207690_10012751 | 3300025932 | Bacteria | 5037 |
| 149 | Ga0207665_10510152 | 3300025939 | Bacteria | 930 |
| 150 | Ga0207665_10794563 | 3300025939 | Unclassified | 747 |
| 151 | Ga0207667_10095966 | 3300025949 | Bacteria | 3060 |
| 152 | Ga0207667_10542459 | 3300025949 | Bacteria | 1177 |
| 153 | Ga0207668_10649041 | 3300025972 | Bacteria | 924 |
| 154 | Ga0207640_10025047 | 3300025981 | Bacteria | 3607 |
| 155 | Ga0207703_11591459 | 3300026035 | Bacteria | 629 |
| 156 | Ga0207639_10039149 | 3300026041 | Bacteria | 3531 |
| 157 | Ga0207639_11155537 | 3300026041 | Bacteria | 726 |
| 158 | Ga0207674_10016950 | 3300026116 | Bacteria | 7956 |
| 159 | Ga0207674_11354077 | 3300026116 | Bacteria | 681 |
| 160 | Ga0207674_11457746 | 3300026116 | Bacteria | 654 |
| 161 | Ga0207675_100337424 | 3300026118 | Bacteria | 1475 |
| 162 | Ga0207698_10884310 | 3300026142 | Bacteria | 900 |
| 163 | Ga0209999_1007217 | 3300027543 | Bacteria | 1997 |
| 164 | Ga0268265_11817992 | 3300028380 | Bacteria | 616 |
| 165 | Ga0268264_10053452 | 3300028381 | Bacteria | 3370 |
| 166 | Ga0268264_11226521 | 3300028381 | Bacteria | 760 |
| 167 | Ga0265326_10062435 | 3300028558 | Bacteria | 1054 |
| 168 | Ga0265334_10000272 | 3300028573 | Bacteria | 29197 |
| 169 | Ga0265334_10002690 | 3300028573 | Bacteria | 8214 |
| 170 | Ga0265318_10040734 | 3300028577 | Bacteria | 1768 |
| 171 | Ga0265338_10000135 | 3300028800 | Bacteria | 135743 |
| 172 | Ga0265338_10283863 | 3300028800 | Bacteria | 1209 |
| 173 | Ga0265324_10000247 | 3300029957 | Bacteria | 40078 |
| 174 | Ga0316177_1219406 | 3300030731 | Bacteria | 1129 |
| 175 | Ga0314311_1002819 | 3300030733 | Bacteria | 634 |
| 176 | Ga0316179_1011335 | 3300030734 | Bacteria | 581 |
| 177 | Ga0316180_1144171 | 3300030736 | Bacteria | 1178 |
| 178 | Ga0265328_10026643 | 3300031239 | Bacteria | 2172 |
| 179 | Ga0265339_10275706 | 3300031249 | Bacteria | 807 |
| 180 | Ga0265331_10024674 | 3300031250 | Bacteria | 3040 |
| 181 | Ga0265331_10233349 | 3300031250 | Bacteria | 826 |
| 182 | Ga0265327_10001935 | 3300031251 | Bacteria | 23890 |
| 183 | Ga0265327_10059376 | 3300031251 | Bacteria | 1959 |
| 184 | Ga0265327_10074641 | 3300031251 | Bacteria | 1689 |
| 185 | Ga0265316_10557917 | 3300031344 | Bacteria | 815 |
| 186 | Ga0307408_100013046 | 3300031548 | Bacteria | 5512 |
| 187 | Ga0307408_100484555 | 3300031548 | Bacteria | 1079 |
| 188 | Ga0307408_100614704 | 3300031548 | Bacteria | 967 |
| 189 | Ga0265314_10065968 | 3300031711 | Bacteria | 2443 |
| 190 | Ga0265342_10256852 | 3300031712 | Bacteria | 931 |
| 191 | Ga0265342_10444788 | 3300031712 | Bacteria | 666 |
| 192 | Ga0316576_10763277 | 3300031727 | Bacteria | 698 |
| 193 | Ga0316576_11350953 | 3300031727 | Bacteria | 501 |
| 194 | Ga0307405_10051278 | 3300031731 | Bacteria | 2559 |
| 195 | Ga0307405_10462418 | 3300031731 | Bacteria | 1009 |
| 196 | Ga0307413_10081458 | 3300031824 | Bacteria | 2075 |
| 197 | Ga0307413_10393442 | 3300031824 | Bacteria | 1084 |
| 198 | Ga0307413_10543971 | 3300031824 | Bacteria | 941 |
| 199 | Ga0307410_10003030 | 3300031852 | Bacteria | 8302 |
| 200 | Ga0307410_10159428 | 3300031852 | Bacteria | 1689 |
| 201 | Ga0307406_10143289 | 3300031901 | Bacteria | 1695 |
| 202 | Ga0307406_10427406 | 3300031901 | Bacteria | 1057 |
| 203 | Ga0307407_10781539 | 3300031903 | Bacteria | 725 |
| 204 | Ga0307412_10006208 | 3300031911 | Bacteria | 6740 |
| 205 | Ga0307412_10031955 | 3300031911 | Bacteria | 3329 |
| 206 | Ga0307412_10310506 | 3300031911 | Bacteria | 1250 |
| 207 | Ga0307412_11079551 | 3300031911 | Bacteria | 713 |
| 208 | Ga0307412_11462645 | 3300031911 | Bacteria | 620 |
| 209 | Ga0307409_100004529 | 3300031995 | Bacteria | 7828 |
| 210 | Ga0307416_100137679 | 3300032002 | Bacteria | 2212 |
| 211 | Ga0307416_100213871 | 3300032002 | Bacteria | 1842 |
| 212 | Ga0307414_10000927 | 3300032004 | Bacteria | 15015 |
| 213 | Ga0307414_10011719 | 3300032004 | Bacteria | 5154 |
| 214 | Ga0307414_10014563 | 3300032004 | Bacteria | 4720 |
| 215 | Ga0307414_10028964 | 3300032004 | Bacteria | 3599 |
| 216 | Ga0307414_10168902 | 3300032004 | Bacteria | 1746 |
| 217 | Ga0307414_10591101 | 3300032004 | Bacteria | 994 |
| 218 | Ga0307414_11504083 | 3300032004 | Bacteria | 627 |
| 219 | Ga0307414_11741533 | 3300032004 | Bacteria | 581 |
| 220 | Ga0307411_10008827 | 3300032005 | Bacteria | 5250 |
| 221 | Ga0307411_10047021 | 3300032005 | Bacteria | 2787 |
| 222 | Ga0307411_11187883 | 3300032005 | Bacteria | 691 |
| 223 | Ga0307415_100353293 | 3300032126 | Bacteria | 1238 |
| 224 | Ga0316593_10050622 | 3300032168 | Bacteria | 1402 |
| 225 | Ga0316593_10162840 | 3300032168 | Unclassified | 815 |
| 226 | Ga0316592_1000011 | 3300033524 | Bacteria | 13521 |
| 227 | Ga0316596_1006644 | 3300033541 | Bacteria | 2700 |
| 228 | Ga0316596_1007465 | 3300033541 | Bacteria | 2583 |
| 229 | Ga0373946_0218365 | 3300035171 | Bacteria | 920 |
| 230 | Ga0316574_0138171 | 3300035398 | Bacteria | 1569 |
| 231 | Ga0373927_0000001 | 3300035695 | Bacteria | 1082160 |
| 232 | Ga0373937_1126740 | 3300036401 | Bacteria | 733 |
| 233 | Ga0316582_0338819 | 3300036647 | Bacteria | 1034 |
| 234 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 235 | Ga0395899_0105310 | 3300037312 | Bacteria | 2032 |
| 236 | Ga0395900_0201560 | 3300037418 | Bacteria | 2013 |
| 237 | Ga0395900_1133326 | 3300037418 | Bacteria | 699 |
| 238 | Ga0395898_0257000 | 3300037466 | Bacteria | 1666 |
| 239 | Ga0395898_0290360 | 3300037466 | Bacteria | 1560 |
| 240 | Ga0395901_0018865 | 3300038443 | Bacteria | 7051 |
| 241 | Ga0436362_0192697 | 3300039453 | Unclassified | 2593 |
| 242 | Ga0439436_0053857 | 3300041404 | Bacteria | 1133 |
| 243 | Ga0439465_0419119 | 3300041413 | Bacteria | 511 |
| 244 | Ga0451789_0610099 | 3300041443 | Bacteria | 701 |
| 245 | Ga0451790_21411 | 3300041444 | Bacteria | 734 |
| 246 | Ga0451804_0336010 | 3300041463 | Bacteria | 547 |
| 247 | Ga0451807_1039411 | 3300041486 | Bacteria | 559 |
| 248 | Ga0451837_0432158 | 3300041494 | Bacteria | 1837 |
| 249 | Ga0451853_2989796 | 3300041512 | Bacteria | 528 |
| 250 | Ga0452268_28166 | 3300041907 | Bacteria | 651 |
| 251 | Ga0439449_0083278 | 3300042007 | Bacteria | 1180 |
| 252 | Ga0439457_004245 | 3300042014 | Bacteria | 3773 |
| 253 | Ga0439462_0128235 | 3300042015 | Bacteria | 707 |
| 254 | Ga0450890_012599 | 3300042127 | Bacteria | 1099 |
| 255 | Ga0439435_0077741 | 3300042436 | Bacteria | 992 |
| 256 | Ga0450893_0145855 | 3300042532 | Bacteria | 508 |
| 257 | Ga0451577_0000210 | 3300042876 | Bacteria | 122637 |
| 258 | Ga0451577_0004463 | 3300042876 | Bacteria | 14775 |
| 259 | Ga0451577_0030002 | 3300042876 | Bacteria | 4913 |
| 260 | Ga0466972_0022564 | 3300044658 | Bacteria | 3133 |
| 261 | Ga0466961_0135164 | 3300044693 | Bacteria | 1545 |
| 262 | Ga0453684_0000413 | 3300044712 | Bacteria | 174924 |
| 263 | Ga0453684_0002807 | 3300044712 | Bacteria | 41156 |
| 264 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 265 | Ga0453684_0027807 | 3300044712 | Bacteria | 8094 |
| 266 | Ga0453684_0198942 | 3300044712 | Bacteria | 2337 |
| 267 | Ga0453684_0784483 | 3300044712 | Bacteria | 1029 |
| 268 | Ga0466968_0047351 | 3300044735 | Bacteria | 1828 |
| 269 | Ga0466968_0269237 | 3300044735 | Bacteria | 813 |
| 270 | Ga0466970_0009840 | 3300044765 | Bacteria | 4842 |
| 271 | Ga0466959_0279231 | 3300045049 | Bacteria | 1147 |
| 272 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 273 | Ga0451576_0030427 | 3300045051 | Bacteria | 5770 |
| 274 | Ga0451576_1792466 | 3300045051 | Unclassified | 635 |
| 275 | Ga0495583_0204454 | 3300046506 | Bacteria | 801 |
| 276 | Ga0495663_0139917 | 3300046525 | Bacteria | 821 |
| 277 | Ga0495667_0371360 | 3300046559 | Bacteria | 903 |
| 278 | Ga0495625_0068664 | 3300046660 | Bacteria | 2491 |
| 279 | Ga0495670_0070410 | 3300046691 | Bacteria | 1770 |
| 280 | Ga0495604_0269520 | 3300047317 | Bacteria | 1154 |
| 281 | Ga0495636_0238073 | 3300047318 | Bacteria | 839 |
| 282 | Ga0495672_0284895 | 3300047320 | Bacteria | 788 |
| 283 | Ga0495684_0153472 | 3300047471 | Bacteria | 1721 |
| 284 | Ga0495686_0034775 | 3300047472 | Bacteria | 3242 |
| 285 | Ga0496102_0590881 | 3300048905 | Bacteria | 1033 |
| 286 | Ga0496103_0058547 | 3300048906 | Bacteria | 2394 |
| 287 | Ga0496115_1009044 | 3300048918 | Bacteria | 636 |
| 288 | Ga0496116_0091803 | 3300048919 | Bacteria | 1844 |
| 289 | Ga0496117_0088035 | 3300048920 | Bacteria | 2010 |
| 290 | Ga0496121_0086162 | 3300048924 | Bacteria | 2469 |
| 291 | Ga0496126_0035497 | 3300048929 | Bacteria | 4673 |
| 292 | Ga0496126_0102727 | 3300048929 | Bacteria | 2499 |
| 293 | Ga0501306_017228 | 3300049127 | Bacteria | 978 |
| 294 | Ga0501306_025702 | 3300049127 | Bacteria | 849 |
| 295 | Ga0501308_004229 | 3300049128 | Bacteria | 1375 |
| 296 | Ga0501308_020268 | 3300049128 | Bacteria | 827 |
| 297 | Ga0501308_020720 | 3300049128 | Bacteria | 821 |
| 298 | Ga0501309_064569 | 3300049129 | Bacteria | 594 |
| 299 | Ga0501310_021854 | 3300049130 | Bacteria | 803 |
| 300 | Ga0501310_072467 | 3300049130 | Bacteria | 530 |
| 301 | Ga0501310_081363 | 3300049130 | Bacteria | 509 |
| 302 | Ga0501343_005351 | 3300049132 | Bacteria | 982 |
| 303 | Ga0501343_021492 | 3300049132 | Bacteria | 571 |
| 304 | Ga0501305_005628 | 3300049161 | Bacteria | 1527 |
| 305 | Ga0501307_020560 | 3300049162 | Bacteria | 855 |
| 306 | Ga0501307_029054 | 3300049162 | Bacteria | 759 |
| 307 | Ga0501311_068078 | 3300049527 | Bacteria | 586 |
| 308 | Ga0501312_002580 | 3300049528 | Bacteria | 1968 |
| 309 | Ga0501312_043055 | 3300049528 | Bacteria | 743 |
| 310 | Ga0501312_087058 | 3300049528 | Bacteria | 572 |
| 311 | Ga0501312_098692 | 3300049528 | Bacteria | 546 |
| 312 | Ga0501313_027750 | 3300049529 | Bacteria | 724 |
| 313 | Ga0501314_000038 | 3300049530 | Bacteria | 5733 |
| 314 | Ga0501315_003355 | 3300049531 | Bacteria | 1595 |
| 315 | Ga0501315_017264 | 3300049531 | Bacteria | 942 |
| 316 | Ga0501315_020857 | 3300049531 | Bacteria | 883 |
| 317 | Ga0501315_077348 | 3300049531 | Bacteria | 560 |
| 318 | Ga0501315_084386 | 3300049531 | Bacteria | 543 |
| 319 | Ga0501317_004692 | 3300049533 | Bacteria | 1434 |
| 320 | Ga0501317_098162 | 3300049533 | Bacteria | 526 |
| 321 | Ga0501320_001839 | 3300049536 | Bacteria | 1618 |
| 322 | Ga0501320_003002 | 3300049536 | Bacteria | 1398 |
| 323 | Ga0501320_018033 | 3300049536 | Bacteria | 794 |
| 324 | Ga0501320_018336 | 3300049536 | Bacteria | 790 |
| 325 | Ga0501321_047434 | 3300049537 | Bacteria | 620 |
| 326 | Ga0501323_018933 | 3300049539 | Bacteria | 894 |
| 327 | Ga0501324_000812 | 3300049540 | Bacteria | 1882 |
| 328 | Ga0501325_031005 | 3300049541 | Bacteria | 612 |
| 329 | Ga0501326_04901 | 3300049542 | Bacteria | 719 |
| 330 | Ga0501327_03811 | 3300049543 | Bacteria | 843 |
| 331 | Ga0501329_02901 | 3300049545 | Bacteria | 848 |
| 332 | Ga0501330_008560 | 3300049546 | Bacteria | 703 |
| 333 | Ga0501331_11512 | 3300049547 | Bacteria | 559 |
| 334 | Ga0501334_07180 | 3300049550 | Bacteria | 764 |
| 335 | Ga0501335_005181 | 3300049551 | Bacteria | 1159 |
| 336 | Ga0501335_015036 | 3300049551 | Bacteria | 786 |
| 337 | Ga0501335_048704 | 3300049551 | Bacteria | 513 |
| 338 | Ga0501337_008454 | 3300049553 | Bacteria | 731 |
| 339 | Ga0501337_019466 | 3300049553 | Bacteria | 546 |
| 340 | Ga0501338_06283 | 3300049554 | Bacteria | 749 |
| 341 | Ga0501340_000481 | 3300049556 | Bacteria | 1772 |
| 342 | Ga0501340_019144 | 3300049556 | Bacteria | 564 |
| 343 | Ga0501033_0729587 | 3300049570 | Bacteria | 673 |
| 344 | Ga0501034_0105341 | 3300049571 | Bacteria | 2813 |
| 345 | Ga0501037_0105203 | 3300049573 | Bacteria | 2034 |
| 346 | Ga0501037_0156384 | 3300049573 | Bacteria | 1627 |
| 347 | Ga0501038_0388677 | 3300049574 | Unclassified | 1081 |
| 348 | Ga0501039_0276971 | 3300049575 | Bacteria | 1319 |
| 349 | Ga0501040_0408170 | 3300049576 | Bacteria | 976 |
| 350 | Ga0501042_0165306 | 3300049578 | Bacteria | 1597 |
| 351 | Ga0501047_0005869 | 3300049581 | Bacteria | 11555 |
| 352 | Ga0501047_0074504 | 3300049581 | Bacteria | 3268 |
| 353 | Ga0501047_0303224 | 3300049581 | Bacteria | 1439 |
| 354 | Ga0501048_0975460 | 3300049582 | Bacteria | 610 |
| 355 | Ga0501072_0793055 | 3300049588 | Bacteria | 742 |
| 356 | Ga0501074_0139117 | 3300049590 | Bacteria | 1737 |
| 357 | Ga0501075_0172789 | 3300049591 | Bacteria | 1649 |
| 358 | Ga0501075_0787114 | 3300049591 | Bacteria | 724 |
| 359 | Ga0501075_0849564 | 3300049591 | Bacteria | 694 |
| 360 | Ga0501076_0193157 | 3300049592 | Bacteria | 1662 |
| 361 | Ga0501076_0429359 | 3300049592 | Bacteria | 1087 |
| 362 | Ga0501207_078071 | 3300049654 | Bacteria | 633 |
| 363 | Ga0501217_010354 | 3300049661 | Bacteria | 2041 |
| 364 | Ga0501223_067476 | 3300049663 | Bacteria | 704 |
| 365 | Ga0501245_148433 | 3300049708 | Bacteria | 516 |
| 366 | Ga0501080_0187759 | 3300049742 | Bacteria | 1900 |
| 367 | Ga0501081_0269524 | 3300049743 | Bacteria | 1245 |
| 368 | Ga0501083_0956854 | 3300049744 | Bacteria | 557 |
| 369 | Ga0501266_051713 | 3300049763 | Bacteria | 637 |
| 370 | Ga0501269_026196 | 3300049766 | Bacteria | 736 |
| 371 | Ga0501035_0048381 | 3300049822 | Bacteria | 3814 |
| 372 | Ga0501035_0212145 | 3300049822 | Bacteria | 1656 |
| 373 | Ga0501044_0008030 | 3300049823 | Bacteria | 11594 |
| 374 | Ga0501044_0037946 | 3300049823 | Bacteria | 5034 |
| 375 | nmdc:mga0k408_4220_c1 | 3300050493 | Bacteria | 7623 |
| 376 | nmdc:mga0k408_434950_c1 | 3300050493 | Bacteria | 780 |
| 377 | nmdc:mga06z11_888712_c1 | 3300050494 | Unclassified | 543 |
| 378 | nmdc:mga07m45_44230_c1 | 3300050496 | Bacteria | 874 |
| 379 | nmdc:mga07m45_671679_c1 | 3300050496 | Bacteria | 597 |
| 380 | nmdc:mga05p37_80072_c1 | 3300050507 | Bacteria | 4023 |
| 381 | nmdc:mga09592_197231_c1 | 3300050508 | Bacteria | 1743 |
| 382 | nmdc:mga09592_439617_c1 | 3300050508 | Bacteria | 1126 |
| 383 | nmdc:mga0qj67_712714_c1 | 3300050509 | Unclassified | 798 |
| 384 | nmdc:mga0qj67_873297_c1 | 3300050509 | Bacteria | 710 |
| 385 | nmdc:mga06r32_903963_c1 | 3300050510 | Bacteria | 839 |
| 386 | nmdc:mga06r32_954572_c1 | 3300050510 | Bacteria | 812 |
| 387 | nmdc:mga0n895_419548_c1 | 3300050512 | Bacteria | 1353 |
| 388 | nmdc:mga0rr50_141842_c1 | 3300050513 | Bacteria | 1934 |
| 389 | nmdc:mga0a205_464881_c1 | 3300050515 | Bacteria | 1124 |
| 390 | nmdc:mga0a205_608441_c1 | 3300050515 | Bacteria | 946 |
| 391 | nmdc:mga0a205_674830_c1 | 3300050515 | Bacteria | 884 |
| 392 | Ga0500635_0004581 | 3300053080 | Bacteria | 3570 |
| 393 | Ga0500566_0303741 | 3300053094 | Bacteria | 750 |
| 394 | Ga0500554_114417 | 3300053102 | Bacteria | 908 |
| 395 | Ga0500595_014280 | 3300053119 | Bacteria | 3018 |
| 396 | Ga0500559_0103194 | 3300053136 | Bacteria | 1316 |
| 397 | Ga0500564_131549 | 3300053138 | Bacteria | 1082 |
| 398 | Ga0500616_0235892 | 3300053153 | Bacteria | 789 |
| 399 | Ga0500619_087325 | 3300053154 | Bacteria | 1052 |
| 400 | Ga0500622_0000385 | 3300053156 | Bacteria | 42685 |
| 401 | Ga0500627_0310574 | 3300053158 | Bacteria | 687 |
| 402 | Ga0500645_019570 | 3300053730 | Bacteria | 2105 |
| 403 | Ga0500645_077780 | 3300053730 | Bacteria | 948 |
| 404 | Ga0501084_1875507 | 3300054114 | Bacteria | 500 |
| 405 | Ga0500661_027542 | 3300055283 | Bacteria | 1004 |
| 406 | Ga0587084_017616 | 3300059477 | Bacteria | 1033 |
| 407 | Ga0587084_095626 | 3300059477 | Bacteria | 595 |
| 408 | Ga0587070_030135 | 3300059491 | Bacteria | 978 |
| 409 | Ga0587077_003683 | 3300059493 | Bacteria | 1950 |
| 410 | Ga0587077_007978 | 3300059493 | Bacteria | 1561 |
| 411 | Ga0587077_038531 | 3300059493 | Bacteria | 948 |
| 412 | Ga0587077_083713 | 3300059493 | Bacteria | 737 |
| 413 | Ga0587077_091444 | 3300059493 | Bacteria | 716 |
| 414 | Ga0587082_021755 | 3300059504 | Bacteria | 1050 |
| 415 | Ga0587085_019714 | 3300059506 | Bacteria | 1013 |
| 416 | Ga0587085_115200 | 3300059506 | Bacteria | 584 |
| 417 | Ga0587086_003002 | 3300059507 | Bacteria | 1660 |
| 418 | Ga0587090_002489 | 3300059510 | Bacteria | 2038 |
| 419 | Ga0587090_008083 | 3300059510 | Bacteria | 1401 |
| 420 | Ga0587090_019444 | 3300059510 | Bacteria | 1048 |
| 421 | Ga0587090_164008 | 3300059510 | Bacteria | 511 |
| 422 | Ga0587091_015081 | 3300059511 | Bacteria | 1270 |
| 423 | Ga0587091_018706 | 3300059511 | Bacteria | 1182 |
| 424 | Ga0587091_058986 | 3300059511 | Bacteria | 810 |
| 425 | Ga0587091_087856 | 3300059511 | Bacteria | 709 |
| 426 | Ga0587092_004898 | 3300059512 | Bacteria | 1622 |
| 427 | Ga0587092_040529 | 3300059512 | Bacteria | 809 |
| 428 | Ga0587125_023139 | 3300059607 | Bacteria | 748 |
| 429 | Ga0587101_012643 | 3300059623 | Bacteria | 1100 |
| 430 | Ga0587101_053390 | 3300059623 | Bacteria | 702 |
| 431 | Ga0587109_003270 | 3300059624 | Bacteria | 2146 |
| 432 | Ga0587109_004974 | 3300059624 | Bacteria | 1879 |
| 433 | Ga0587117_000700 | 3300059627 | Bacteria | 2456 |
| 434 | Ga0587117_020062 | 3300059627 | Bacteria | 924 |
| 435 | Ga0587128_042644 | 3300059630 | Bacteria | 800 |
| 436 | Ga0587128_086715 | 3300059630 | Bacteria | 636 |
| 437 | Ga0587128_153326 | 3300059630 | Bacteria | 526 |
| 438 | Ga0587062_000275 | 3300059639 | Bacteria | 3263 |
| 439 | Ga0587062_004253 | 3300059639 | Bacteria | 1509 |
| 440 | Ga0587062_014690 | 3300059639 | Bacteria | 1037 |
| 441 | Ga0587062_043843 | 3300059639 | Bacteria | 735 |
| 442 | Ga0587062_136919 | 3300059639 | Bacteria | 508 |
| 443 | Ga0587068_000623 | 3300059641 | Bacteria | 3402 |
| 444 | Ga0587068_011433 | 3300059641 | Bacteria | 1340 |
| 445 | Ga0587068_016722 | 3300059641 | Bacteria | 1166 |
| 446 | Ga0587068_023231 | 3300059641 | Bacteria | 1031 |
| 447 | Ga0587076_008986 | 3300059645 | Bacteria | 1409 |
| 448 | Ga0587076_054617 | 3300059645 | Bacteria | 789 |
| 449 | Ga0587100_045287 | 3300059648 | Bacteria | 506 |
| 450 | Ga0587107_015937 | 3300059652 | Bacteria | 987 |
| 451 | Ga0587107_105427 | 3300059652 | Bacteria | 563 |
| 452 | Ga0587108_004347 | 3300059653 | Bacteria | 1034 |
| 453 | Ga0587108_004541 | 3300059653 | Bacteria | 1020 |
| 454 | Ga0587124_005157 | 3300059660 | Bacteria | 1034 |
| 455 | Ga0587124_010738 | 3300059660 | Bacteria | 821 |
| 456 | Ga0587061_08754 | 3300060244 | Bacteria | 521 |
| 457 | Ga0587081_03105 | 3300060246 | Bacteria | 1034 |
| 458 | Ga0587111_0005171 | 3300060346 | Bacteria | 1991 |
| 459 | Ga0587111_0005360 | 3300060346 | Bacteria | 1972 |
| 460 | Ga0587111_0010170 | 3300060346 | Bacteria | 1608 |
| 461 | Ga0501082_0240326 | 3300060353 | Bacteria | 1576 |
| 462 | Ga0501082_0265415 | 3300060353 | Bacteria | 1494 |
| 463 | Ga0501082_0534043 | 3300060353 | Bacteria | 1026 |
| 464 | Ga0501082_1539284 | 3300060353 | Bacteria | 581 |
| 465 | Ga0530510_0924741 | 3300061734 | Bacteria | 667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0138171 | Ga0316574_0138171_227_490 | 84 |
| 2 | 3300036647 | Ga0316582_0338819 | Ga0316582_0338819_122_385 | 84 |
| 3 | iso_pu_bacteria | 2522125168 | 2522549416 | 84 |
| 4 | iso_pu_bacteria | 2894510363 | 2894510849 | 84 |
| 5 | iso_pu_bacteria | 2919692658 | 2919697456 | 84 |
| 6 | 3300006175 | Ga0070712_100565079 | Ga0070712_1005650792 | 87 |
| 7 | 3300009093 | Ga0105240_10048322 | Ga0105240_100483226 | 87 |
| 8 | 3300025913 | Ga0207695_10359162 | Ga0207695_103591622 | 87 |
| 9 | 3300025915 | Ga0207693_10769761 | Ga0207693_107697612 | 87 |
| 10 | 3300026035 | Ga0207703_11591459 | Ga0207703_115914592 | 87 |
| 11 | 3300031911 | Ga0307412_11462645 | Ga0307412_114626451 | 87 |
| 12 | 3300032005 | Ga0307411_11187883 | Ga0307411_111878832 | 87 |
| 13 | 3300035171 | Ga0373946_0218365 | Ga0373946_0218365_307_594 | 87 |
| 14 | 3300035695 | Ga0373927_0000001 | Ga0373927_0000001_680724_681011 | 87 |
| 15 | 3300037466 | Ga0395898_0290360 | Ga0395898_0290360_1005_1268 | 87 |
| 16 | 3300039453 | Ga0436362_0192697 | Ga0436362_0192697_968_1237 | 87 |
| 17 | 3300046559 | Ga0495667_0371360 | Ga0495667_0371360_295_582 | 87 |
| 18 | 3300047317 | Ga0495604_0269520 | Ga0495604_0269520_208_495 | 87 |
| 19 | 3300048919 | Ga0496116_0091803 | Ga0496116_0091803_1075_1338 | 87 |
| 20 | 3300048920 | Ga0496117_0088035 | Ga0496117_0088035_494_757 | 87 |
| 21 | 3300048924 | Ga0496121_0086162 | Ga0496121_0086162_1112_1375 | 87 |
| 22 | 3300048929 | Ga0496126_0035497 | Ga0496126_0035497_1752_2015 | 87 |
| 23 | 3300049162 | Ga0501307_029054 | Ga0501307_029054_454_726 | 87 |
| 24 | 3300049571 | Ga0501034_0105341 | Ga0501034_0105341_1472_1735 | 87 |
| 25 | 3300049573 | Ga0501037_0105203 | Ga0501037_0105203_945_1211 | 87 |
| 26 | 3300049573 | Ga0501037_0156384 | Ga0501037_0156384_1079_1351 | 87 |
| 27 | 3300049574 | Ga0501038_0388677 | Ga0501038_0388677_787_1053 | 87 |
| 28 | 3300049575 | Ga0501039_0276971 | Ga0501039_0276971_737_1003 | 87 |
| 29 | 3300049822 | Ga0501035_0212145 | Ga0501035_0212145_1175_1447 | 87 |
| 30 | 3300049823 | Ga0501044_0037946 | Ga0501044_0037946_1056_1322 | 87 |
| 31 | 3300053153 | Ga0500616_0235892 | Ga0500616_0235892_514_777 | 87 |
| 32 | 3300059512 | Ga0587092_040529 | Ga0587092_040529_232_495 | 87 |
| 33 | 3300059627 | Ga0587117_020062 | Ga0587117_020062_449_712 | 87 |
| 34 | 3300059639 | Ga0587062_043843 | Ga0587062_043843_87_350 | 87 |
| 35 | 3300001904 | JGI24736J21556_1037201 | JGI24736J21556_10372011 | 88 |
| 36 | 3300001989 | JGI24739J22299_10248889 | JGI24739J22299_102488892 | 88 |
| 37 | 3300001990 | JGI24737J22298_10001191 | JGI24737J22298_100011913 | 88 |
| 38 | 3300002067 | JGI24735J21928_10001634 | JGI24735J21928_100016344 | 88 |
| 39 | 3300002741 | JGI25157J39369_1012503 | JGI25157J39369_10125032 | 88 |
| 40 | 3300002741 | JGI25157J39369_1036779 | JGI25157J39369_10367791 | 88 |
| 41 | 3300003214 | JGI25165J46597_1030395 | JGI25165J46597_10303952 | 88 |
| 42 | 3300003322 | rootL2_10134610 | rootL2_101346105 | 88 |
| 43 | 3300003323 | rootH1_10116742 | rootH1_101167422 | 88 |
| 44 | 3300003781 | Ga0055536_1006040 | Ga0055536_10060406 | 88 |
| 45 | 3300004625 | Ga0055543_1023698 | Ga0055543_10236982 | 88 |
| 46 | 3300004799 | Ga0058863_11894467 | Ga0058863_118944672 | 88 |
| 47 | 3300004801 | Ga0058860_11979646 | Ga0058860_119796462 | 88 |
| 48 | 3300004803 | Ga0058862_11525955 | Ga0058862_115259552 | 88 |
| 49 | 3300004803 | Ga0058862_12680365 | Ga0058862_126803651 | 88 |
| 50 | 3300004803 | Ga0058862_12740678 | Ga0058862_127406782 | 88 |
| 51 | 3300005262 | Ga0065165_1000131 | Ga0065165_100013144 | 88 |
| 52 | 3300005289 | Ga0065704_10014908 | Ga0065704_100149082 | 88 |
| 53 | 3300005289 | Ga0065704_10422899 | Ga0065704_104228992 | 88 |
| 54 | 3300005289 | Ga0065704_10426557 | Ga0065704_104265572 | 88 |
| 55 | 3300005295 | Ga0065707_10068828 | Ga0065707_100688281 | 88 |
| 56 | 3300005295 | Ga0065707_10484260 | Ga0065707_104842602 | 88 |
| 57 | 3300005327 | Ga0070658_10000153 | Ga0070658_1000015334 | 88 |
| 58 | 3300005328 | Ga0070676_10520477 | Ga0070676_105204772 | 88 |
| 59 | 3300005339 | Ga0070660_100007068 | Ga0070660_1000070683 | 88 |
| 60 | 3300005347 | Ga0070668_101518162 | Ga0070668_1015181622 | 88 |
| 61 | 3300005347 | Ga0070668_102172490 | Ga0070668_1021724902 | 88 |
| 62 | 3300005354 | Ga0070675_101428503 | Ga0070675_1014285031 | 88 |
| 63 | 3300005355 | Ga0070671_100794976 | Ga0070671_1007949762 | 88 |
| 64 | 3300005365 | Ga0070688_100302945 | Ga0070688_1003029452 | 88 |
| 65 | 3300005366 | Ga0070659_100008718 | Ga0070659_1000087185 | 88 |
| 66 | 3300005367 | Ga0070667_101665396 | Ga0070667_1016653961 | 88 |
| 67 | 3300005459 | Ga0068867_101388288 | Ga0068867_1013882882 | 88 |
| 68 | 3300005467 | Ga0070706_100497050 | Ga0070706_1004970501 | 88 |
| 69 | 3300005530 | Ga0070679_100510731 | Ga0070679_1005107312 | 88 |
| 70 | 3300005539 | Ga0068853_100081417 | Ga0068853_1000814175 | 88 |
| 71 | 3300005544 | Ga0070686_101728309 | Ga0070686_1017283092 | 88 |
| 72 | 3300005545 | Ga0070695_100226104 | Ga0070695_1002261043 | 88 |
| 73 | 3300005546 | Ga0070696_100162632 | Ga0070696_1001626321 | 88 |
| 74 | 3300005549 | Ga0070704_100433128 | Ga0070704_1004331282 | 88 |
| 75 | 3300005563 | Ga0068855_100044845 | Ga0068855_1000448453 | 88 |
| 76 | 3300005563 | Ga0068855_100824591 | Ga0068855_1008245913 | 88 |
| 77 | 3300005577 | Ga0068857_100038490 | Ga0068857_10003849010 | 88 |
| 78 | 3300005577 | Ga0068857_101087483 | Ga0068857_1010874832 | 88 |
| 79 | 3300005578 | Ga0068854_100068418 | Ga0068854_1000684182 | 88 |
| 80 | 3300005578 | Ga0068854_101837642 | Ga0068854_1018376422 | 88 |
| 81 | 3300005616 | Ga0068852_101353931 | Ga0068852_1013539312 | 88 |
| 82 | 3300005617 | Ga0068859_100352672 | Ga0068859_1003526723 | 88 |
| 83 | 3300005719 | Ga0068861_100585687 | Ga0068861_1005856873 | 88 |
| 84 | 3300005840 | Ga0068870_10479651 | Ga0068870_104796513 | 88 |
| 85 | 3300005842 | Ga0068858_100779401 | Ga0068858_1007794012 | 88 |
| 86 | 3300005842 | Ga0068858_101707600 | Ga0068858_1017076001 | 88 |
| 87 | 3300005843 | Ga0068860_100326634 | Ga0068860_1003266343 | 88 |
| 88 | 3300006173 | Ga0070716_100178428 | Ga0070716_1001784282 | 88 |
| 89 | 3300006177 | Ga0075362_10412817 | Ga0075362_104128171 | 88 |
| 90 | 3300006195 | Ga0075366_10000288 | Ga0075366_1000028835 | 88 |
| 91 | 3300006195 | Ga0075366_10077240 | Ga0075366_100772403 | 88 |
| 92 | 3300006195 | Ga0075366_10106699 | Ga0075366_101066992 | 88 |
| 93 | 3300006353 | Ga0075370_10063124 | Ga0075370_100631242 | 88 |
| 94 | 3300006353 | Ga0075370_10450086 | Ga0075370_104500862 | 88 |
| 95 | 3300006353 | Ga0075370_10471947 | Ga0075370_104719472 | 88 |
| 96 | 3300006844 | Ga0075428_100003062 | Ga0075428_10000306224 | 88 |
| 97 | 3300006844 | Ga0075428_100272873 | Ga0075428_1002728732 | 88 |
| 98 | 3300006844 | Ga0075428_100335530 | Ga0075428_1003355302 | 88 |
| 99 | 3300006846 | Ga0075430_100455491 | Ga0075430_1004554912 | 88 |
| 100 | 3300006846 | Ga0075430_100666777 | Ga0075430_1006667772 | 88 |
| 101 | 3300006847 | Ga0075431_100256533 | Ga0075431_1002565333 | 88 |
| 102 | 3300006847 | Ga0075431_100904296 | Ga0075431_1009042962 | 88 |
| 103 | 3300006847 | Ga0075431_101697136 | Ga0075431_1016971362 | 88 |
| 104 | 3300006852 | Ga0075433_11344379 | Ga0075433_113443792 | 88 |
| 105 | 3300006880 | Ga0075429_100317476 | Ga0075429_1003174762 | 88 |
| 106 | 3300006880 | Ga0075429_100392049 | Ga0075429_1003920492 | 88 |
| 107 | 3300006881 | Ga0068865_101650585 | Ga0068865_1016505852 | 88 |
| 108 | 3300006931 | Ga0097620_100352668 | Ga0097620_1003526683 | 88 |
| 109 | 3300007265 | Ga0099794_10469421 | Ga0099794_104694211 | 88 |
| 110 | 3300009093 | Ga0105240_10041987 | Ga0105240_1004198710 | 88 |
| 111 | 3300009093 | Ga0105240_10404513 | Ga0105240_104045131 | 88 |
| 112 | 3300009093 | Ga0105240_10661368 | Ga0105240_106613682 | 88 |
| 113 | 3300009101 | Ga0105247_10743125 | Ga0105247_107431252 | 88 |
| 114 | 3300009147 | Ga0114129_10134996 | Ga0114129_101349965 | 88 |
| 115 | 3300009147 | Ga0114129_10421592 | Ga0114129_104215923 | 88 |
| 116 | 3300009174 | Ga0105241_10009907 | Ga0105241_1000990713 | 88 |
| 117 | 3300009174 | Ga0105241_10703499 | Ga0105241_107034991 | 88 |
| 118 | 3300009177 | Ga0105248_12476230 | Ga0105248_124762302 | 88 |
| 119 | 3300009545 | Ga0105237_10035876 | Ga0105237_100358763 | 88 |
| 120 | 3300009545 | Ga0105237_11818087 | Ga0105237_118180872 | 88 |
| 121 | 3300009551 | Ga0105238_10248125 | Ga0105238_102481253 | 88 |
| 122 | 3300009551 | Ga0105238_12366008 | Ga0105238_123660081 | 88 |
| 123 | 3300009553 | Ga0105249_12380731 | Ga0105249_123807312 | 88 |
| 124 | 3300010375 | Ga0105239_10000011 | Ga0105239_10000011133 | 88 |
| 125 | 3300010375 | Ga0105239_10122693 | Ga0105239_101226932 | 88 |
| 126 | 3300010375 | Ga0105239_11570583 | Ga0105239_115705832 | 88 |
| 127 | 3300010375 | Ga0105239_11640035 | Ga0105239_116400352 | 88 |
| 128 | 3300012513 | Ga0157326_1016658 | Ga0157326_10166582 | 88 |
| 129 | 3300013102 | Ga0157371_10001664 | Ga0157371_1000166431 | 88 |
| 130 | 3300013102 | Ga0157371_11424422 | Ga0157371_114244222 | 88 |
| 131 | 3300013102 | Ga0157371_11587625 | Ga0157371_115876252 | 88 |
| 132 | 3300013104 | Ga0157370_10047165 | Ga0157370_100471656 | 88 |
| 133 | 3300013104 | Ga0157370_11599843 | Ga0157370_115998431 | 88 |
| 134 | 3300013105 | Ga0157369_10007412 | Ga0157369_1000741210 | 88 |
| 135 | 3300013296 | Ga0157374_10173144 | Ga0157374_101731441 | 88 |
| 136 | 3300013296 | Ga0157374_10609812 | Ga0157374_106098122 | 88 |
| 137 | 3300013297 | Ga0157378_10058863 | Ga0157378_100588633 | 88 |
| 138 | 3300013306 | Ga0163162_10379084 | Ga0163162_103790843 | 88 |
| 139 | 3300013307 | Ga0157372_10064662 | Ga0157372_100646625 | 88 |
| 140 | 3300013307 | Ga0157372_10269915 | Ga0157372_102699153 | 88 |
| 141 | 3300013308 | Ga0157375_13077954 | Ga0157375_130779541 | 88 |
| 142 | 3300020070 | Ga0206356_10239140 | Ga0206356_102391402 | 88 |
| 143 | 3300020070 | Ga0206356_11003395 | Ga0206356_110033953 | 88 |
| 144 | 3300020075 | Ga0206349_1204727 | Ga0206349_12047272 | 88 |
| 145 | 3300020076 | Ga0206355_1259448 | Ga0206355_12594482 | 88 |
| 146 | 3300020077 | Ga0206351_10512829 | Ga0206351_1051282924 | 88 |
| 147 | 3300020078 | Ga0206352_10935446 | Ga0206352_109354462 | 88 |
| 148 | 3300020080 | Ga0206350_10752456 | Ga0206350_107524565 | 88 |
| 149 | 3300020080 | Ga0206350_11611523 | Ga0206350_116115232 | 88 |
| 150 | 3300020081 | Ga0206354_11306986 | Ga0206354_113069862 | 88 |
| 151 | 3300020082 | Ga0206353_10607448 | Ga0206353_106074482 | 88 |
| 152 | 3300020610 | Ga0154015_1037437 | Ga0154015_103743724 | 88 |
| 153 | 3300022467 | Ga0224712_10003182 | Ga0224712_100031823 | 88 |
| 154 | 3300022467 | Ga0224712_10003582 | Ga0224712_100035825 | 88 |
| 155 | 3300025250 | Ga0209026_1003238 | Ga0209026_100323811 | 88 |
| 156 | 3300025250 | Ga0209026_1004981 | Ga0209026_10049815 | 88 |
| 157 | 3300025254 | Ga0209148_1024264 | Ga0209148_10242642 | 88 |
| 158 | 3300025261 | Ga0209233_1001329 | Ga0209233_100132913 | 88 |
| 159 | 3300025261 | Ga0209233_1003581 | Ga0209233_100358112 | 88 |
| 160 | 3300025272 | Ga0209455_1013843 | Ga0209455_10138433 | 88 |
| 161 | 3300025292 | Ga0209676_1000332 | Ga0209676_100033238 | 88 |
| 162 | 3300025298 | Ga0209050_1038388 | Ga0209050_10383882 | 88 |
| 163 | 3300025904 | Ga0207647_10000171 | Ga0207647_1000017117 | 88 |
| 164 | 3300025909 | Ga0207705_10000108 | Ga0207705_1000010878 | 88 |
| 165 | 3300025910 | Ga0207684_10086390 | Ga0207684_100863905 | 88 |
| 166 | 3300025910 | Ga0207684_10402324 | Ga0207684_104023243 | 88 |
| 167 | 3300025911 | Ga0207654_10014217 | Ga0207654_100142179 | 88 |
| 168 | 3300025911 | Ga0207654_10319167 | Ga0207654_103191672 | 88 |
| 169 | 3300025911 | Ga0207654_10534306 | Ga0207654_105343063 | 88 |
| 170 | 3300025913 | Ga0207695_10000053 | Ga0207695_10000053360 | 88 |
| 171 | 3300025913 | Ga0207695_10081967 | Ga0207695_100819671 | 88 |
| 172 | 3300025913 | Ga0207695_10275711 | Ga0207695_102757112 | 88 |
| 173 | 3300025914 | Ga0207671_10201010 | Ga0207671_102010102 | 88 |
| 174 | 3300025914 | Ga0207671_10998199 | Ga0207671_109981992 | 88 |
| 175 | 3300025917 | Ga0207660_10617026 | Ga0207660_106170261 | 88 |
| 176 | 3300025919 | Ga0207657_10105386 | Ga0207657_101053864 | 88 |
| 177 | 3300025924 | Ga0207694_10154790 | Ga0207694_101547903 | 88 |
| 178 | 3300025932 | Ga0207690_10012751 | Ga0207690_100127517 | 88 |
| 179 | 3300025939 | Ga0207665_10510152 | Ga0207665_105101522 | 88 |
| 180 | 3300025939 | Ga0207665_10794563 | Ga0207665_107945632 | 88 |
| 181 | 3300025949 | Ga0207667_10095966 | Ga0207667_100959663 | 88 |
| 182 | 3300025949 | Ga0207667_10542459 | Ga0207667_105424592 | 88 |
| 183 | 3300025972 | Ga0207668_10649041 | Ga0207668_106490412 | 88 |
| 184 | 3300025981 | Ga0207640_10025047 | Ga0207640_100250473 | 88 |
| 185 | 3300026041 | Ga0207639_10039149 | Ga0207639_100391492 | 88 |
| 186 | 3300026041 | Ga0207639_11155537 | Ga0207639_111555372 | 88 |
| 187 | 3300026116 | Ga0207674_10016950 | Ga0207674_1001695017 | 88 |
| 188 | 3300026116 | Ga0207674_11354077 | Ga0207674_113540771 | 88 |
| 189 | 3300026116 | Ga0207674_11457746 | Ga0207674_114577462 | 88 |
| 190 | 3300026118 | Ga0207675_100337424 | Ga0207675_1003374242 | 88 |
| 191 | 3300026142 | Ga0207698_10884310 | Ga0207698_108843102 | 88 |
| 192 | 3300027543 | Ga0209999_1007217 | Ga0209999_10072172 | 88 |
| 193 | 3300028380 | Ga0268265_11817992 | Ga0268265_118179922 | 88 |
| 194 | 3300028381 | Ga0268264_10053452 | Ga0268264_100534523 | 88 |
| 195 | 3300028381 | Ga0268264_11226521 | Ga0268264_112265212 | 88 |
| 196 | 3300028558 | Ga0265326_10062435 | Ga0265326_100624352 | 88 |
| 197 | 3300028573 | Ga0265334_10000272 | Ga0265334_1000027236 | 88 |
| 198 | 3300028573 | Ga0265334_10002690 | Ga0265334_100026902 | 88 |
| 199 | 3300028577 | Ga0265318_10040734 | Ga0265318_100407344 | 88 |
| 200 | 3300028800 | Ga0265338_10000135 | Ga0265338_1000013543 | 88 |
| 201 | 3300028800 | Ga0265338_10283863 | Ga0265338_102838633 | 88 |
| 202 | 3300029957 | Ga0265324_10000247 | Ga0265324_1000024739 | 88 |
| 203 | 3300030731 | Ga0316177_1219406 | Ga0316177_12194062 | 88 |
| 204 | 3300030733 | Ga0314311_1002819 | Ga0314311_10028192 | 88 |
| 205 | 3300030734 | Ga0316179_1011335 | Ga0316179_10113351 | 88 |
| 206 | 3300030736 | Ga0316180_1144171 | Ga0316180_11441712 | 88 |
| 207 | 3300031239 | Ga0265328_10026643 | Ga0265328_100266433 | 88 |
| 208 | 3300031249 | Ga0265339_10275706 | Ga0265339_102757062 | 88 |
| 209 | 3300031250 | Ga0265331_10024674 | Ga0265331_100246746 | 88 |
| 210 | 3300031250 | Ga0265331_10233349 | Ga0265331_102333492 | 88 |
| 211 | 3300031251 | Ga0265327_10001935 | Ga0265327_100019357 | 88 |
| 212 | 3300031251 | Ga0265327_10059376 | Ga0265327_100593764 | 88 |
| 213 | 3300031251 | Ga0265327_10074641 | Ga0265327_100746412 | 88 |
| 214 | 3300031344 | Ga0265316_10557917 | Ga0265316_105579172 | 88 |
| 215 | 3300031548 | Ga0307408_100013046 | Ga0307408_1000130466 | 88 |
| 216 | 3300031548 | Ga0307408_100484555 | Ga0307408_1004845552 | 88 |
| 217 | 3300031548 | Ga0307408_100614704 | Ga0307408_1006147042 | 88 |
| 218 | 3300031711 | Ga0265314_10065968 | Ga0265314_100659682 | 88 |
| 219 | 3300031712 | Ga0265342_10256852 | Ga0265342_102568522 | 88 |
| 220 | 3300031712 | Ga0265342_10444788 | Ga0265342_104447881 | 88 |
| 221 | 3300031727 | Ga0316576_10763277 | Ga0316576_107632772 | 88 |
| 222 | 3300031727 | Ga0316576_11350953 | Ga0316576_113509531 | 88 |
| 223 | 3300031731 | Ga0307405_10051278 | Ga0307405_100512783 | 88 |
| 224 | 3300031731 | Ga0307405_10462418 | Ga0307405_104624182 | 88 |
| 225 | 3300031824 | Ga0307413_10081458 | Ga0307413_100814584 | 88 |
| 226 | 3300031824 | Ga0307413_10393442 | Ga0307413_103934422 | 88 |
| 227 | 3300031824 | Ga0307413_10543971 | Ga0307413_105439712 | 88 |
| 228 | 3300031852 | Ga0307410_10003030 | Ga0307410_100030303 | 88 |
| 229 | 3300031852 | Ga0307410_10159428 | Ga0307410_101594283 | 88 |
| 230 | 3300031901 | Ga0307406_10143289 | Ga0307406_101432893 | 88 |
| 231 | 3300031901 | Ga0307406_10427406 | Ga0307406_104274063 | 88 |
| 232 | 3300031903 | Ga0307407_10781539 | Ga0307407_107815392 | 88 |
| 233 | 3300031911 | Ga0307412_10006208 | Ga0307412_1000620814 | 88 |
| 234 | 3300031911 | Ga0307412_10031955 | Ga0307412_100319555 | 88 |
| 235 | 3300031911 | Ga0307412_10310506 | Ga0307412_103105062 | 88 |
| 236 | 3300031911 | Ga0307412_11079551 | Ga0307412_110795512 | 88 |
| 237 | 3300031995 | Ga0307409_100004529 | Ga0307409_10000452915 | 88 |
| 238 | 3300032002 | Ga0307416_100137679 | Ga0307416_1001376792 | 88 |
| 239 | 3300032002 | Ga0307416_100213871 | Ga0307416_1002138714 | 88 |
| 240 | 3300032004 | Ga0307414_10000927 | Ga0307414_100009273 | 88 |
| 241 | 3300032004 | Ga0307414_10011719 | Ga0307414_1001171912 | 88 |
| 242 | 3300032004 | Ga0307414_10014563 | Ga0307414_100145632 | 88 |
| 243 | 3300032004 | Ga0307414_10028964 | Ga0307414_100289649 | 88 |
| 244 | 3300032004 | Ga0307414_10168902 | Ga0307414_101689023 | 88 |
| 245 | 3300032004 | Ga0307414_10591101 | Ga0307414_105911012 | 88 |
| 246 | 3300032004 | Ga0307414_11504083 | Ga0307414_115040831 | 88 |
| 247 | 3300032004 | Ga0307414_11741533 | Ga0307414_117415332 | 88 |
| 248 | 3300032005 | Ga0307411_10008827 | Ga0307411_1000882711 | 88 |
| 249 | 3300032005 | Ga0307411_10047021 | Ga0307411_100470213 | 88 |
| 250 | 3300032126 | Ga0307415_100353293 | Ga0307415_1003532933 | 88 |
| 251 | 3300032168 | Ga0316593_10050622 | Ga0316593_100506221 | 88 |
| 252 | 3300032168 | Ga0316593_10162840 | Ga0316593_101628402 | 88 |
| 253 | 3300033524 | Ga0316592_1000011 | Ga0316592_100001117 | 88 |
| 254 | 3300033541 | Ga0316596_1006644 | Ga0316596_10066444 | 88 |
| 255 | 3300033541 | Ga0316596_1007465 | Ga0316596_10074651 | 88 |
| 256 | 3300036401 | Ga0373937_1126740 | Ga0373937_1126740_186_467 | 88 |
| 257 | 3300037312 | Ga0395899_0000034 | Ga0395899_0000034_22233_22499 | 88 |
| 258 | 3300037312 | Ga0395899_0105310 | Ga0395899_0105310_910_1206 | 88 |
| 259 | 3300037418 | Ga0395900_0201560 | Ga0395900_0201560_566_862 | 88 |
| 260 | 3300037418 | Ga0395900_1133326 | Ga0395900_1133326_42_308 | 88 |
| 261 | 3300037466 | Ga0395898_0257000 | Ga0395898_0257000_1376_1642 | 88 |
| 262 | 3300038443 | Ga0395901_0018865 | Ga0395901_0018865_519_788 | 88 |
| 263 | 3300041404 | Ga0439436_0053857 | Ga0439436_0053857_217_483 | 88 |
| 264 | 3300041413 | Ga0439465_0419119 | Ga0439465_0419119_18_296 | 88 |
| 265 | 3300041443 | Ga0451789_0610099 | Ga0451789_0610099_232_498 | 88 |
| 266 | 3300041444 | Ga0451790_21411 | Ga0451790_21411_168_434 | 88 |
| 267 | 3300041463 | Ga0451804_0336010 | Ga0451804_0336010_35_301 | 88 |
| 268 | 3300041486 | Ga0451807_1039411 | Ga0451807_1039411_51_317 | 88 |
| 269 | 3300041494 | Ga0451837_0432158 | Ga0451837_0432158_1022_1300 | 88 |
| 270 | 3300041512 | Ga0451853_2989796 | Ga0451853_2989796_226_492 | 88 |
| 271 | 3300041907 | Ga0452268_28166 | Ga0452268_28166_95_361 | 88 |
| 272 | 3300042007 | Ga0439449_0083278 | Ga0439449_0083278_615_893 | 88 |
| 273 | 3300042014 | Ga0439457_004245 | Ga0439457_004245_2990_3256 | 88 |
| 274 | 3300042015 | Ga0439462_0128235 | Ga0439462_0128235_369_635 | 88 |
| 275 | 3300042127 | Ga0450890_012599 | Ga0450890_012599_336_614 | 88 |
| 276 | 3300042436 | Ga0439435_0077741 | Ga0439435_0077741_123_437 | 88 |
| 277 | 3300042532 | Ga0450893_0145855 | Ga0450893_0145855_162_479 | 88 |
| 278 | 3300042876 | Ga0451577_0000210 | Ga0451577_0000210_118551_118823 | 88 |
| 279 | 3300042876 | Ga0451577_0004463 | Ga0451577_0004463_6397_6675 | 88 |
| 280 | 3300042876 | Ga0451577_0030002 | Ga0451577_0030002_556_828 | 88 |
| 281 | 3300044658 | Ga0466972_0022564 | Ga0466972_0022564_1406_1711 | 88 |
| 282 | 3300044693 | Ga0466961_0135164 | Ga0466961_0135164_660_965 | 88 |
| 283 | 3300044712 | Ga0453684_0000413 | Ga0453684_0000413_82972_83250 | 88 |
| 284 | 3300044712 | Ga0453684_0002807 | Ga0453684_0002807_39918_40190 | 88 |
| 285 | 3300044712 | Ga0453684_0012498 | Ga0453684_0012498_10540_10815 | 88 |
| 286 | 3300044712 | Ga0453684_0027807 | Ga0453684_0027807_718_990 | 88 |
| 287 | 3300044712 | Ga0453684_0198942 | Ga0453684_0198942_1631_1948 | 88 |
| 288 | 3300044712 | Ga0453684_0784483 | Ga0453684_0784483_714_989 | 88 |
| 289 | 3300044735 | Ga0466968_0047351 | Ga0466968_0047351_235_540 | 88 |
| 290 | 3300044735 | Ga0466968_0269237 | Ga0466968_0269237_358_624 | 88 |
| 291 | 3300044765 | Ga0466970_0009840 | Ga0466970_0009840_2969_3274 | 88 |
| 292 | 3300045049 | Ga0466959_0279231 | Ga0466959_0279231_68_334 | 88 |
| 293 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_957674_957961 | 88 |
| 294 | 3300045051 | Ga0451576_0030427 | Ga0451576_0030427_4056_4334 | 88 |
| 295 | 3300045051 | Ga0451576_1792466 | Ga0451576_1792466_91_372 | 88 |
| 296 | 3300046506 | Ga0495583_0204454 | Ga0495583_0204454_119_385 | 88 |
| 297 | 3300046525 | Ga0495663_0139917 | Ga0495663_0139917_320_598 | 88 |
| 298 | 3300046660 | Ga0495625_0068664 | Ga0495625_0068664_2056_2322 | 88 |
| 299 | 3300046691 | Ga0495670_0070410 | Ga0495670_0070410_958_1236 | 88 |
| 300 | 3300047318 | Ga0495636_0238073 | Ga0495636_0238073_133_453 | 88 |
| 301 | 3300047320 | Ga0495672_0284895 | Ga0495672_0284895_468_743 | 88 |
| 302 | 3300047471 | Ga0495684_0153472 | Ga0495684_0153472_529_810 | 88 |
| 303 | 3300047472 | Ga0495686_0034775 | Ga0495686_0034775_2489_2755 | 88 |
| 304 | 3300048905 | Ga0496102_0590881 | Ga0496102_0590881_315_593 | 88 |
| 305 | 3300048906 | Ga0496103_0058547 | Ga0496103_0058547_592_870 | 88 |
| 306 | 3300048918 | Ga0496115_1009044 | Ga0496115_1009044_50_316 | 88 |
| 307 | 3300048929 | Ga0496126_0102727 | Ga0496126_0102727_1589_1864 | 88 |
| 308 | 3300049127 | Ga0501306_017228 | Ga0501306_017228_603_881 | 88 |
| 309 | 3300049127 | Ga0501306_025702 | Ga0501306_025702_125_403 | 88 |
| 310 | 3300049128 | Ga0501308_004229 | Ga0501308_004229_95_361 | 88 |
| 311 | 3300049128 | Ga0501308_020268 | Ga0501308_020268_101_379 | 88 |
| 312 | 3300049128 | Ga0501308_020720 | Ga0501308_020720_123_401 | 88 |
| 313 | 3300049129 | Ga0501309_064569 | Ga0501309_064569_197_475 | 88 |
| 314 | 3300049130 | Ga0501310_021854 | Ga0501310_021854_103_381 | 88 |
| 315 | 3300049130 | Ga0501310_072467 | Ga0501310_072467_123_401 | 88 |
| 316 | 3300049130 | Ga0501310_081363 | Ga0501310_081363_174_452 | 88 |
| 317 | 3300049132 | Ga0501343_005351 | Ga0501343_005351_105_383 | 88 |
| 318 | 3300049132 | Ga0501343_021492 | Ga0501343_021492_263_538 | 88 |
| 319 | 3300049161 | Ga0501305_005628 | Ga0501305_005628_168_446 | 88 |
| 320 | 3300049162 | Ga0501307_020560 | Ga0501307_020560_124_402 | 88 |
| 321 | 3300049527 | Ga0501311_068078 | Ga0501311_068078_287_565 | 88 |
| 322 | 3300049528 | Ga0501312_002580 | Ga0501312_002580_1572_1850 | 88 |
| 323 | 3300049528 | Ga0501312_043055 | Ga0501312_043055_437_721 | 88 |
| 324 | 3300049528 | Ga0501312_087058 | Ga0501312_087058_118_396 | 88 |
| 325 | 3300049528 | Ga0501312_098692 | Ga0501312_098692_62_331 | 88 |
| 326 | 3300049529 | Ga0501313_027750 | Ga0501313_027750_324_602 | 88 |
| 327 | 3300049530 | Ga0501314_000038 | Ga0501314_000038_4975_5253 | 88 |
| 328 | 3300049531 | Ga0501315_003355 | Ga0501315_003355_1166_1444 | 88 |
| 329 | 3300049531 | Ga0501315_017264 | Ga0501315_017264_35_301 | 88 |
| 330 | 3300049531 | Ga0501315_020857 | Ga0501315_020857_482_760 | 88 |
| 331 | 3300049531 | Ga0501315_077348 | Ga0501315_077348_117_383 | 88 |
| 332 | 3300049531 | Ga0501315_084386 | Ga0501315_084386_181_459 | 88 |
| 333 | 3300049533 | Ga0501317_004692 | Ga0501317_004692_999_1277 | 88 |
| 334 | 3300049533 | Ga0501317_098162 | Ga0501317_098162_128_406 | 88 |
| 335 | 3300049536 | Ga0501320_001839 | Ga0501320_001839_104_382 | 88 |
| 336 | 3300049536 | Ga0501320_003002 | Ga0501320_003002_969_1247 | 88 |
| 337 | 3300049536 | Ga0501320_018033 | Ga0501320_018033_407_685 | 88 |
| 338 | 3300049536 | Ga0501320_018336 | Ga0501320_018336_95_373 | 88 |
| 339 | 3300049537 | Ga0501321_047434 | Ga0501321_047434_321_599 | 88 |
| 340 | 3300049539 | Ga0501323_018933 | Ga0501323_018933_582_860 | 88 |
| 341 | 3300049540 | Ga0501324_000812 | Ga0501324_000812_1500_1778 | 88 |
| 342 | 3300049541 | Ga0501325_031005 | Ga0501325_031005_64_342 | 88 |
| 343 | 3300049542 | Ga0501326_04901 | Ga0501326_04901_120_398 | 88 |
| 344 | 3300049543 | Ga0501327_03811 | Ga0501327_03811_407_685 | 88 |
| 345 | 3300049545 | Ga0501329_02901 | Ga0501329_02901_269_547 | 88 |
| 346 | 3300049546 | Ga0501330_008560 | Ga0501330_008560_97_375 | 88 |
| 347 | 3300049547 | Ga0501331_11512 | Ga0501331_11512_104_382 | 88 |
| 348 | 3300049550 | Ga0501334_07180 | Ga0501334_07180_106_372 | 88 |
| 349 | 3300049551 | Ga0501335_005181 | Ga0501335_005181_101_367 | 88 |
| 350 | 3300049551 | Ga0501335_015036 | Ga0501335_015036_109_387 | 88 |
| 351 | 3300049551 | Ga0501335_048704 | Ga0501335_048704_116_394 | 88 |
| 352 | 3300049553 | Ga0501337_008454 | Ga0501337_008454_353_631 | 88 |
| 353 | 3300049553 | Ga0501337_019466 | Ga0501337_019466_106_384 | 88 |
| 354 | 3300049554 | Ga0501338_06283 | Ga0501338_06283_361_639 | 88 |
| 355 | 3300049556 | Ga0501340_000481 | Ga0501340_000481_1086_1364 | 88 |
| 356 | 3300049556 | Ga0501340_019144 | Ga0501340_019144_109_387 | 88 |
| 357 | 3300049570 | Ga0501033_0729587 | Ga0501033_0729587_249_515 | 88 |
| 358 | 3300049576 | Ga0501040_0408170 | Ga0501040_0408170_391_675 | 88 |
| 359 | 3300049578 | Ga0501042_0165306 | Ga0501042_0165306_1247_1540 | 88 |
| 360 | 3300049581 | Ga0501047_0005869 | Ga0501047_0005869_5158_5427 | 88 |
| 361 | 3300049581 | Ga0501047_0074504 | Ga0501047_0074504_1135_1410 | 88 |
| 362 | 3300049581 | Ga0501047_0303224 | Ga0501047_0303224_387_665 | 88 |
| 363 | 3300049582 | Ga0501048_0975460 | Ga0501048_0975460_75_350 | 88 |
| 364 | 3300049588 | Ga0501072_0793055 | Ga0501072_0793055_57_335 | 88 |
| 365 | 3300049590 | Ga0501074_0139117 | Ga0501074_0139117_1156_1425 | 88 |
| 366 | 3300049591 | Ga0501075_0172789 | Ga0501075_0172789_789_1085 | 88 |
| 367 | 3300049591 | Ga0501075_0787114 | Ga0501075_0787114_79_366 | 88 |
| 368 | 3300049591 | Ga0501075_0849564 | Ga0501075_0849564_218_496 | 88 |
| 369 | 3300049592 | Ga0501076_0193157 | Ga0501076_0193157_501_779 | 88 |
| 370 | 3300049592 | Ga0501076_0429359 | Ga0501076_0429359_365_652 | 88 |
| 371 | 3300049654 | Ga0501207_078071 | Ga0501207_078071_88_453 | 88 |
| 372 | 3300049661 | Ga0501217_010354 | Ga0501217_010354_13_291 | 88 |
| 373 | 3300049663 | Ga0501223_067476 | Ga0501223_067476_46_312 | 88 |
| 374 | 3300049708 | Ga0501245_148433 | Ga0501245_148433_116_382 | 88 |
| 375 | 3300049742 | Ga0501080_0187759 | Ga0501080_0187759_65_334 | 88 |
| 376 | 3300049743 | Ga0501081_0269524 | Ga0501081_0269524_925_1209 | 88 |
| 377 | 3300049744 | Ga0501083_0956854 | Ga0501083_0956854_225_503 | 88 |
| 378 | 3300049763 | Ga0501266_051713 | Ga0501266_051713_169_447 | 88 |
| 379 | 3300049766 | Ga0501269_026196 | Ga0501269_026196_205_480 | 88 |
| 380 | 3300049822 | Ga0501035_0048381 | Ga0501035_0048381_2983_3252 | 88 |
| 381 | 3300049823 | Ga0501044_0008030 | Ga0501044_0008030_7870_8139 | 88 |
| 382 | 3300050493 | nmdc:mga0k408_4220_c1 | nmdc:mga0k408_4220_c1_6297_6563 | 88 |
| 383 | 3300050493 | nmdc:mga0k408_434950_c1 | nmdc:mga0k408_434950_c1_452_718 | 88 |
| 384 | 3300050494 | nmdc:mga06z11_888712_c1 | nmdc:mga06z11_888712_c1_131_424 | 88 |
| 385 | 3300050496 | nmdc:mga07m45_44230_c1 | nmdc:mga07m45_44230_c1_284_562 | 88 |
| 386 | 3300050496 | nmdc:mga07m45_671679_c1 | nmdc:mga07m45_671679_c1_193_459 | 88 |
| 387 | 3300050507 | nmdc:mga05p37_80072_c1 | nmdc:mga05p37_80072_c1_2928_3221 | 88 |
| 388 | 3300050508 | nmdc:mga09592_197231_c1 | nmdc:mga09592_197231_c1_805_1125 | 88 |
| 389 | 3300050508 | nmdc:mga09592_439617_c1 | nmdc:mga09592_439617_c1_501_779 | 88 |
| 390 | 3300050509 | nmdc:mga0qj67_712714_c1 | nmdc:mga0qj67_712714_c1_470_748 | 88 |
| 391 | 3300050509 | nmdc:mga0qj67_873297_c1 | nmdc:mga0qj67_873297_c1_177_491 | 88 |
| 392 | 3300050510 | nmdc:mga06r32_903963_c1 | nmdc:mga06r32_903963_c1_365_643 | 88 |
| 393 | 3300050510 | nmdc:mga06r32_954572_c1 | nmdc:mga06r32_954572_c1_282_602 | 88 |
| 394 | 3300050512 | nmdc:mga0n895_419548_c1 | nmdc:mga0n895_419548_c1_275_568 | 88 |
| 395 | 3300050513 | nmdc:mga0rr50_141842_c1 | nmdc:mga0rr50_141842_c1_930_1223 | 88 |
| 396 | 3300050515 | nmdc:mga0a205_464881_c1 | nmdc:mga0a205_464881_c1_20_340 | 88 |
| 397 | 3300050515 | nmdc:mga0a205_608441_c1 | nmdc:mga0a205_608441_c1_433_726 | 88 |
| 398 | 3300050515 | nmdc:mga0a205_674830_c1 | nmdc:mga0a205_674830_c1_352_672 | 88 |
| 399 | 3300053080 | Ga0500635_0004581 | Ga0500635_0004581_512_778 | 88 |
| 400 | 3300053094 | Ga0500566_0303741 | Ga0500566_0303741_296_562 | 88 |
| 401 | 3300053102 | Ga0500554_114417 | Ga0500554_114417_47_322 | 88 |
| 402 | 3300053119 | Ga0500595_014280 | Ga0500595_014280_1298_1573 | 88 |
| 403 | 3300053136 | Ga0500559_0103194 | Ga0500559_0103194_465_731 | 88 |
| 404 | 3300053138 | Ga0500564_131549 | Ga0500564_131549_743_1018 | 88 |
| 405 | 3300053154 | Ga0500619_087325 | Ga0500619_087325_136_411 | 88 |
| 406 | 3300053156 | Ga0500622_0000385 | Ga0500622_0000385_38237_38503 | 88 |
| 407 | 3300053158 | Ga0500627_0310574 | Ga0500627_0310574_99_365 | 88 |
| 408 | 3300053730 | Ga0500645_019570 | Ga0500645_019570_491_769 | 88 |
| 409 | 3300053730 | Ga0500645_077780 | Ga0500645_077780_19_285 | 88 |
| 410 | 3300054114 | Ga0501084_1875507 | Ga0501084_1875507_15_293 | 88 |
| 411 | 3300055283 | Ga0500661_027542 | Ga0500661_027542_615_890 | 88 |
| 412 | 3300059477 | Ga0587084_017616 | Ga0587084_017616_66_341 | 88 |
| 413 | 3300059477 | Ga0587084_095626 | Ga0587084_095626_250_555 | 88 |
| 414 | 3300059491 | Ga0587070_030135 | Ga0587070_030135_650_925 | 88 |
| 415 | 3300059493 | Ga0587077_003683 | Ga0587077_003683_1214_1492 | 88 |
| 416 | 3300059493 | Ga0587077_007978 | Ga0587077_007978_149_442 | 88 |
| 417 | 3300059493 | Ga0587077_038531 | Ga0587077_038531_26_301 | 88 |
| 418 | 3300059493 | Ga0587077_083713 | Ga0587077_083713_209_487 | 88 |
| 419 | 3300059493 | Ga0587077_091444 | Ga0587077_091444_107_373 | 88 |
| 420 | 3300059504 | Ga0587082_021755 | Ga0587082_021755_654_932 | 88 |
| 421 | 3300059506 | Ga0587085_019714 | Ga0587085_019714_83_358 | 88 |
| 422 | 3300059506 | Ga0587085_115200 | Ga0587085_115200_140_418 | 88 |
| 423 | 3300059507 | Ga0587086_003002 | Ga0587086_003002_1328_1603 | 88 |
| 424 | 3300059510 | Ga0587090_002489 | Ga0587090_002489_1640_1918 | 88 |
| 425 | 3300059510 | Ga0587090_008083 | Ga0587090_008083_995_1273 | 88 |
| 426 | 3300059510 | Ga0587090_019444 | Ga0587090_019444_82_357 | 88 |
| 427 | 3300059510 | Ga0587090_164008 | Ga0587090_164008_92_358 | 88 |
| 428 | 3300059511 | Ga0587091_015081 | Ga0587091_015081_883_1149 | 88 |
| 429 | 3300059511 | Ga0587091_018706 | Ga0587091_018706_127_402 | 88 |
| 430 | 3300059511 | Ga0587091_058986 | Ga0587091_058986_115_393 | 88 |
| 431 | 3300059511 | Ga0587091_087856 | Ga0587091_087856_131_409 | 88 |
| 432 | 3300059512 | Ga0587092_004898 | Ga0587092_004898_1110_1403 | 88 |
| 433 | 3300059607 | Ga0587125_023139 | Ga0587125_023139_174_452 | 88 |
| 434 | 3300059623 | Ga0587101_012643 | Ga0587101_012643_702_980 | 88 |
| 435 | 3300059623 | Ga0587101_053390 | Ga0587101_053390_26_301 | 88 |
| 436 | 3300059624 | Ga0587109_003270 | Ga0587109_003270_1036_1314 | 88 |
| 437 | 3300059624 | Ga0587109_004974 | Ga0587109_004974_1152_1445 | 88 |
| 438 | 3300059627 | Ga0587117_000700 | Ga0587117_000700_1087_1380 | 88 |
| 439 | 3300059630 | Ga0587128_042644 | Ga0587128_042644_406_684 | 88 |
| 440 | 3300059630 | Ga0587128_086715 | Ga0587128_086715_139_438 | 88 |
| 441 | 3300059630 | Ga0587128_153326 | Ga0587128_153326_215_490 | 88 |
| 442 | 3300059639 | Ga0587062_000275 | Ga0587062_000275_2219_2497 | 88 |
| 443 | 3300059639 | Ga0587062_004253 | Ga0587062_004253_647_925 | 88 |
| 444 | 3300059639 | Ga0587062_014690 | Ga0587062_014690_118_396 | 88 |
| 445 | 3300059639 | Ga0587062_136919 | Ga0587062_136919_48_323 | 88 |
| 446 | 3300059641 | Ga0587068_000623 | Ga0587068_000623_1637_1930 | 88 |
| 447 | 3300059641 | Ga0587068_011433 | Ga0587068_011433_979_1245 | 88 |
| 448 | 3300059641 | Ga0587068_016722 | Ga0587068_016722_213_518 | 88 |
| 449 | 3300059641 | Ga0587068_023231 | Ga0587068_023231_102_377 | 88 |
| 450 | 3300059645 | Ga0587076_008986 | Ga0587076_008986_37_336 | 88 |
| 451 | 3300059645 | Ga0587076_054617 | Ga0587076_054617_123_401 | 88 |
| 452 | 3300059648 | Ga0587100_045287 | Ga0587100_045287_108_386 | 88 |
| 453 | 3300059652 | Ga0587107_015937 | Ga0587107_015937_68_346 | 88 |
| 454 | 3300059652 | Ga0587107_105427 | Ga0587107_105427_112_387 | 88 |
| 455 | 3300059653 | Ga0587108_004347 | Ga0587108_004347_359_637 | 88 |
| 456 | 3300059653 | Ga0587108_004541 | Ga0587108_004541_115_393 | 88 |
| 457 | 3300059660 | Ga0587124_005157 | Ga0587124_005157_636_914 | 88 |
| 458 | 3300059660 | Ga0587124_010738 | Ga0587124_010738_263_541 | 88 |
| 459 | 3300060244 | Ga0587061_08754 | Ga0587061_08754_117_395 | 88 |
| 460 | 3300060246 | Ga0587081_03105 | Ga0587081_03105_117_395 | 88 |
| 461 | 3300060346 | Ga0587111_0005171 | Ga0587111_0005171_1223_1501 | 88 |
| 462 | 3300060346 | Ga0587111_0005360 | Ga0587111_0005360_1631_1936 | 88 |
| 463 | 3300060346 | Ga0587111_0010170 | Ga0587111_0010170_656_931 | 88 |
| 464 | 3300060353 | Ga0501082_0240326 | Ga0501082_0240326_498_782 | 88 |
| 465 | 3300060353 | Ga0501082_0265415 | Ga0501082_0265415_405_692 | 88 |
| 466 | 3300060353 | Ga0501082_0534043 | Ga0501082_0534043_452_736 | 88 |
| 467 | 3300060353 | Ga0501082_1539284 | Ga0501082_1539284_86_364 | 88 |
| 468 | 3300061734 | Ga0530510_0924741 | Ga0530510_0924741_76_354 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mmm-assembly1.cif.gz_s | structure of the 70s chloroplast ribosome | 0.9725 | 8 | 83 |
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9496 | 12 | 76 |
| 4v8a-assembly2.cif.gz_CS | the structure of thermorubin in complex with the 70s ribosome from thermus thermophilus. | 0.9427 | 8 | 83 |
| 4v8a-assembly1.cif.gz_DS | the structure of thermorubin in complex with the 70s ribosome from thermus thermophilus. | 0.9427 | 8 | 83 |
| 5o61-assembly1.cif.gz_BS | the complete structure of the mycobacterium smegmatis 70s ribosome | 0.9415 | 2 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5zeus00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9208 | 7 | 83 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9021 | 4 | 81 | 3.30.860.10 |
| 4kj2S00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9019 | 3 | 81 | 3.30.860.10 |
| 5zeus00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8989 | 7 | 83 | 3.30.860.10 |
| 2wriS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8975 | 4 | 82 | 3.30.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R5ZCU1-F1-model_v4 | deleted | 0.9588 | 1 | 83 |
|
| AF-A0A3D0N859-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9488 | 1 | 84 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A1V5ZDP7-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9485 | 1 | 84 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A496ATK1-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9457 | 1 | 84 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A1V5L2N2-F1-model_v4 | Small ribosomal subunit protein uS19 | 0.9423 | 3 | 83 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar