F449988

General Info

Members Datasets Scaffolds Average Seq Length
468 298 465 91

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100497050|Ga0070706_1004970501
Length 106
Sequence MARSLRKGPFVDPSLQRKVDASLAGGSKQVIRTWSRRSMITPDFVGLTFHVHNGKLFVPVFVTENMVGHRLGEFSPTRKFTGHSGAKKVKTVAAPSSPMPVPGQKS

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
3 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
122 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
123 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
124 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
162 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
247 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.58
Metatranscriptomes 27.78
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 0
Rhizoplane 1.5
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1037201 3300001904 Bacteria 750
2 JGI24739J22299_10248889 3300001989 Bacteria 521
3 JGI24737J22298_10001191 3300001990 Bacteria 9175
4 JGI24735J21928_10001634 3300002067 Bacteria 7935
5 JGI25157J39369_1012503 3300002741 Bacteria 1079
6 JGI25157J39369_1036779 3300002741 Bacteria 547
7 JGI25165J46597_1030395 3300003214 Bacteria 697
8 rootL2_10134610 3300003322 Bacteria 2534
9 rootH1_10116742 3300003323 Bacteria 1409
10 Ga0055536_1006040 3300003781 Bacteria 5745
11 Ga0055543_1023698 3300004625 Bacteria 1105
12 Ga0058863_11894467 3300004799 Bacteria 1830
13 Ga0058860_11979646 3300004801 Bacteria 978
14 Ga0058862_11525955 3300004803 Bacteria 1479
15 Ga0058862_12680365 3300004803 Bacteria 536
16 Ga0058862_12740678 3300004803 Bacteria 703
17 Ga0065165_1000131 3300005262 Bacteria 128880
18 Ga0065704_10014908 3300005289 Bacteria 2005
19 Ga0065704_10422899 3300005289 Bacteria 657
20 Ga0065704_10426557 3300005289 Bacteria 727
21 Ga0065707_10068828 3300005295 Bacteria 549
22 Ga0065707_10484260 3300005295 Bacteria 771
23 Ga0070658_10000153 3300005327 Bacteria 60625
24 Ga0070676_10520477 3300005328 Bacteria 847
25 Ga0070660_100007068 3300005339 Bacteria 7799
26 Ga0070668_101518162 3300005347 Bacteria 613
27 Ga0070668_102172490 3300005347 Bacteria 513
28 Ga0070675_101428503 3300005354 Bacteria 638
29 Ga0070671_100794976 3300005355 Bacteria 823
30 Ga0070688_100302945 3300005365 Bacteria 1156
31 Ga0070659_100008718 3300005366 Bacteria 7421
32 Ga0070667_101665396 3300005367 Bacteria 600
33 Ga0068867_101388288 3300005459 Bacteria 651
34 Ga0070706_100497050 3300005467 Bacteria 1135
35 Ga0070679_100510731 3300005530 Bacteria 1146
36 Ga0068853_100081417 3300005539 Bacteria 2835
37 Ga0070686_101728309 3300005544 Bacteria 531
38 Ga0070695_100226104 3300005545 Bacteria 1350
39 Ga0070696_100162632 3300005546 Bacteria 1645
40 Ga0070704_100433128 3300005549 Bacteria 1129
41 Ga0068855_100044845 3300005563 Bacteria 5231
42 Ga0068855_100824591 3300005563 Bacteria 984
43 Ga0068857_100038490 3300005577 Bacteria 4236
44 Ga0068857_101087483 3300005577 Bacteria 772
45 Ga0068854_100068418 3300005578 Bacteria 2589
46 Ga0068854_101837642 3300005578 Bacteria 556
47 Ga0068852_101353931 3300005616 Bacteria 734
48 Ga0068859_100352672 3300005617 Bacteria 1566
49 Ga0068861_100585687 3300005719 Bacteria 1022
50 Ga0068870_10479651 3300005840 Bacteria 825
51 Ga0068858_100779401 3300005842 Bacteria 932
52 Ga0068858_101707600 3300005842 Bacteria 622
53 Ga0068860_100326634 3300005843 Bacteria 1506
54 Ga0070716_100178428 3300006173 Bacteria 1392
55 Ga0070712_100565079 3300006175 Bacteria 960
56 Ga0075362_10412817 3300006177 Bacteria 682
57 Ga0075366_10000288 3300006195 Bacteria 22515
58 Ga0075366_10077240 3300006195 Bacteria 1987
59 Ga0075366_10106699 3300006195 Bacteria 1684
60 Ga0075370_10063124 3300006353 Bacteria 2111
61 Ga0075370_10450086 3300006353 Bacteria 775
62 Ga0075370_10471947 3300006353 Bacteria 756
63 Ga0075428_100003062 3300006844 Bacteria 18244
64 Ga0075428_100272873 3300006844 Bacteria 1820
65 Ga0075428_100335530 3300006844 Bacteria 1624
66 Ga0075430_100455491 3300006846 Bacteria 1056
67 Ga0075430_100666777 3300006846 Bacteria 858
68 Ga0075431_100256533 3300006847 Bacteria 1775
69 Ga0075431_100904296 3300006847 Bacteria 852
70 Ga0075431_101697136 3300006847 Bacteria 588
71 Ga0075433_11344379 3300006852 Bacteria 619
72 Ga0075429_100317476 3300006880 Bacteria 1363
73 Ga0075429_100392049 3300006880 Bacteria 1216
74 Ga0068865_101650585 3300006881 Bacteria 577
75 Ga0097620_100352668 3300006931 Bacteria 1566
76 Ga0099794_10469421 3300007265 Bacteria 661
77 Ga0105240_10041987 3300009093 Bacteria 5831
78 Ga0105240_10048322 3300009093 Bacteria 5379
79 Ga0105240_10404513 3300009093 Bacteria 1537
80 Ga0105240_10661368 3300009093 Bacteria 1144
81 Ga0105247_10743125 3300009101 Bacteria 743
82 Ga0114129_10134996 3300009147 Bacteria 3386
83 Ga0114129_10421592 3300009147 Bacteria 1755
84 Ga0105241_10009907 3300009174 Bacteria 7004
85 Ga0105241_10703499 3300009174 Bacteria 923
86 Ga0105248_12476230 3300009177 Bacteria 591
87 Ga0105237_10035876 3300009545 Bacteria 5016
88 Ga0105237_11818087 3300009545 Bacteria 617
89 Ga0105238_10248125 3300009551 Bacteria 1758
90 Ga0105238_12366008 3300009551 Bacteria 567
91 Ga0105249_12380731 3300009553 Bacteria 602
92 Ga0105239_10000011 3300010375 Bacteria 337500
93 Ga0105239_10122693 3300010375 Bacteria 2887
94 Ga0105239_11570583 3300010375 Bacteria 761
95 Ga0105239_11640035 3300010375 Bacteria 744
96 Ga0157326_1016658 3300012513 Bacteria 872
97 Ga0157371_10001664 3300013102 Bacteria 22687
98 Ga0157371_11424422 3300013102 Bacteria 539
99 Ga0157371_11587625 3300013102 Bacteria 512
100 Ga0157370_10047165 3300013104 Bacteria 4130
101 Ga0157370_11599843 3300013104 Bacteria 585
102 Ga0157369_10007412 3300013105 Bacteria 12631
103 Ga0157374_10173144 3300013296 Bacteria 2106
104 Ga0157374_10609812 3300013296 Bacteria 1102
105 Ga0157378_10058863 3300013297 Bacteria 3427
106 Ga0163162_10379084 3300013306 Bacteria 1547
107 Ga0157372_10064662 3300013307 Bacteria 4104
108 Ga0157372_10269915 3300013307 Bacteria 1976
109 Ga0157375_13077954 3300013308 Bacteria 556
110 Ga0206356_10239140 3300020070 Bacteria 1146
111 Ga0206356_11003395 3300020070 Bacteria 2327
112 Ga0206349_1204727 3300020075 Bacteria 1249
113 Ga0206355_1259448 3300020076 Bacteria 985
114 Ga0206351_10512829 3300020077 Bacteria 15076
115 Ga0206352_10935446 3300020078 Bacteria 1890
116 Ga0206350_10752456 3300020080 Bacteria 3060
117 Ga0206350_11611523 3300020080 Bacteria 576
118 Ga0206354_11306986 3300020081 Bacteria 4239
119 Ga0206353_10607448 3300020082 Bacteria 1144
120 Ga0154015_1037437 3300020610 Bacteria 13281
121 Ga0224712_10003182 3300022467 Bacteria 4212
122 Ga0224712_10003582 3300022467 Bacteria 4061
123 Ga0209026_1003238 3300025250 Bacteria 5483
124 Ga0209026_1004981 3300025250 Bacteria 3723
125 Ga0209148_1024264 3300025254 Bacteria 959
126 Ga0209233_1001329 3300025261 Bacteria 9868
127 Ga0209233_1003581 3300025261 Bacteria 5451
128 Ga0209455_1013843 3300025272 Bacteria 1854
129 Ga0209676_1000332 3300025292 Bacteria 90798
130 Ga0209050_1038388 3300025298 Bacteria 1366
131 Ga0207647_10000171 3300025904 Bacteria 51875
132 Ga0207705_10000108 3300025909 Bacteria 93501
133 Ga0207684_10086390 3300025910 Bacteria 2672
134 Ga0207684_10402324 3300025910 Bacteria 1177
135 Ga0207654_10014217 3300025911 Bacteria 4110
136 Ga0207654_10319167 3300025911 Bacteria 1061
137 Ga0207654_10534306 3300025911 Bacteria 831
138 Ga0207695_10000053 3300025913 Bacteria 396740
139 Ga0207695_10081967 3300025913 Bacteria 3263
140 Ga0207695_10275711 3300025913 Bacteria 1576
141 Ga0207695_10359162 3300025913 Bacteria 1343
142 Ga0207671_10201010 3300025914 Bacteria 1556
143 Ga0207671_10998199 3300025914 Bacteria 660
144 Ga0207693_10769761 3300025915 Bacteria 743
145 Ga0207660_10617026 3300025917 Bacteria 884
146 Ga0207657_10105386 3300025919 Bacteria 2334
147 Ga0207694_10154790 3300025924 Bacteria 1848
148 Ga0207690_10012751 3300025932 Bacteria 5037
149 Ga0207665_10510152 3300025939 Bacteria 930
150 Ga0207665_10794563 3300025939 Unclassified 747
151 Ga0207667_10095966 3300025949 Bacteria 3060
152 Ga0207667_10542459 3300025949 Bacteria 1177
153 Ga0207668_10649041 3300025972 Bacteria 924
154 Ga0207640_10025047 3300025981 Bacteria 3607
155 Ga0207703_11591459 3300026035 Bacteria 629
156 Ga0207639_10039149 3300026041 Bacteria 3531
157 Ga0207639_11155537 3300026041 Bacteria 726
158 Ga0207674_10016950 3300026116 Bacteria 7956
159 Ga0207674_11354077 3300026116 Bacteria 681
160 Ga0207674_11457746 3300026116 Bacteria 654
161 Ga0207675_100337424 3300026118 Bacteria 1475
162 Ga0207698_10884310 3300026142 Bacteria 900
163 Ga0209999_1007217 3300027543 Bacteria 1997
164 Ga0268265_11817992 3300028380 Bacteria 616
165 Ga0268264_10053452 3300028381 Bacteria 3370
166 Ga0268264_11226521 3300028381 Bacteria 760
167 Ga0265326_10062435 3300028558 Bacteria 1054
168 Ga0265334_10000272 3300028573 Bacteria 29197
169 Ga0265334_10002690 3300028573 Bacteria 8214
170 Ga0265318_10040734 3300028577 Bacteria 1768
171 Ga0265338_10000135 3300028800 Bacteria 135743
172 Ga0265338_10283863 3300028800 Bacteria 1209
173 Ga0265324_10000247 3300029957 Bacteria 40078
174 Ga0316177_1219406 3300030731 Bacteria 1129
175 Ga0314311_1002819 3300030733 Bacteria 634
176 Ga0316179_1011335 3300030734 Bacteria 581
177 Ga0316180_1144171 3300030736 Bacteria 1178
178 Ga0265328_10026643 3300031239 Bacteria 2172
179 Ga0265339_10275706 3300031249 Bacteria 807
180 Ga0265331_10024674 3300031250 Bacteria 3040
181 Ga0265331_10233349 3300031250 Bacteria 826
182 Ga0265327_10001935 3300031251 Bacteria 23890
183 Ga0265327_10059376 3300031251 Bacteria 1959
184 Ga0265327_10074641 3300031251 Bacteria 1689
185 Ga0265316_10557917 3300031344 Bacteria 815
186 Ga0307408_100013046 3300031548 Bacteria 5512
187 Ga0307408_100484555 3300031548 Bacteria 1079
188 Ga0307408_100614704 3300031548 Bacteria 967
189 Ga0265314_10065968 3300031711 Bacteria 2443
190 Ga0265342_10256852 3300031712 Bacteria 931
191 Ga0265342_10444788 3300031712 Bacteria 666
192 Ga0316576_10763277 3300031727 Bacteria 698
193 Ga0316576_11350953 3300031727 Bacteria 501
194 Ga0307405_10051278 3300031731 Bacteria 2559
195 Ga0307405_10462418 3300031731 Bacteria 1009
196 Ga0307413_10081458 3300031824 Bacteria 2075
197 Ga0307413_10393442 3300031824 Bacteria 1084
198 Ga0307413_10543971 3300031824 Bacteria 941
199 Ga0307410_10003030 3300031852 Bacteria 8302
200 Ga0307410_10159428 3300031852 Bacteria 1689
201 Ga0307406_10143289 3300031901 Bacteria 1695
202 Ga0307406_10427406 3300031901 Bacteria 1057
203 Ga0307407_10781539 3300031903 Bacteria 725
204 Ga0307412_10006208 3300031911 Bacteria 6740
205 Ga0307412_10031955 3300031911 Bacteria 3329
206 Ga0307412_10310506 3300031911 Bacteria 1250
207 Ga0307412_11079551 3300031911 Bacteria 713
208 Ga0307412_11462645 3300031911 Bacteria 620
209 Ga0307409_100004529 3300031995 Bacteria 7828
210 Ga0307416_100137679 3300032002 Bacteria 2212
211 Ga0307416_100213871 3300032002 Bacteria 1842
212 Ga0307414_10000927 3300032004 Bacteria 15015
213 Ga0307414_10011719 3300032004 Bacteria 5154
214 Ga0307414_10014563 3300032004 Bacteria 4720
215 Ga0307414_10028964 3300032004 Bacteria 3599
216 Ga0307414_10168902 3300032004 Bacteria 1746
217 Ga0307414_10591101 3300032004 Bacteria 994
218 Ga0307414_11504083 3300032004 Bacteria 627
219 Ga0307414_11741533 3300032004 Bacteria 581
220 Ga0307411_10008827 3300032005 Bacteria 5250
221 Ga0307411_10047021 3300032005 Bacteria 2787
222 Ga0307411_11187883 3300032005 Bacteria 691
223 Ga0307415_100353293 3300032126 Bacteria 1238
224 Ga0316593_10050622 3300032168 Bacteria 1402
225 Ga0316593_10162840 3300032168 Unclassified 815
226 Ga0316592_1000011 3300033524 Bacteria 13521
227 Ga0316596_1006644 3300033541 Bacteria 2700
228 Ga0316596_1007465 3300033541 Bacteria 2583
229 Ga0373946_0218365 3300035171 Bacteria 920
230 Ga0316574_0138171 3300035398 Bacteria 1569
231 Ga0373927_0000001 3300035695 Bacteria 1082160
232 Ga0373937_1126740 3300036401 Bacteria 733
233 Ga0316582_0338819 3300036647 Bacteria 1034
234 Ga0395899_0000034 3300037312 Bacteria 302623
235 Ga0395899_0105310 3300037312 Bacteria 2032
236 Ga0395900_0201560 3300037418 Bacteria 2013
237 Ga0395900_1133326 3300037418 Bacteria 699
238 Ga0395898_0257000 3300037466 Bacteria 1666
239 Ga0395898_0290360 3300037466 Bacteria 1560
240 Ga0395901_0018865 3300038443 Bacteria 7051
241 Ga0436362_0192697 3300039453 Unclassified 2593
242 Ga0439436_0053857 3300041404 Bacteria 1133
243 Ga0439465_0419119 3300041413 Bacteria 511
244 Ga0451789_0610099 3300041443 Bacteria 701
245 Ga0451790_21411 3300041444 Bacteria 734
246 Ga0451804_0336010 3300041463 Bacteria 547
247 Ga0451807_1039411 3300041486 Bacteria 559
248 Ga0451837_0432158 3300041494 Bacteria 1837
249 Ga0451853_2989796 3300041512 Bacteria 528
250 Ga0452268_28166 3300041907 Bacteria 651
251 Ga0439449_0083278 3300042007 Bacteria 1180
252 Ga0439457_004245 3300042014 Bacteria 3773
253 Ga0439462_0128235 3300042015 Bacteria 707
254 Ga0450890_012599 3300042127 Bacteria 1099
255 Ga0439435_0077741 3300042436 Bacteria 992
256 Ga0450893_0145855 3300042532 Bacteria 508
257 Ga0451577_0000210 3300042876 Bacteria 122637
258 Ga0451577_0004463 3300042876 Bacteria 14775
259 Ga0451577_0030002 3300042876 Bacteria 4913
260 Ga0466972_0022564 3300044658 Bacteria 3133
261 Ga0466961_0135164 3300044693 Bacteria 1545
262 Ga0453684_0000413 3300044712 Bacteria 174924
263 Ga0453684_0002807 3300044712 Bacteria 41156
264 Ga0453684_0012498 3300044712 Bacteria 13983
265 Ga0453684_0027807 3300044712 Bacteria 8094
266 Ga0453684_0198942 3300044712 Bacteria 2337
267 Ga0453684_0784483 3300044712 Bacteria 1029
268 Ga0466968_0047351 3300044735 Bacteria 1828
269 Ga0466968_0269237 3300044735 Bacteria 813
270 Ga0466970_0009840 3300044765 Bacteria 4842
271 Ga0466959_0279231 3300045049 Bacteria 1147
272 Ga0451576_0000003 3300045051 Bacteria 1550573
273 Ga0451576_0030427 3300045051 Bacteria 5770
274 Ga0451576_1792466 3300045051 Unclassified 635
275 Ga0495583_0204454 3300046506 Bacteria 801
276 Ga0495663_0139917 3300046525 Bacteria 821
277 Ga0495667_0371360 3300046559 Bacteria 903
278 Ga0495625_0068664 3300046660 Bacteria 2491
279 Ga0495670_0070410 3300046691 Bacteria 1770
280 Ga0495604_0269520 3300047317 Bacteria 1154
281 Ga0495636_0238073 3300047318 Bacteria 839
282 Ga0495672_0284895 3300047320 Bacteria 788
283 Ga0495684_0153472 3300047471 Bacteria 1721
284 Ga0495686_0034775 3300047472 Bacteria 3242
285 Ga0496102_0590881 3300048905 Bacteria 1033
286 Ga0496103_0058547 3300048906 Bacteria 2394
287 Ga0496115_1009044 3300048918 Bacteria 636
288 Ga0496116_0091803 3300048919 Bacteria 1844
289 Ga0496117_0088035 3300048920 Bacteria 2010
290 Ga0496121_0086162 3300048924 Bacteria 2469
291 Ga0496126_0035497 3300048929 Bacteria 4673
292 Ga0496126_0102727 3300048929 Bacteria 2499
293 Ga0501306_017228 3300049127 Bacteria 978
294 Ga0501306_025702 3300049127 Bacteria 849
295 Ga0501308_004229 3300049128 Bacteria 1375
296 Ga0501308_020268 3300049128 Bacteria 827
297 Ga0501308_020720 3300049128 Bacteria 821
298 Ga0501309_064569 3300049129 Bacteria 594
299 Ga0501310_021854 3300049130 Bacteria 803
300 Ga0501310_072467 3300049130 Bacteria 530
301 Ga0501310_081363 3300049130 Bacteria 509
302 Ga0501343_005351 3300049132 Bacteria 982
303 Ga0501343_021492 3300049132 Bacteria 571
304 Ga0501305_005628 3300049161 Bacteria 1527
305 Ga0501307_020560 3300049162 Bacteria 855
306 Ga0501307_029054 3300049162 Bacteria 759
307 Ga0501311_068078 3300049527 Bacteria 586
308 Ga0501312_002580 3300049528 Bacteria 1968
309 Ga0501312_043055 3300049528 Bacteria 743
310 Ga0501312_087058 3300049528 Bacteria 572
311 Ga0501312_098692 3300049528 Bacteria 546
312 Ga0501313_027750 3300049529 Bacteria 724
313 Ga0501314_000038 3300049530 Bacteria 5733
314 Ga0501315_003355 3300049531 Bacteria 1595
315 Ga0501315_017264 3300049531 Bacteria 942
316 Ga0501315_020857 3300049531 Bacteria 883
317 Ga0501315_077348 3300049531 Bacteria 560
318 Ga0501315_084386 3300049531 Bacteria 543
319 Ga0501317_004692 3300049533 Bacteria 1434
320 Ga0501317_098162 3300049533 Bacteria 526
321 Ga0501320_001839 3300049536 Bacteria 1618
322 Ga0501320_003002 3300049536 Bacteria 1398
323 Ga0501320_018033 3300049536 Bacteria 794
324 Ga0501320_018336 3300049536 Bacteria 790
325 Ga0501321_047434 3300049537 Bacteria 620
326 Ga0501323_018933 3300049539 Bacteria 894
327 Ga0501324_000812 3300049540 Bacteria 1882
328 Ga0501325_031005 3300049541 Bacteria 612
329 Ga0501326_04901 3300049542 Bacteria 719
330 Ga0501327_03811 3300049543 Bacteria 843
331 Ga0501329_02901 3300049545 Bacteria 848
332 Ga0501330_008560 3300049546 Bacteria 703
333 Ga0501331_11512 3300049547 Bacteria 559
334 Ga0501334_07180 3300049550 Bacteria 764
335 Ga0501335_005181 3300049551 Bacteria 1159
336 Ga0501335_015036 3300049551 Bacteria 786
337 Ga0501335_048704 3300049551 Bacteria 513
338 Ga0501337_008454 3300049553 Bacteria 731
339 Ga0501337_019466 3300049553 Bacteria 546
340 Ga0501338_06283 3300049554 Bacteria 749
341 Ga0501340_000481 3300049556 Bacteria 1772
342 Ga0501340_019144 3300049556 Bacteria 564
343 Ga0501033_0729587 3300049570 Bacteria 673
344 Ga0501034_0105341 3300049571 Bacteria 2813
345 Ga0501037_0105203 3300049573 Bacteria 2034
346 Ga0501037_0156384 3300049573 Bacteria 1627
347 Ga0501038_0388677 3300049574 Unclassified 1081
348 Ga0501039_0276971 3300049575 Bacteria 1319
349 Ga0501040_0408170 3300049576 Bacteria 976
350 Ga0501042_0165306 3300049578 Bacteria 1597
351 Ga0501047_0005869 3300049581 Bacteria 11555
352 Ga0501047_0074504 3300049581 Bacteria 3268
353 Ga0501047_0303224 3300049581 Bacteria 1439
354 Ga0501048_0975460 3300049582 Bacteria 610
355 Ga0501072_0793055 3300049588 Bacteria 742
356 Ga0501074_0139117 3300049590 Bacteria 1737
357 Ga0501075_0172789 3300049591 Bacteria 1649
358 Ga0501075_0787114 3300049591 Bacteria 724
359 Ga0501075_0849564 3300049591 Bacteria 694
360 Ga0501076_0193157 3300049592 Bacteria 1662
361 Ga0501076_0429359 3300049592 Bacteria 1087
362 Ga0501207_078071 3300049654 Bacteria 633
363 Ga0501217_010354 3300049661 Bacteria 2041
364 Ga0501223_067476 3300049663 Bacteria 704
365 Ga0501245_148433 3300049708 Bacteria 516
366 Ga0501080_0187759 3300049742 Bacteria 1900
367 Ga0501081_0269524 3300049743 Bacteria 1245
368 Ga0501083_0956854 3300049744 Bacteria 557
369 Ga0501266_051713 3300049763 Bacteria 637
370 Ga0501269_026196 3300049766 Bacteria 736
371 Ga0501035_0048381 3300049822 Bacteria 3814
372 Ga0501035_0212145 3300049822 Bacteria 1656
373 Ga0501044_0008030 3300049823 Bacteria 11594
374 Ga0501044_0037946 3300049823 Bacteria 5034
375 nmdc:mga0k408_4220_c1 3300050493 Bacteria 7623
376 nmdc:mga0k408_434950_c1 3300050493 Bacteria 780
377 nmdc:mga06z11_888712_c1 3300050494 Unclassified 543
378 nmdc:mga07m45_44230_c1 3300050496 Bacteria 874
379 nmdc:mga07m45_671679_c1 3300050496 Bacteria 597
380 nmdc:mga05p37_80072_c1 3300050507 Bacteria 4023
381 nmdc:mga09592_197231_c1 3300050508 Bacteria 1743
382 nmdc:mga09592_439617_c1 3300050508 Bacteria 1126
383 nmdc:mga0qj67_712714_c1 3300050509 Unclassified 798
384 nmdc:mga0qj67_873297_c1 3300050509 Bacteria 710
385 nmdc:mga06r32_903963_c1 3300050510 Bacteria 839
386 nmdc:mga06r32_954572_c1 3300050510 Bacteria 812
387 nmdc:mga0n895_419548_c1 3300050512 Bacteria 1353
388 nmdc:mga0rr50_141842_c1 3300050513 Bacteria 1934
389 nmdc:mga0a205_464881_c1 3300050515 Bacteria 1124
390 nmdc:mga0a205_608441_c1 3300050515 Bacteria 946
391 nmdc:mga0a205_674830_c1 3300050515 Bacteria 884
392 Ga0500635_0004581 3300053080 Bacteria 3570
393 Ga0500566_0303741 3300053094 Bacteria 750
394 Ga0500554_114417 3300053102 Bacteria 908
395 Ga0500595_014280 3300053119 Bacteria 3018
396 Ga0500559_0103194 3300053136 Bacteria 1316
397 Ga0500564_131549 3300053138 Bacteria 1082
398 Ga0500616_0235892 3300053153 Bacteria 789
399 Ga0500619_087325 3300053154 Bacteria 1052
400 Ga0500622_0000385 3300053156 Bacteria 42685
401 Ga0500627_0310574 3300053158 Bacteria 687
402 Ga0500645_019570 3300053730 Bacteria 2105
403 Ga0500645_077780 3300053730 Bacteria 948
404 Ga0501084_1875507 3300054114 Bacteria 500
405 Ga0500661_027542 3300055283 Bacteria 1004
406 Ga0587084_017616 3300059477 Bacteria 1033
407 Ga0587084_095626 3300059477 Bacteria 595
408 Ga0587070_030135 3300059491 Bacteria 978
409 Ga0587077_003683 3300059493 Bacteria 1950
410 Ga0587077_007978 3300059493 Bacteria 1561
411 Ga0587077_038531 3300059493 Bacteria 948
412 Ga0587077_083713 3300059493 Bacteria 737
413 Ga0587077_091444 3300059493 Bacteria 716
414 Ga0587082_021755 3300059504 Bacteria 1050
415 Ga0587085_019714 3300059506 Bacteria 1013
416 Ga0587085_115200 3300059506 Bacteria 584
417 Ga0587086_003002 3300059507 Bacteria 1660
418 Ga0587090_002489 3300059510 Bacteria 2038
419 Ga0587090_008083 3300059510 Bacteria 1401
420 Ga0587090_019444 3300059510 Bacteria 1048
421 Ga0587090_164008 3300059510 Bacteria 511
422 Ga0587091_015081 3300059511 Bacteria 1270
423 Ga0587091_018706 3300059511 Bacteria 1182
424 Ga0587091_058986 3300059511 Bacteria 810
425 Ga0587091_087856 3300059511 Bacteria 709
426 Ga0587092_004898 3300059512 Bacteria 1622
427 Ga0587092_040529 3300059512 Bacteria 809
428 Ga0587125_023139 3300059607 Bacteria 748
429 Ga0587101_012643 3300059623 Bacteria 1100
430 Ga0587101_053390 3300059623 Bacteria 702
431 Ga0587109_003270 3300059624 Bacteria 2146
432 Ga0587109_004974 3300059624 Bacteria 1879
433 Ga0587117_000700 3300059627 Bacteria 2456
434 Ga0587117_020062 3300059627 Bacteria 924
435 Ga0587128_042644 3300059630 Bacteria 800
436 Ga0587128_086715 3300059630 Bacteria 636
437 Ga0587128_153326 3300059630 Bacteria 526
438 Ga0587062_000275 3300059639 Bacteria 3263
439 Ga0587062_004253 3300059639 Bacteria 1509
440 Ga0587062_014690 3300059639 Bacteria 1037
441 Ga0587062_043843 3300059639 Bacteria 735
442 Ga0587062_136919 3300059639 Bacteria 508
443 Ga0587068_000623 3300059641 Bacteria 3402
444 Ga0587068_011433 3300059641 Bacteria 1340
445 Ga0587068_016722 3300059641 Bacteria 1166
446 Ga0587068_023231 3300059641 Bacteria 1031
447 Ga0587076_008986 3300059645 Bacteria 1409
448 Ga0587076_054617 3300059645 Bacteria 789
449 Ga0587100_045287 3300059648 Bacteria 506
450 Ga0587107_015937 3300059652 Bacteria 987
451 Ga0587107_105427 3300059652 Bacteria 563
452 Ga0587108_004347 3300059653 Bacteria 1034
453 Ga0587108_004541 3300059653 Bacteria 1020
454 Ga0587124_005157 3300059660 Bacteria 1034
455 Ga0587124_010738 3300059660 Bacteria 821
456 Ga0587061_08754 3300060244 Bacteria 521
457 Ga0587081_03105 3300060246 Bacteria 1034
458 Ga0587111_0005171 3300060346 Bacteria 1991
459 Ga0587111_0005360 3300060346 Bacteria 1972
460 Ga0587111_0010170 3300060346 Bacteria 1608
461 Ga0501082_0240326 3300060353 Bacteria 1576
462 Ga0501082_0265415 3300060353 Bacteria 1494
463 Ga0501082_0534043 3300060353 Bacteria 1026
464 Ga0501082_1539284 3300060353 Bacteria 581
465 Ga0530510_0924741 3300061734 Bacteria 667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0138171 Ga0316574_0138171_227_490 84
2 3300036647 Ga0316582_0338819 Ga0316582_0338819_122_385 84
3 iso_pu_bacteria 2522125168 2522549416 84
4 iso_pu_bacteria 2894510363 2894510849 84
5 iso_pu_bacteria 2919692658 2919697456 84
6 3300006175 Ga0070712_100565079 Ga0070712_1005650792 87
7 3300009093 Ga0105240_10048322 Ga0105240_100483226 87
8 3300025913 Ga0207695_10359162 Ga0207695_103591622 87
9 3300025915 Ga0207693_10769761 Ga0207693_107697612 87
10 3300026035 Ga0207703_11591459 Ga0207703_115914592 87
11 3300031911 Ga0307412_11462645 Ga0307412_114626451 87
12 3300032005 Ga0307411_11187883 Ga0307411_111878832 87
13 3300035171 Ga0373946_0218365 Ga0373946_0218365_307_594 87
14 3300035695 Ga0373927_0000001 Ga0373927_0000001_680724_681011 87
15 3300037466 Ga0395898_0290360 Ga0395898_0290360_1005_1268 87
16 3300039453 Ga0436362_0192697 Ga0436362_0192697_968_1237 87
17 3300046559 Ga0495667_0371360 Ga0495667_0371360_295_582 87
18 3300047317 Ga0495604_0269520 Ga0495604_0269520_208_495 87
19 3300048919 Ga0496116_0091803 Ga0496116_0091803_1075_1338 87
20 3300048920 Ga0496117_0088035 Ga0496117_0088035_494_757 87
21 3300048924 Ga0496121_0086162 Ga0496121_0086162_1112_1375 87
22 3300048929 Ga0496126_0035497 Ga0496126_0035497_1752_2015 87
23 3300049162 Ga0501307_029054 Ga0501307_029054_454_726 87
24 3300049571 Ga0501034_0105341 Ga0501034_0105341_1472_1735 87
25 3300049573 Ga0501037_0105203 Ga0501037_0105203_945_1211 87
26 3300049573 Ga0501037_0156384 Ga0501037_0156384_1079_1351 87
27 3300049574 Ga0501038_0388677 Ga0501038_0388677_787_1053 87
28 3300049575 Ga0501039_0276971 Ga0501039_0276971_737_1003 87
29 3300049822 Ga0501035_0212145 Ga0501035_0212145_1175_1447 87
30 3300049823 Ga0501044_0037946 Ga0501044_0037946_1056_1322 87
31 3300053153 Ga0500616_0235892 Ga0500616_0235892_514_777 87
32 3300059512 Ga0587092_040529 Ga0587092_040529_232_495 87
33 3300059627 Ga0587117_020062 Ga0587117_020062_449_712 87
34 3300059639 Ga0587062_043843 Ga0587062_043843_87_350 87
35 3300001904 JGI24736J21556_1037201 JGI24736J21556_10372011 88
36 3300001989 JGI24739J22299_10248889 JGI24739J22299_102488892 88
37 3300001990 JGI24737J22298_10001191 JGI24737J22298_100011913 88
38 3300002067 JGI24735J21928_10001634 JGI24735J21928_100016344 88
39 3300002741 JGI25157J39369_1012503 JGI25157J39369_10125032 88
40 3300002741 JGI25157J39369_1036779 JGI25157J39369_10367791 88
41 3300003214 JGI25165J46597_1030395 JGI25165J46597_10303952 88
42 3300003322 rootL2_10134610 rootL2_101346105 88
43 3300003323 rootH1_10116742 rootH1_101167422 88
44 3300003781 Ga0055536_1006040 Ga0055536_10060406 88
45 3300004625 Ga0055543_1023698 Ga0055543_10236982 88
46 3300004799 Ga0058863_11894467 Ga0058863_118944672 88
47 3300004801 Ga0058860_11979646 Ga0058860_119796462 88
48 3300004803 Ga0058862_11525955 Ga0058862_115259552 88
49 3300004803 Ga0058862_12680365 Ga0058862_126803651 88
50 3300004803 Ga0058862_12740678 Ga0058862_127406782 88
51 3300005262 Ga0065165_1000131 Ga0065165_100013144 88
52 3300005289 Ga0065704_10014908 Ga0065704_100149082 88
53 3300005289 Ga0065704_10422899 Ga0065704_104228992 88
54 3300005289 Ga0065704_10426557 Ga0065704_104265572 88
55 3300005295 Ga0065707_10068828 Ga0065707_100688281 88
56 3300005295 Ga0065707_10484260 Ga0065707_104842602 88
57 3300005327 Ga0070658_10000153 Ga0070658_1000015334 88
58 3300005328 Ga0070676_10520477 Ga0070676_105204772 88
59 3300005339 Ga0070660_100007068 Ga0070660_1000070683 88
60 3300005347 Ga0070668_101518162 Ga0070668_1015181622 88
61 3300005347 Ga0070668_102172490 Ga0070668_1021724902 88
62 3300005354 Ga0070675_101428503 Ga0070675_1014285031 88
63 3300005355 Ga0070671_100794976 Ga0070671_1007949762 88
64 3300005365 Ga0070688_100302945 Ga0070688_1003029452 88
65 3300005366 Ga0070659_100008718 Ga0070659_1000087185 88
66 3300005367 Ga0070667_101665396 Ga0070667_1016653961 88
67 3300005459 Ga0068867_101388288 Ga0068867_1013882882 88
68 3300005467 Ga0070706_100497050 Ga0070706_1004970501 88
69 3300005530 Ga0070679_100510731 Ga0070679_1005107312 88
70 3300005539 Ga0068853_100081417 Ga0068853_1000814175 88
71 3300005544 Ga0070686_101728309 Ga0070686_1017283092 88
72 3300005545 Ga0070695_100226104 Ga0070695_1002261043 88
73 3300005546 Ga0070696_100162632 Ga0070696_1001626321 88
74 3300005549 Ga0070704_100433128 Ga0070704_1004331282 88
75 3300005563 Ga0068855_100044845 Ga0068855_1000448453 88
76 3300005563 Ga0068855_100824591 Ga0068855_1008245913 88
77 3300005577 Ga0068857_100038490 Ga0068857_10003849010 88
78 3300005577 Ga0068857_101087483 Ga0068857_1010874832 88
79 3300005578 Ga0068854_100068418 Ga0068854_1000684182 88
80 3300005578 Ga0068854_101837642 Ga0068854_1018376422 88
81 3300005616 Ga0068852_101353931 Ga0068852_1013539312 88
82 3300005617 Ga0068859_100352672 Ga0068859_1003526723 88
83 3300005719 Ga0068861_100585687 Ga0068861_1005856873 88
84 3300005840 Ga0068870_10479651 Ga0068870_104796513 88
85 3300005842 Ga0068858_100779401 Ga0068858_1007794012 88
86 3300005842 Ga0068858_101707600 Ga0068858_1017076001 88
87 3300005843 Ga0068860_100326634 Ga0068860_1003266343 88
88 3300006173 Ga0070716_100178428 Ga0070716_1001784282 88
89 3300006177 Ga0075362_10412817 Ga0075362_104128171 88
90 3300006195 Ga0075366_10000288 Ga0075366_1000028835 88
91 3300006195 Ga0075366_10077240 Ga0075366_100772403 88
92 3300006195 Ga0075366_10106699 Ga0075366_101066992 88
93 3300006353 Ga0075370_10063124 Ga0075370_100631242 88
94 3300006353 Ga0075370_10450086 Ga0075370_104500862 88
95 3300006353 Ga0075370_10471947 Ga0075370_104719472 88
96 3300006844 Ga0075428_100003062 Ga0075428_10000306224 88
97 3300006844 Ga0075428_100272873 Ga0075428_1002728732 88
98 3300006844 Ga0075428_100335530 Ga0075428_1003355302 88
99 3300006846 Ga0075430_100455491 Ga0075430_1004554912 88
100 3300006846 Ga0075430_100666777 Ga0075430_1006667772 88
101 3300006847 Ga0075431_100256533 Ga0075431_1002565333 88
102 3300006847 Ga0075431_100904296 Ga0075431_1009042962 88
103 3300006847 Ga0075431_101697136 Ga0075431_1016971362 88
104 3300006852 Ga0075433_11344379 Ga0075433_113443792 88
105 3300006880 Ga0075429_100317476 Ga0075429_1003174762 88
106 3300006880 Ga0075429_100392049 Ga0075429_1003920492 88
107 3300006881 Ga0068865_101650585 Ga0068865_1016505852 88
108 3300006931 Ga0097620_100352668 Ga0097620_1003526683 88
109 3300007265 Ga0099794_10469421 Ga0099794_104694211 88
110 3300009093 Ga0105240_10041987 Ga0105240_1004198710 88
111 3300009093 Ga0105240_10404513 Ga0105240_104045131 88
112 3300009093 Ga0105240_10661368 Ga0105240_106613682 88
113 3300009101 Ga0105247_10743125 Ga0105247_107431252 88
114 3300009147 Ga0114129_10134996 Ga0114129_101349965 88
115 3300009147 Ga0114129_10421592 Ga0114129_104215923 88
116 3300009174 Ga0105241_10009907 Ga0105241_1000990713 88
117 3300009174 Ga0105241_10703499 Ga0105241_107034991 88
118 3300009177 Ga0105248_12476230 Ga0105248_124762302 88
119 3300009545 Ga0105237_10035876 Ga0105237_100358763 88
120 3300009545 Ga0105237_11818087 Ga0105237_118180872 88
121 3300009551 Ga0105238_10248125 Ga0105238_102481253 88
122 3300009551 Ga0105238_12366008 Ga0105238_123660081 88
123 3300009553 Ga0105249_12380731 Ga0105249_123807312 88
124 3300010375 Ga0105239_10000011 Ga0105239_10000011133 88
125 3300010375 Ga0105239_10122693 Ga0105239_101226932 88
126 3300010375 Ga0105239_11570583 Ga0105239_115705832 88
127 3300010375 Ga0105239_11640035 Ga0105239_116400352 88
128 3300012513 Ga0157326_1016658 Ga0157326_10166582 88
129 3300013102 Ga0157371_10001664 Ga0157371_1000166431 88
130 3300013102 Ga0157371_11424422 Ga0157371_114244222 88
131 3300013102 Ga0157371_11587625 Ga0157371_115876252 88
132 3300013104 Ga0157370_10047165 Ga0157370_100471656 88
133 3300013104 Ga0157370_11599843 Ga0157370_115998431 88
134 3300013105 Ga0157369_10007412 Ga0157369_1000741210 88
135 3300013296 Ga0157374_10173144 Ga0157374_101731441 88
136 3300013296 Ga0157374_10609812 Ga0157374_106098122 88
137 3300013297 Ga0157378_10058863 Ga0157378_100588633 88
138 3300013306 Ga0163162_10379084 Ga0163162_103790843 88
139 3300013307 Ga0157372_10064662 Ga0157372_100646625 88
140 3300013307 Ga0157372_10269915 Ga0157372_102699153 88
141 3300013308 Ga0157375_13077954 Ga0157375_130779541 88
142 3300020070 Ga0206356_10239140 Ga0206356_102391402 88
143 3300020070 Ga0206356_11003395 Ga0206356_110033953 88
144 3300020075 Ga0206349_1204727 Ga0206349_12047272 88
145 3300020076 Ga0206355_1259448 Ga0206355_12594482 88
146 3300020077 Ga0206351_10512829 Ga0206351_1051282924 88
147 3300020078 Ga0206352_10935446 Ga0206352_109354462 88
148 3300020080 Ga0206350_10752456 Ga0206350_107524565 88
149 3300020080 Ga0206350_11611523 Ga0206350_116115232 88
150 3300020081 Ga0206354_11306986 Ga0206354_113069862 88
151 3300020082 Ga0206353_10607448 Ga0206353_106074482 88
152 3300020610 Ga0154015_1037437 Ga0154015_103743724 88
153 3300022467 Ga0224712_10003182 Ga0224712_100031823 88
154 3300022467 Ga0224712_10003582 Ga0224712_100035825 88
155 3300025250 Ga0209026_1003238 Ga0209026_100323811 88
156 3300025250 Ga0209026_1004981 Ga0209026_10049815 88
157 3300025254 Ga0209148_1024264 Ga0209148_10242642 88
158 3300025261 Ga0209233_1001329 Ga0209233_100132913 88
159 3300025261 Ga0209233_1003581 Ga0209233_100358112 88
160 3300025272 Ga0209455_1013843 Ga0209455_10138433 88
161 3300025292 Ga0209676_1000332 Ga0209676_100033238 88
162 3300025298 Ga0209050_1038388 Ga0209050_10383882 88
163 3300025904 Ga0207647_10000171 Ga0207647_1000017117 88
164 3300025909 Ga0207705_10000108 Ga0207705_1000010878 88
165 3300025910 Ga0207684_10086390 Ga0207684_100863905 88
166 3300025910 Ga0207684_10402324 Ga0207684_104023243 88
167 3300025911 Ga0207654_10014217 Ga0207654_100142179 88
168 3300025911 Ga0207654_10319167 Ga0207654_103191672 88
169 3300025911 Ga0207654_10534306 Ga0207654_105343063 88
170 3300025913 Ga0207695_10000053 Ga0207695_10000053360 88
171 3300025913 Ga0207695_10081967 Ga0207695_100819671 88
172 3300025913 Ga0207695_10275711 Ga0207695_102757112 88
173 3300025914 Ga0207671_10201010 Ga0207671_102010102 88
174 3300025914 Ga0207671_10998199 Ga0207671_109981992 88
175 3300025917 Ga0207660_10617026 Ga0207660_106170261 88
176 3300025919 Ga0207657_10105386 Ga0207657_101053864 88
177 3300025924 Ga0207694_10154790 Ga0207694_101547903 88
178 3300025932 Ga0207690_10012751 Ga0207690_100127517 88
179 3300025939 Ga0207665_10510152 Ga0207665_105101522 88
180 3300025939 Ga0207665_10794563 Ga0207665_107945632 88
181 3300025949 Ga0207667_10095966 Ga0207667_100959663 88
182 3300025949 Ga0207667_10542459 Ga0207667_105424592 88
183 3300025972 Ga0207668_10649041 Ga0207668_106490412 88
184 3300025981 Ga0207640_10025047 Ga0207640_100250473 88
185 3300026041 Ga0207639_10039149 Ga0207639_100391492 88
186 3300026041 Ga0207639_11155537 Ga0207639_111555372 88
187 3300026116 Ga0207674_10016950 Ga0207674_1001695017 88
188 3300026116 Ga0207674_11354077 Ga0207674_113540771 88
189 3300026116 Ga0207674_11457746 Ga0207674_114577462 88
190 3300026118 Ga0207675_100337424 Ga0207675_1003374242 88
191 3300026142 Ga0207698_10884310 Ga0207698_108843102 88
192 3300027543 Ga0209999_1007217 Ga0209999_10072172 88
193 3300028380 Ga0268265_11817992 Ga0268265_118179922 88
194 3300028381 Ga0268264_10053452 Ga0268264_100534523 88
195 3300028381 Ga0268264_11226521 Ga0268264_112265212 88
196 3300028558 Ga0265326_10062435 Ga0265326_100624352 88
197 3300028573 Ga0265334_10000272 Ga0265334_1000027236 88
198 3300028573 Ga0265334_10002690 Ga0265334_100026902 88
199 3300028577 Ga0265318_10040734 Ga0265318_100407344 88
200 3300028800 Ga0265338_10000135 Ga0265338_1000013543 88
201 3300028800 Ga0265338_10283863 Ga0265338_102838633 88
202 3300029957 Ga0265324_10000247 Ga0265324_1000024739 88
203 3300030731 Ga0316177_1219406 Ga0316177_12194062 88
204 3300030733 Ga0314311_1002819 Ga0314311_10028192 88
205 3300030734 Ga0316179_1011335 Ga0316179_10113351 88
206 3300030736 Ga0316180_1144171 Ga0316180_11441712 88
207 3300031239 Ga0265328_10026643 Ga0265328_100266433 88
208 3300031249 Ga0265339_10275706 Ga0265339_102757062 88
209 3300031250 Ga0265331_10024674 Ga0265331_100246746 88
210 3300031250 Ga0265331_10233349 Ga0265331_102333492 88
211 3300031251 Ga0265327_10001935 Ga0265327_100019357 88
212 3300031251 Ga0265327_10059376 Ga0265327_100593764 88
213 3300031251 Ga0265327_10074641 Ga0265327_100746412 88
214 3300031344 Ga0265316_10557917 Ga0265316_105579172 88
215 3300031548 Ga0307408_100013046 Ga0307408_1000130466 88
216 3300031548 Ga0307408_100484555 Ga0307408_1004845552 88
217 3300031548 Ga0307408_100614704 Ga0307408_1006147042 88
218 3300031711 Ga0265314_10065968 Ga0265314_100659682 88
219 3300031712 Ga0265342_10256852 Ga0265342_102568522 88
220 3300031712 Ga0265342_10444788 Ga0265342_104447881 88
221 3300031727 Ga0316576_10763277 Ga0316576_107632772 88
222 3300031727 Ga0316576_11350953 Ga0316576_113509531 88
223 3300031731 Ga0307405_10051278 Ga0307405_100512783 88
224 3300031731 Ga0307405_10462418 Ga0307405_104624182 88
225 3300031824 Ga0307413_10081458 Ga0307413_100814584 88
226 3300031824 Ga0307413_10393442 Ga0307413_103934422 88
227 3300031824 Ga0307413_10543971 Ga0307413_105439712 88
228 3300031852 Ga0307410_10003030 Ga0307410_100030303 88
229 3300031852 Ga0307410_10159428 Ga0307410_101594283 88
230 3300031901 Ga0307406_10143289 Ga0307406_101432893 88
231 3300031901 Ga0307406_10427406 Ga0307406_104274063 88
232 3300031903 Ga0307407_10781539 Ga0307407_107815392 88
233 3300031911 Ga0307412_10006208 Ga0307412_1000620814 88
234 3300031911 Ga0307412_10031955 Ga0307412_100319555 88
235 3300031911 Ga0307412_10310506 Ga0307412_103105062 88
236 3300031911 Ga0307412_11079551 Ga0307412_110795512 88
237 3300031995 Ga0307409_100004529 Ga0307409_10000452915 88
238 3300032002 Ga0307416_100137679 Ga0307416_1001376792 88
239 3300032002 Ga0307416_100213871 Ga0307416_1002138714 88
240 3300032004 Ga0307414_10000927 Ga0307414_100009273 88
241 3300032004 Ga0307414_10011719 Ga0307414_1001171912 88
242 3300032004 Ga0307414_10014563 Ga0307414_100145632 88
243 3300032004 Ga0307414_10028964 Ga0307414_100289649 88
244 3300032004 Ga0307414_10168902 Ga0307414_101689023 88
245 3300032004 Ga0307414_10591101 Ga0307414_105911012 88
246 3300032004 Ga0307414_11504083 Ga0307414_115040831 88
247 3300032004 Ga0307414_11741533 Ga0307414_117415332 88
248 3300032005 Ga0307411_10008827 Ga0307411_1000882711 88
249 3300032005 Ga0307411_10047021 Ga0307411_100470213 88
250 3300032126 Ga0307415_100353293 Ga0307415_1003532933 88
251 3300032168 Ga0316593_10050622 Ga0316593_100506221 88
252 3300032168 Ga0316593_10162840 Ga0316593_101628402 88
253 3300033524 Ga0316592_1000011 Ga0316592_100001117 88
254 3300033541 Ga0316596_1006644 Ga0316596_10066444 88
255 3300033541 Ga0316596_1007465 Ga0316596_10074651 88
256 3300036401 Ga0373937_1126740 Ga0373937_1126740_186_467 88
257 3300037312 Ga0395899_0000034 Ga0395899_0000034_22233_22499 88
258 3300037312 Ga0395899_0105310 Ga0395899_0105310_910_1206 88
259 3300037418 Ga0395900_0201560 Ga0395900_0201560_566_862 88
260 3300037418 Ga0395900_1133326 Ga0395900_1133326_42_308 88
261 3300037466 Ga0395898_0257000 Ga0395898_0257000_1376_1642 88
262 3300038443 Ga0395901_0018865 Ga0395901_0018865_519_788 88
263 3300041404 Ga0439436_0053857 Ga0439436_0053857_217_483 88
264 3300041413 Ga0439465_0419119 Ga0439465_0419119_18_296 88
265 3300041443 Ga0451789_0610099 Ga0451789_0610099_232_498 88
266 3300041444 Ga0451790_21411 Ga0451790_21411_168_434 88
267 3300041463 Ga0451804_0336010 Ga0451804_0336010_35_301 88
268 3300041486 Ga0451807_1039411 Ga0451807_1039411_51_317 88
269 3300041494 Ga0451837_0432158 Ga0451837_0432158_1022_1300 88
270 3300041512 Ga0451853_2989796 Ga0451853_2989796_226_492 88
271 3300041907 Ga0452268_28166 Ga0452268_28166_95_361 88
272 3300042007 Ga0439449_0083278 Ga0439449_0083278_615_893 88
273 3300042014 Ga0439457_004245 Ga0439457_004245_2990_3256 88
274 3300042015 Ga0439462_0128235 Ga0439462_0128235_369_635 88
275 3300042127 Ga0450890_012599 Ga0450890_012599_336_614 88
276 3300042436 Ga0439435_0077741 Ga0439435_0077741_123_437 88
277 3300042532 Ga0450893_0145855 Ga0450893_0145855_162_479 88
278 3300042876 Ga0451577_0000210 Ga0451577_0000210_118551_118823 88
279 3300042876 Ga0451577_0004463 Ga0451577_0004463_6397_6675 88
280 3300042876 Ga0451577_0030002 Ga0451577_0030002_556_828 88
281 3300044658 Ga0466972_0022564 Ga0466972_0022564_1406_1711 88
282 3300044693 Ga0466961_0135164 Ga0466961_0135164_660_965 88
283 3300044712 Ga0453684_0000413 Ga0453684_0000413_82972_83250 88
284 3300044712 Ga0453684_0002807 Ga0453684_0002807_39918_40190 88
285 3300044712 Ga0453684_0012498 Ga0453684_0012498_10540_10815 88
286 3300044712 Ga0453684_0027807 Ga0453684_0027807_718_990 88
287 3300044712 Ga0453684_0198942 Ga0453684_0198942_1631_1948 88
288 3300044712 Ga0453684_0784483 Ga0453684_0784483_714_989 88
289 3300044735 Ga0466968_0047351 Ga0466968_0047351_235_540 88
290 3300044735 Ga0466968_0269237 Ga0466968_0269237_358_624 88
291 3300044765 Ga0466970_0009840 Ga0466970_0009840_2969_3274 88
292 3300045049 Ga0466959_0279231 Ga0466959_0279231_68_334 88
293 3300045051 Ga0451576_0000003 Ga0451576_0000003_957674_957961 88
294 3300045051 Ga0451576_0030427 Ga0451576_0030427_4056_4334 88
295 3300045051 Ga0451576_1792466 Ga0451576_1792466_91_372 88
296 3300046506 Ga0495583_0204454 Ga0495583_0204454_119_385 88
297 3300046525 Ga0495663_0139917 Ga0495663_0139917_320_598 88
298 3300046660 Ga0495625_0068664 Ga0495625_0068664_2056_2322 88
299 3300046691 Ga0495670_0070410 Ga0495670_0070410_958_1236 88
300 3300047318 Ga0495636_0238073 Ga0495636_0238073_133_453 88
301 3300047320 Ga0495672_0284895 Ga0495672_0284895_468_743 88
302 3300047471 Ga0495684_0153472 Ga0495684_0153472_529_810 88
303 3300047472 Ga0495686_0034775 Ga0495686_0034775_2489_2755 88
304 3300048905 Ga0496102_0590881 Ga0496102_0590881_315_593 88
305 3300048906 Ga0496103_0058547 Ga0496103_0058547_592_870 88
306 3300048918 Ga0496115_1009044 Ga0496115_1009044_50_316 88
307 3300048929 Ga0496126_0102727 Ga0496126_0102727_1589_1864 88
308 3300049127 Ga0501306_017228 Ga0501306_017228_603_881 88
309 3300049127 Ga0501306_025702 Ga0501306_025702_125_403 88
310 3300049128 Ga0501308_004229 Ga0501308_004229_95_361 88
311 3300049128 Ga0501308_020268 Ga0501308_020268_101_379 88
312 3300049128 Ga0501308_020720 Ga0501308_020720_123_401 88
313 3300049129 Ga0501309_064569 Ga0501309_064569_197_475 88
314 3300049130 Ga0501310_021854 Ga0501310_021854_103_381 88
315 3300049130 Ga0501310_072467 Ga0501310_072467_123_401 88
316 3300049130 Ga0501310_081363 Ga0501310_081363_174_452 88
317 3300049132 Ga0501343_005351 Ga0501343_005351_105_383 88
318 3300049132 Ga0501343_021492 Ga0501343_021492_263_538 88
319 3300049161 Ga0501305_005628 Ga0501305_005628_168_446 88
320 3300049162 Ga0501307_020560 Ga0501307_020560_124_402 88
321 3300049527 Ga0501311_068078 Ga0501311_068078_287_565 88
322 3300049528 Ga0501312_002580 Ga0501312_002580_1572_1850 88
323 3300049528 Ga0501312_043055 Ga0501312_043055_437_721 88
324 3300049528 Ga0501312_087058 Ga0501312_087058_118_396 88
325 3300049528 Ga0501312_098692 Ga0501312_098692_62_331 88
326 3300049529 Ga0501313_027750 Ga0501313_027750_324_602 88
327 3300049530 Ga0501314_000038 Ga0501314_000038_4975_5253 88
328 3300049531 Ga0501315_003355 Ga0501315_003355_1166_1444 88
329 3300049531 Ga0501315_017264 Ga0501315_017264_35_301 88
330 3300049531 Ga0501315_020857 Ga0501315_020857_482_760 88
331 3300049531 Ga0501315_077348 Ga0501315_077348_117_383 88
332 3300049531 Ga0501315_084386 Ga0501315_084386_181_459 88
333 3300049533 Ga0501317_004692 Ga0501317_004692_999_1277 88
334 3300049533 Ga0501317_098162 Ga0501317_098162_128_406 88
335 3300049536 Ga0501320_001839 Ga0501320_001839_104_382 88
336 3300049536 Ga0501320_003002 Ga0501320_003002_969_1247 88
337 3300049536 Ga0501320_018033 Ga0501320_018033_407_685 88
338 3300049536 Ga0501320_018336 Ga0501320_018336_95_373 88
339 3300049537 Ga0501321_047434 Ga0501321_047434_321_599 88
340 3300049539 Ga0501323_018933 Ga0501323_018933_582_860 88
341 3300049540 Ga0501324_000812 Ga0501324_000812_1500_1778 88
342 3300049541 Ga0501325_031005 Ga0501325_031005_64_342 88
343 3300049542 Ga0501326_04901 Ga0501326_04901_120_398 88
344 3300049543 Ga0501327_03811 Ga0501327_03811_407_685 88
345 3300049545 Ga0501329_02901 Ga0501329_02901_269_547 88
346 3300049546 Ga0501330_008560 Ga0501330_008560_97_375 88
347 3300049547 Ga0501331_11512 Ga0501331_11512_104_382 88
348 3300049550 Ga0501334_07180 Ga0501334_07180_106_372 88
349 3300049551 Ga0501335_005181 Ga0501335_005181_101_367 88
350 3300049551 Ga0501335_015036 Ga0501335_015036_109_387 88
351 3300049551 Ga0501335_048704 Ga0501335_048704_116_394 88
352 3300049553 Ga0501337_008454 Ga0501337_008454_353_631 88
353 3300049553 Ga0501337_019466 Ga0501337_019466_106_384 88
354 3300049554 Ga0501338_06283 Ga0501338_06283_361_639 88
355 3300049556 Ga0501340_000481 Ga0501340_000481_1086_1364 88
356 3300049556 Ga0501340_019144 Ga0501340_019144_109_387 88
357 3300049570 Ga0501033_0729587 Ga0501033_0729587_249_515 88
358 3300049576 Ga0501040_0408170 Ga0501040_0408170_391_675 88
359 3300049578 Ga0501042_0165306 Ga0501042_0165306_1247_1540 88
360 3300049581 Ga0501047_0005869 Ga0501047_0005869_5158_5427 88
361 3300049581 Ga0501047_0074504 Ga0501047_0074504_1135_1410 88
362 3300049581 Ga0501047_0303224 Ga0501047_0303224_387_665 88
363 3300049582 Ga0501048_0975460 Ga0501048_0975460_75_350 88
364 3300049588 Ga0501072_0793055 Ga0501072_0793055_57_335 88
365 3300049590 Ga0501074_0139117 Ga0501074_0139117_1156_1425 88
366 3300049591 Ga0501075_0172789 Ga0501075_0172789_789_1085 88
367 3300049591 Ga0501075_0787114 Ga0501075_0787114_79_366 88
368 3300049591 Ga0501075_0849564 Ga0501075_0849564_218_496 88
369 3300049592 Ga0501076_0193157 Ga0501076_0193157_501_779 88
370 3300049592 Ga0501076_0429359 Ga0501076_0429359_365_652 88
371 3300049654 Ga0501207_078071 Ga0501207_078071_88_453 88
372 3300049661 Ga0501217_010354 Ga0501217_010354_13_291 88
373 3300049663 Ga0501223_067476 Ga0501223_067476_46_312 88
374 3300049708 Ga0501245_148433 Ga0501245_148433_116_382 88
375 3300049742 Ga0501080_0187759 Ga0501080_0187759_65_334 88
376 3300049743 Ga0501081_0269524 Ga0501081_0269524_925_1209 88
377 3300049744 Ga0501083_0956854 Ga0501083_0956854_225_503 88
378 3300049763 Ga0501266_051713 Ga0501266_051713_169_447 88
379 3300049766 Ga0501269_026196 Ga0501269_026196_205_480 88
380 3300049822 Ga0501035_0048381 Ga0501035_0048381_2983_3252 88
381 3300049823 Ga0501044_0008030 Ga0501044_0008030_7870_8139 88
382 3300050493 nmdc:mga0k408_4220_c1 nmdc:mga0k408_4220_c1_6297_6563 88
383 3300050493 nmdc:mga0k408_434950_c1 nmdc:mga0k408_434950_c1_452_718 88
384 3300050494 nmdc:mga06z11_888712_c1 nmdc:mga06z11_888712_c1_131_424 88
385 3300050496 nmdc:mga07m45_44230_c1 nmdc:mga07m45_44230_c1_284_562 88
386 3300050496 nmdc:mga07m45_671679_c1 nmdc:mga07m45_671679_c1_193_459 88
387 3300050507 nmdc:mga05p37_80072_c1 nmdc:mga05p37_80072_c1_2928_3221 88
388 3300050508 nmdc:mga09592_197231_c1 nmdc:mga09592_197231_c1_805_1125 88
389 3300050508 nmdc:mga09592_439617_c1 nmdc:mga09592_439617_c1_501_779 88
390 3300050509 nmdc:mga0qj67_712714_c1 nmdc:mga0qj67_712714_c1_470_748 88
391 3300050509 nmdc:mga0qj67_873297_c1 nmdc:mga0qj67_873297_c1_177_491 88
392 3300050510 nmdc:mga06r32_903963_c1 nmdc:mga06r32_903963_c1_365_643 88
393 3300050510 nmdc:mga06r32_954572_c1 nmdc:mga06r32_954572_c1_282_602 88
394 3300050512 nmdc:mga0n895_419548_c1 nmdc:mga0n895_419548_c1_275_568 88
395 3300050513 nmdc:mga0rr50_141842_c1 nmdc:mga0rr50_141842_c1_930_1223 88
396 3300050515 nmdc:mga0a205_464881_c1 nmdc:mga0a205_464881_c1_20_340 88
397 3300050515 nmdc:mga0a205_608441_c1 nmdc:mga0a205_608441_c1_433_726 88
398 3300050515 nmdc:mga0a205_674830_c1 nmdc:mga0a205_674830_c1_352_672 88
399 3300053080 Ga0500635_0004581 Ga0500635_0004581_512_778 88
400 3300053094 Ga0500566_0303741 Ga0500566_0303741_296_562 88
401 3300053102 Ga0500554_114417 Ga0500554_114417_47_322 88
402 3300053119 Ga0500595_014280 Ga0500595_014280_1298_1573 88
403 3300053136 Ga0500559_0103194 Ga0500559_0103194_465_731 88
404 3300053138 Ga0500564_131549 Ga0500564_131549_743_1018 88
405 3300053154 Ga0500619_087325 Ga0500619_087325_136_411 88
406 3300053156 Ga0500622_0000385 Ga0500622_0000385_38237_38503 88
407 3300053158 Ga0500627_0310574 Ga0500627_0310574_99_365 88
408 3300053730 Ga0500645_019570 Ga0500645_019570_491_769 88
409 3300053730 Ga0500645_077780 Ga0500645_077780_19_285 88
410 3300054114 Ga0501084_1875507 Ga0501084_1875507_15_293 88
411 3300055283 Ga0500661_027542 Ga0500661_027542_615_890 88
412 3300059477 Ga0587084_017616 Ga0587084_017616_66_341 88
413 3300059477 Ga0587084_095626 Ga0587084_095626_250_555 88
414 3300059491 Ga0587070_030135 Ga0587070_030135_650_925 88
415 3300059493 Ga0587077_003683 Ga0587077_003683_1214_1492 88
416 3300059493 Ga0587077_007978 Ga0587077_007978_149_442 88
417 3300059493 Ga0587077_038531 Ga0587077_038531_26_301 88
418 3300059493 Ga0587077_083713 Ga0587077_083713_209_487 88
419 3300059493 Ga0587077_091444 Ga0587077_091444_107_373 88
420 3300059504 Ga0587082_021755 Ga0587082_021755_654_932 88
421 3300059506 Ga0587085_019714 Ga0587085_019714_83_358 88
422 3300059506 Ga0587085_115200 Ga0587085_115200_140_418 88
423 3300059507 Ga0587086_003002 Ga0587086_003002_1328_1603 88
424 3300059510 Ga0587090_002489 Ga0587090_002489_1640_1918 88
425 3300059510 Ga0587090_008083 Ga0587090_008083_995_1273 88
426 3300059510 Ga0587090_019444 Ga0587090_019444_82_357 88
427 3300059510 Ga0587090_164008 Ga0587090_164008_92_358 88
428 3300059511 Ga0587091_015081 Ga0587091_015081_883_1149 88
429 3300059511 Ga0587091_018706 Ga0587091_018706_127_402 88
430 3300059511 Ga0587091_058986 Ga0587091_058986_115_393 88
431 3300059511 Ga0587091_087856 Ga0587091_087856_131_409 88
432 3300059512 Ga0587092_004898 Ga0587092_004898_1110_1403 88
433 3300059607 Ga0587125_023139 Ga0587125_023139_174_452 88
434 3300059623 Ga0587101_012643 Ga0587101_012643_702_980 88
435 3300059623 Ga0587101_053390 Ga0587101_053390_26_301 88
436 3300059624 Ga0587109_003270 Ga0587109_003270_1036_1314 88
437 3300059624 Ga0587109_004974 Ga0587109_004974_1152_1445 88
438 3300059627 Ga0587117_000700 Ga0587117_000700_1087_1380 88
439 3300059630 Ga0587128_042644 Ga0587128_042644_406_684 88
440 3300059630 Ga0587128_086715 Ga0587128_086715_139_438 88
441 3300059630 Ga0587128_153326 Ga0587128_153326_215_490 88
442 3300059639 Ga0587062_000275 Ga0587062_000275_2219_2497 88
443 3300059639 Ga0587062_004253 Ga0587062_004253_647_925 88
444 3300059639 Ga0587062_014690 Ga0587062_014690_118_396 88
445 3300059639 Ga0587062_136919 Ga0587062_136919_48_323 88
446 3300059641 Ga0587068_000623 Ga0587068_000623_1637_1930 88
447 3300059641 Ga0587068_011433 Ga0587068_011433_979_1245 88
448 3300059641 Ga0587068_016722 Ga0587068_016722_213_518 88
449 3300059641 Ga0587068_023231 Ga0587068_023231_102_377 88
450 3300059645 Ga0587076_008986 Ga0587076_008986_37_336 88
451 3300059645 Ga0587076_054617 Ga0587076_054617_123_401 88
452 3300059648 Ga0587100_045287 Ga0587100_045287_108_386 88
453 3300059652 Ga0587107_015937 Ga0587107_015937_68_346 88
454 3300059652 Ga0587107_105427 Ga0587107_105427_112_387 88
455 3300059653 Ga0587108_004347 Ga0587108_004347_359_637 88
456 3300059653 Ga0587108_004541 Ga0587108_004541_115_393 88
457 3300059660 Ga0587124_005157 Ga0587124_005157_636_914 88
458 3300059660 Ga0587124_010738 Ga0587124_010738_263_541 88
459 3300060244 Ga0587061_08754 Ga0587061_08754_117_395 88
460 3300060246 Ga0587081_03105 Ga0587081_03105_117_395 88
461 3300060346 Ga0587111_0005171 Ga0587111_0005171_1223_1501 88
462 3300060346 Ga0587111_0005360 Ga0587111_0005360_1631_1936 88
463 3300060346 Ga0587111_0010170 Ga0587111_0010170_656_931 88
464 3300060353 Ga0501082_0240326 Ga0501082_0240326_498_782 88
465 3300060353 Ga0501082_0265415 Ga0501082_0265415_405_692 88
466 3300060353 Ga0501082_0534043 Ga0501082_0534043_452_736 88
467 3300060353 Ga0501082_1539284 Ga0501082_1539284_86_364 88
468 3300061734 Ga0530510_0924741 Ga0530510_0924741_76_354 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9725 8 83
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9496 12 76
4v8a-assembly2.cif.gz_CS the structure of thermorubin in complex with the 70s ribosome from thermus thermophilus. 0.9427 8 83
4v8a-assembly1.cif.gz_DS the structure of thermorubin in complex with the 70s ribosome from thermus thermophilus. 0.9427 8 83
5o61-assembly1.cif.gz_BS the complete structure of the mycobacterium smegmatis 70s ribosome 0.9415 2 83
ID Description Score Start End Superfamily
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9208 7 83 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9021 4 81 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9019 3 81 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8989 7 83 3.30.860.10
2wriS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8975 4 82 3.30.860.10
ID Description Score Start End GO Terms
AF-R5ZCU1-F1-model_v4 deleted 0.9588 1 83
AF-A0A3D0N859-F1-model_v4 Small ribosomal subunit protein uS19 0.9488 1 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1V5ZDP7-F1-model_v4 Small ribosomal subunit protein uS19 0.9485 1 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A496ATK1-F1-model_v4 Small ribosomal subunit protein uS19 0.9457 1 84 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1V5L2N2-F1-model_v4 Small ribosomal subunit protein uS19 0.9423 3 83 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
89.68 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map