F449647

General Info

Members Datasets Scaffolds Average Seq Length
466 284 932 123

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000133|Ga0105240_1000013336
Length 135
Sequence VNVPENLHYATSHEWLRLDGENGTVGISDHAQEELTDVVYVELPQVGKQVKAGEQICVVESVKAASDIYAPVSGTVTAANEKLSSNPALINTDPYGEGWIFQIKVEAGEEIEELKSPAQYKEQIGGSGADSGAGV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
77 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
173 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
265 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
280 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
281 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
282 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
283 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
284 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0.21
Rhizoplane 1.72
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000133 3300009093 Bacteria 152160
2 JGI24737J22298_10004757 3300001990 Bacteria 4714
3 JGI24737J22298_10009854 3300001990 Bacteria 3164
4 JGI24735J21928_10057984 3300002067 Bacteria 1114
5 rootH2_10001019 3300003320 Bacteria 3208
6 Ga0065712_10218016 3300005290 Bacteria 1050
7 Ga0065715_10980605 3300005293 Bacteria 551
8 Ga0065707_10155856 3300005295 Bacteria 1609
9 Ga0065707_10310282 3300005295 Bacteria 986
10 Ga0070658_10745150 3300005327 Bacteria 851
11 Ga0070676_10633676 3300005328 Bacteria 774
12 Ga0070690_100706089 3300005330 Bacteria 775
13 Ga0070670_100338743 3300005331 Bacteria 1320
14 Ga0070677_10315409 3300005333 Bacteria 799
15 Ga0068869_100449056 3300005334 Bacteria 1068
16 Ga0070666_10478404 3300005335 Bacteria 901
17 Ga0070680_100343514 3300005336 Bacteria 1268
18 Ga0068868_100335871 3300005338 Bacteria 1291
19 Ga0068868_100506180 3300005338 Bacteria 1058
20 Ga0068868_100769695 3300005338 Unclassified 866
21 Ga0070660_100021225 3300005339 Bacteria 4786
22 Ga0070660_100697735 3300005339 Bacteria 851
23 Ga0070689_100130535 3300005340 Bacteria 2014
24 Ga0070661_100895383 3300005344 Bacteria 732
25 Ga0070692_10000457 3300005345 Bacteria 12459
26 Ga0070668_100009416 3300005347 Bacteria 7246
27 Ga0070668_100416465 3300005347 Bacteria 1150
28 Ga0070668_100542432 3300005347 Bacteria 1011
29 Ga0070669_100533900 3300005353 Bacteria 976
30 Ga0070675_100062334 3300005354 Bacteria 3081
31 Ga0070675_100159453 3300005354 Bacteria 1939
32 Ga0070671_100007488 3300005355 Bacteria 8725
33 Ga0070671_100484092 3300005355 Bacteria 1063
34 Ga0070673_100188114 3300005364 Bacteria 1772
35 Ga0070673_101167095 3300005364 Unclassified 721
36 Ga0070659_100001481 3300005366 Bacteria 16916
37 Ga0070659_100114057 3300005366 Bacteria 2183
38 Ga0070659_101201970 3300005366 Bacteria 670
39 Ga0070667_100004769 3300005367 Bacteria 11358
40 Ga0070667_101486378 3300005367 Bacteria 636
41 Ga0070714_100026969 3300005435 Bacteria 4753
42 Ga0070711_101283191 3300005439 Unclassified 635
43 Ga0070694_100003228 3300005444 Bacteria 9732
44 Ga0070694_100955749 3300005444 Bacteria 710
45 Ga0070663_100059171 3300005455 Bacteria 2754
46 Ga0070663_100158437 3300005455 Bacteria 1741
47 Ga0070662_100011424 3300005457 Bacteria 5861
48 Ga0070662_100263828 3300005457 Bacteria 1388
49 Ga0070662_100417011 3300005457 Bacteria 1110
50 Ga0070662_100422475 3300005457 Bacteria 1103
51 Ga0070662_100436485 3300005457 Bacteria 1085
52 Ga0070662_100729265 3300005457 Bacteria 840
53 Ga0070706_100595382 3300005467 Bacteria 1028
54 Ga0070707_100600752 3300005468 Bacteria 1063
55 Ga0070699_100013745 3300005518 Bacteria 6964
56 Ga0070679_100335581 3300005530 Bacteria 1460
57 Ga0070684_101232937 3300005535 Bacteria 704
58 Ga0068853_100099290 3300005539 Bacteria 2572
59 Ga0070672_100390018 3300005543 Bacteria 1192
60 Ga0070672_101688868 3300005543 Unclassified 569
61 Ga0070686_100515184 3300005544 Bacteria 930
62 Ga0070695_100003196 3300005545 Bacteria 9566
63 Ga0070696_100451376 3300005546 Bacteria 1014
64 Ga0070696_100996237 3300005546 Bacteria 700
65 Ga0070693_100992440 3300005547 Bacteria 635
66 Ga0070665_100001257 3300005548 Bacteria 30554
67 Ga0070704_100680195 3300005549 Bacteria 911
68 Ga0070704_101131292 3300005549 Bacteria 712
69 Ga0068855_100019513 3300005563 Bacteria 8147
70 Ga0068855_100772237 3300005563 Bacteria 1023
71 Ga0070664_100014759 3300005564 Bacteria 6378
72 Ga0070664_100207884 3300005564 Bacteria 1748
73 Ga0068857_100034375 3300005577 Bacteria 4484
74 Ga0068857_100097750 3300005577 Bacteria 2632
75 Ga0068857_101822912 3300005577 Bacteria 596
76 Ga0068854_100159379 3300005578 Bacteria 1746
77 Ga0068859_100110788 3300005617 Bacteria 2807
78 Ga0068859_100346621 3300005617 Bacteria 1580
79 Ga0068859_101064797 3300005617 Bacteria 889
80 Ga0068859_101395861 3300005617 Bacteria 772
81 Ga0068859_101519268 3300005617 Bacteria 739
82 Ga0068864_100017938 3300005618 Bacteria 5905
83 Ga0068864_100294308 3300005618 Bacteria 1518
84 Ga0068863_100290472 3300005841 Bacteria 1585
85 Ga0068863_100579406 3300005841 Bacteria 1109
86 Ga0068863_100840595 3300005841 Bacteria 917
87 Ga0068858_100022679 3300005842 Bacteria 5855
88 Ga0068858_100301320 3300005842 Bacteria 1529
89 Ga0068860_100008281 3300005843 Bacteria 10349
90 Ga0068860_100067344 3300005843 Bacteria 3403
91 Ga0068860_100922939 3300005843 Bacteria 890
92 Ga0068862_100107228 3300005844 Bacteria 2449
93 Ga0068862_100238746 3300005844 Bacteria 1651
94 Ga0068862_102060566 3300005844 Bacteria 581
95 Ga0081455_10178255 3300005937 Bacteria 1612
96 Ga0081455_10823739 3300005937 Bacteria 581
97 Ga0081538_10225166 3300005981 Bacteria 739
98 Ga0081539_10082626 3300005985 Bacteria 1683
99 Ga0075364_10209451 3300006051 Bacteria 1322
100 Ga0075362_10020443 3300006177 Bacteria 2765
101 Ga0097621_100190443 3300006237 Bacteria 1776
102 Ga0097621_100736190 3300006237 Unclassified 910
103 Ga0068871_100045358 3300006358 Bacteria 3538
104 Ga0068871_100813832 3300006358 Unclassified 862
105 Ga0075431_100130537 3300006847 Bacteria 2592
106 Ga0075431_101254076 3300006847 Unclassified 703
107 Ga0075429_101021926 3300006880 Bacteria 723
108 Ga0068865_101151884 3300006881 Unclassified 685
109 Ga0097620_100110786 3300006931 Bacteria 2807
110 Ga0097620_100346645 3300006931 Bacteria 1580
111 Ga0097620_101064759 3300006931 Bacteria 889
112 Ga0097620_101395758 3300006931 Bacteria 772
113 Ga0097620_101519666 3300006931 Bacteria 739
114 Ga0105250_10108164 3300009092 Bacteria 1137
115 Ga0105240_10006569 3300009093 Bacteria 17075
116 Ga0105240_10074560 3300009093 Unclassified 4188
117 Ga0105240_10615142 3300009093 Bacteria 1195
118 Ga0105240_11402780 3300009093 Bacteria 734
119 Ga0105245_10551700 3300009098 Bacteria 1174
120 Ga0105245_12162103 3300009098 Bacteria 610
121 Ga0105247_10093851 3300009101 Bacteria 1908
122 Ga0114129_10028458 3300009147 Bacteria 7919
123 Ga0105241_10459235 3300009174 Bacteria 1128
124 Ga0105241_10669479 3300009174 Bacteria 944
125 Ga0105241_11249485 3300009174 Unclassified 705
126 Ga0105248_10023309 3300009177 Bacteria 6876
127 Ga0105248_10106147 3300009177 Bacteria 3167
128 Ga0105237_10006218 3300009545 Bacteria 13304
129 Ga0105237_10061644 3300009545 Bacteria 3749
130 Ga0105238_10027637 3300009551 Bacteria 5782
131 Ga0105238_10562422 3300009551 Bacteria 1145
132 Ga0105238_11565912 3300009551 Unclassified 689
133 Ga0105249_10054521 3300009553 Bacteria 3656
134 Ga0105029_102807 3300009984 Bacteria 1143
135 Ga0105028_103980 3300009993 Bacteria 1543
136 Ga0105239_10133019 3300010375 Bacteria 2768
137 Ga0105239_10293411 3300010375 Bacteria 1831
138 Ga0105239_10631044 3300010375 Bacteria 1223
139 Ga0105239_11067760 3300010375 Bacteria 929
140 Ga0157373_10000131 3300013100 Bacteria 58821
141 Ga0157371_10746695 3300013102 Bacteria 735
142 Ga0157370_10000129 3300013104 Bacteria 90134
143 Ga0157370_10865880 3300013104 Bacteria 821
144 Ga0157369_10127458 3300013105 Bacteria 2697
145 Ga0157369_10589282 3300013105 Bacteria 1148
146 Ga0157374_10000030 3300013296 Bacteria 211102
147 Ga0157374_10072520 3300013296 Bacteria 3249
148 Ga0157378_11178844 3300013297 Unclassified 805
149 Ga0163162_10191889 3300013306 Bacteria 2171
150 Ga0163162_10723821 3300013306 Unclassified 1116
151 Ga0163162_11279529 3300013306 Bacteria 833
152 Ga0157372_10453124 3300013307 Bacteria 1495
153 Ga0157372_10500392 3300013307 Bacteria 1417
154 Ga0157375_11130808 3300013308 Bacteria 917
155 Ga0157375_11838797 3300013308 Bacteria 718
156 Ga0163163_10264822 3300014325 Bacteria 1770
157 Ga0163163_10926796 3300014325 Bacteria 934
158 Ga0163163_12157415 3300014325 Bacteria 616
159 Ga0163163_12894906 3300014325 Bacteria 535
160 Ga0157380_11654852 3300014326 Bacteria 697
161 Ga0157380_11766333 3300014326 Bacteria 677
162 Ga0157379_10582203 3300014968 Bacteria 1043
163 Ga0157379_11826499 3300014968 Bacteria 598
164 Ga0157376_10716100 3300014969 Bacteria 1007
165 Ga0157376_12677590 3300014969 Unclassified 539
166 Ga0213873_10125186 3300021358 Bacteria 757
167 Ga0213874_10079939 3300021377 Bacteria 1057
168 Ga0213876_10137884 3300021384 Bacteria 1297
169 Ga0213875_10004902 3300021388 Bacteria 7266
170 Ga0213875_10107948 3300021388 Bacteria 1299
171 Ga0213875_10131472 3300021388 Bacteria 1170
172 Ga0213871_10001409 3300021441 Bacteria 4017
173 Ga0213871_10268807 3300021441 Bacteria 545
174 Ga0207688_10181978 3300025901 Bacteria 1254
175 Ga0207680_10150178 3300025903 Bacteria 1553
176 Ga0207647_10000327 3300025904 Bacteria 38973
177 Ga0207647_10029719 3300025904 Bacteria 3532
178 Ga0207645_10275396 3300025907 Bacteria 1116
179 Ga0207705_11121792 3300025909 Bacteria 605
180 Ga0207654_10554076 3300025911 Bacteria 817
181 Ga0207695_10000222 3300025913 Bacteria 152313
182 Ga0207695_10010897 3300025913 Bacteria 11064
183 Ga0207695_10138194 3300025913 Bacteria 2388
184 Ga0207695_10715530 3300025913 Bacteria 882
185 Ga0207671_10017325 3300025914 Bacteria 5558
186 Ga0207671_10056227 3300025914 Bacteria 2915
187 Ga0207660_10161501 3300025917 Bacteria 1729
188 Ga0207649_10387673 3300025920 Bacteria 1043
189 Ga0207681_11055506 3300025923 Bacteria 682
190 Ga0207694_10012877 3300025924 Bacteria 6300
191 Ga0207694_10326034 3300025924 Bacteria 1268
192 Ga0207650_10298591 3300025925 Bacteria 1315
193 Ga0207659_10275053 3300025926 Bacteria 1375
194 Ga0207644_10000465 3300025931 Bacteria 26250
195 Ga0207644_10020809 3300025931 Bacteria 4463
196 Ga0207690_10085196 3300025932 Bacteria 2217
197 Ga0207690_10141533 3300025932 Bacteria 1773
198 Ga0207690_10652852 3300025932 Bacteria 862
199 Ga0207706_10004098 3300025933 Bacteria 13773
200 Ga0207706_10012243 3300025933 Bacteria 7818
201 Ga0207706_10108547 3300025933 Bacteria 2442
202 Ga0207706_10315575 3300025933 Bacteria 1361
203 Ga0207706_10370049 3300025933 Bacteria 1245
204 Ga0207706_10979842 3300025933 Bacteria 711
205 Ga0207691_10369519 3300025940 Bacteria 1225
206 Ga0207691_10604126 3300025940 Bacteria 928
207 Ga0207711_10081373 3300025941 Bacteria 2830
208 Ga0207711_10485158 3300025941 Bacteria 1151
209 Ga0207679_10161752 3300025945 Bacteria 1833
210 Ga0207679_10460259 3300025945 Unclassified 1129
211 Ga0207679_10987231 3300025945 Bacteria 772
212 Ga0207679_11524060 3300025945 Unclassified 613
213 Ga0207667_10018675 3300025949 Bacteria 7768
214 Ga0207651_10085767 3300025960 Bacteria 2286
215 Ga0207712_10000491 3300025961 Bacteria 32766
216 Ga0207668_10002897 3300025972 Bacteria 10066
217 Ga0207668_10016416 3300025972 Bacteria 4621
218 Ga0207668_10938556 3300025972 Bacteria 771
219 Ga0207640_10018236 3300025981 Bacteria 4120
220 Ga0207640_10022873 3300025981 Bacteria 3748
221 Ga0207640_10725316 3300025981 Bacteria 855
222 Ga0207658_11206150 3300025986 Bacteria 692
223 Ga0207658_11395710 3300025986 Unclassified 641
224 Ga0207677_10454484 3300026023 Bacteria 1098
225 Ga0207703_10002126 3300026035 Bacteria 17427
226 Ga0207703_10276566 3300026035 Bacteria 1523
227 Ga0207703_10721910 3300026035 Unclassified 948
228 Ga0207639_10113191 3300026041 Bacteria 2216
229 Ga0207639_11142993 3300026041 Bacteria 731
230 Ga0207678_10025491 3300026067 Bacteria 5161
231 Ga0207678_10064553 3300026067 Bacteria 3145
232 Ga0207678_10534295 3300026067 Unclassified 1024
233 Ga0207702_10010294 3300026078 Bacteria 7834
234 Ga0207641_10229872 3300026088 Bacteria 1723
235 Ga0207641_10534710 3300026088 Bacteria 1141
236 Ga0207676_10018911 3300026095 Bacteria 5016
237 Ga0207676_10273855 3300026095 Bacteria 1530
238 Ga0207676_10600852 3300026095 Bacteria 1057
239 Ga0207676_11264858 3300026095 Bacteria 732
240 Ga0207674_10003393 3300026116 Bacteria 19537
241 Ga0207674_10049391 3300026116 Bacteria 4302
242 Ga0207674_10705253 3300026116 Bacteria 974
243 Ga0207675_100070177 3300026118 Bacteria 3274
244 Ga0207675_101149117 3300026118 Unclassified 797
245 Ga0207675_102257631 3300026118 Bacteria 558
246 Ga0207683_10732173 3300026121 Bacteria 917
247 Ga0207698_10087488 3300026142 Bacteria 2538
248 Ga0207698_10888082 3300026142 Bacteria 898
249 Ga0268266_11877819 3300028379 Bacteria 573
250 Ga0268265_10057188 3300028380 Bacteria 2971
251 Ga0268264_10124678 3300028381 Bacteria 2275
252 Ga0268264_10439021 3300028381 Bacteria 1262
253 Ga0265318_10058316 3300028577 Bacteria 1441
254 Ga0265338_10020462 3300028800 Bacteria 6959
255 Ga0265325_10028383 3300031241 Bacteria 3017
256 Ga0265331_10028942 3300031250 Bacteria 2768
257 Ga0265327_10002462 3300031251 Bacteria 19493
258 Ga0265316_10010329 3300031344 Bacteria 8518
259 Ga0307408_100055524 3300031548 Bacteria 2868
260 Ga0307508_10364471 3300031616 Bacteria 1036
261 Ga0316579_10441852 3300031691 Unclassified 629
262 Ga0307405_10696470 3300031731 Bacteria 841
263 Ga0307413_10054626 3300031824 Bacteria 2425
264 Ga0307410_10138177 3300031852 Bacteria 1799
265 Ga0307410_10272435 3300031852 Bacteria 1325
266 Ga0307406_10056826 3300031901 Bacteria 2508
267 Ga0307412_10577770 3300031911 Bacteria 948
268 Ga0307412_11159590 3300031911 Bacteria 690
269 Ga0307409_100040091 3300031995 Bacteria 3483
270 Ga0307409_101575538 3300031995 Bacteria 685
271 Ga0307416_101176283 3300032002 Bacteria 872
272 Ga0307414_10836721 3300032004 Bacteria 841
273 Ga0307411_10112279 3300032005 Bacteria 1953
274 Ga0373953_0102295 3300035117 Bacteria 1207
275 Ga0373955_0204293 3300035172 Bacteria 1177
276 Ga0373933_0990630 3300035724 Unclassified 554
277 Ga0373937_0441122 3300036401 Bacteria 1236
278 Ga0373937_0476861 3300036401 Bacteria 1185
279 Ga0316582_0039479 3300036647 Bacteria 2940
280 Ga0395899_0735064 3300037312 Bacteria 616
281 Ga0395900_0135879 3300037418 Bacteria 2519
282 Ga0395898_0024219 3300037466 Bacteria 6123
283 Ga0395898_0955667 3300037466 Bacteria 794
284 Ga0395905_0077248 3300037471 Bacteria 3120
285 Ga0395905_0341910 3300037471 Bacteria 1387
286 Ga0436364_0108958 3300037853 Bacteria 3554
287 Ga0436364_0373975 3300037853 Bacteria 12022
288 Ga0436364_1455128 3300037853 Bacteria 1226
289 Ga0436364_1498961 3300037853 Bacteria 1919
290 Ga0400489_32935 3300039093 Bacteria 2453
291 Ga0436365_1107144 3300039437 Bacteria 1251
292 Ga0436365_1542972 3300039437 Unclassified 642
293 Ga0436365_1643968 3300039437 Bacteria 1329
294 Ga0436360_0558071 3300039438 Bacteria 818
295 Ga0436360_0670139 3300039438 Bacteria 7895
296 Ga0436360_0741342 3300039438 Bacteria 4506
297 Ga0436361_0987153 3300039447 Bacteria 1835
298 Ga0436363_0771515 3300039450 Bacteria 1256
299 Ga0436363_1094923 3300039450 Bacteria 648
300 Ga0436362_0168774 3300039453 Bacteria 3282
301 Ga0436362_1072232 3300039453 Bacteria 2218
302 Ga0436362_1258392 3300039453 Bacteria 822
303 Ga0439466_0122838 3300041411 Bacteria 801
304 Ga0450888_011103 3300042126 Bacteria 1052
305 Ga0450893_0026340 3300042532 Bacteria 1022
306 Ga0466966_0619990 3300044684 Bacteria 651
307 Ga0466961_0198504 3300044693 Bacteria 1241
308 Ga0453684_0682596 3300044712 Unclassified 1118
309 Ga0466971_0030195 3300044719 Bacteria 2425
310 Ga0466968_0424046 3300044735 Bacteria 655
311 Ga0466957_0125865 3300044842 Bacteria 1637
312 Ga0466959_0401137 3300045049 Bacteria 932
313 Ga0451576_0007254 3300045051 Bacteria 13336
314 Ga0451576_0105659 3300045051 Bacteria 2930
315 Ga0466958_0069658 3300045836 Bacteria 2151
316 Ga0466967_0136140 3300045976 Bacteria 2284
317 Ga0466967_1291164 3300045976 Bacteria 727
318 Ga0466967_1400658 3300045976 Bacteria 696
319 Ga0495603_0560851 3300046455 Bacteria 654
320 Ga0495580_0086513 3300046472 Bacteria 2183
321 Ga0495580_0146066 3300046472 Bacteria 1639
322 Ga0495664_0110102 3300046477 Bacteria 1662
323 Ga0495594_0568004 3300046499 Bacteria 643
324 Ga0495620_0066195 3300046515 Bacteria 1489
325 Ga0495628_0411161 3300046516 Bacteria 987
326 Ga0495637_0210934 3300046520 Bacteria 710
327 Ga0495643_0045607 3300046522 Bacteria 2379
328 Ga0495663_0107108 3300046525 Bacteria 926
329 Ga0495654_0174191 3300046530 Bacteria 936
330 Ga0495640_0075563 3300046533 Bacteria 2250
331 Ga0495587_0080712 3300046536 Bacteria 1885
332 Ga0495609_0171242 3300046538 Bacteria 917
333 Ga0495597_0000634 3300046542 Bacteria 28662
334 Ga0495645_0142578 3300046543 Bacteria 1671
335 Ga0495645_0741757 3300046543 Bacteria 593
336 Ga0495667_0495448 3300046559 Unclassified 766
337 Ga0495668_0262027 3300046616 Bacteria 946
338 Ga0495635_0988585 3300046663 Unclassified 536
339 Ga0495599_0524526 3300046678 Bacteria 695
340 Ga0495624_0089325 3300046690 Bacteria 1902
341 Ga0495604_0217679 3300047317 Bacteria 1316
342 Ga0495674_0003008 3300047319 Bacteria 16426
343 Ga0495687_185383 3300047443 Bacteria 675
344 Ga0495675_0070985 3300047444 Bacteria 2199
345 Ga0495684_1028939 3300047471 Bacteria 521
346 Ga0495602_0057612 3300048088 Bacteria 3407
347 Ga0495602_0220502 3300048088 Bacteria 1432
348 Ga0496102_0285195 3300048905 Bacteria 1556
349 Ga0496102_0369486 3300048905 Bacteria 1350
350 Ga0496106_1578822 3300048909 Bacteria 503
351 Ga0496107_0064994 3300048910 Bacteria 2645
352 Ga0496108_0117352 3300048911 Bacteria 2280
353 Ga0496109_0638660 3300048912 Bacteria 1001
354 Ga0496112_0040896 3300048915 Bacteria 4534
355 Ga0496113_0130393 3300048916 Bacteria 1972
356 Ga0496116_0212161 3300048919 Bacteria 1002
357 Ga0496117_0025102 3300048920 Bacteria 4693
358 Ga0496118_0015326 3300048921 Bacteria 7103
359 Ga0496119_0027441 3300048922 Bacteria 3912
360 Ga0496121_0000627 3300048924 Bacteria 65883
361 Ga0496121_0121681 3300048924 Bacteria 1970
362 Ga0501032_0096928 3300049569 Bacteria 1955
363 Ga0501033_0303109 3300049570 Bacteria 1124
364 Ga0501033_0402299 3300049570 Bacteria 955
365 Ga0501034_0149248 3300049571 Unclassified 2314
366 Ga0501034_0718152 3300049571 Bacteria 897
367 Ga0501034_0821110 3300049571 Bacteria 821
368 Ga0501036_0144385 3300049572 Bacteria 2007
369 Ga0501036_0162002 3300049572 Bacteria 1886
370 Ga0501036_0237026 3300049572 Bacteria 1530
371 Ga0501038_0000045 3300049574 Bacteria 106662
372 Ga0501038_0114934 3300049574 Bacteria 2225
373 Ga0501039_0003553 3300049575 Bacteria 11683
374 Ga0501039_0028933 3300049575 Bacteria 4266
375 Ga0501040_0013106 3300049576 Bacteria 5452
376 Ga0501040_0013174 3300049576 Bacteria 5438
377 Ga0501041_0084385 3300049577 Bacteria 1957
378 Ga0501041_0207698 3300049577 Bacteria 1228
379 Ga0501041_0675281 3300049577 Bacteria 661
380 Ga0501042_0001222 3300049578 Bacteria 14924
381 Ga0501042_0077384 3300049578 Bacteria 2382
382 Ga0501042_0104959 3300049578 Bacteria 2033
383 Ga0501042_0798251 3300049578 Unclassified 687
384 Ga0501043_0251807 3300049579 Bacteria 1360
385 Ga0501046_0052916 3300049580 Bacteria 3199
386 Ga0501046_0107034 3300049580 Bacteria 2140
387 Ga0501046_0218304 3300049580 Bacteria 1413
388 Ga0501048_0010431 3300049582 Bacteria 6939
389 Ga0501048_0012346 3300049582 Bacteria 6356
390 Ga0501048_0059433 3300049582 Bacteria 2709
391 Ga0501068_0039063 3300049584 Bacteria 2845
392 Ga0501068_0182678 3300049584 Unclassified 1326
393 Ga0501069_0187738 3300049585 Bacteria 1195
394 Ga0501070_0257483 3300049586 Bacteria 1427
395 Ga0501071_0069220 3300049587 Bacteria 2569
396 Ga0501071_0099962 3300049587 Bacteria 2137
397 Ga0501071_0400125 3300049587 Bacteria 1048
398 Ga0501072_0002066 3300049588 Bacteria 14929
399 Ga0501072_0024659 3300049588 Bacteria 4681
400 Ga0501072_0724564 3300049588 Bacteria 781
401 Ga0501073_0589497 3300049589 Bacteria 768
402 Ga0501074_0248302 3300049590 Bacteria 1265
403 Ga0501075_0008095 3300049591 Bacteria 7311
404 Ga0501075_0011045 3300049591 Bacteria 6374
405 Ga0501075_1008784 3300049591 Bacteria 632
406 Ga0501076_0034790 3300049592 Bacteria 3940
407 Ga0501076_0071417 3300049592 Bacteria 2777
408 Ga0501076_0140689 3300049592 Bacteria 1960
409 Ga0501077_0024199 3300049593 Unclassified 3855
410 Ga0501077_0074103 3300049593 Bacteria 2156
411 Ga0501077_0415132 3300049593 Bacteria 861
412 Ga0501079_0084636 3300049741 Bacteria 2453
413 Ga0501080_0040589 3300049742 Bacteria 4340
414 Ga0501080_0068161 3300049742 Bacteria 3310
415 Ga0501081_0014757 3300049743 Bacteria 5155
416 Ga0501083_0024531 3300049744 Unclassified 4178
417 Ga0501083_0426431 3300049744 Bacteria 863
418 Ga0501035_0215264 3300049822 Bacteria 1642
419 Ga0501035_0333637 3300049822 Bacteria 1272
420 Ga0501045_0024148 3300049824 Unclassified 4363
421 Ga0501045_0036386 3300049824 Bacteria 3574
422 nmdc:mga03683_31565_c1 3300050489 Bacteria 2126
423 nmdc:mga03683_5319_c1 3300050489 Bacteria 4344
424 nmdc:mga00v17_184553_c1 3300050491 Bacteria 1346
425 nmdc:mga05p37_18398_c1 3300050507 Bacteria 8440
426 nmdc:mga09592_946447_c1 3300050508 Bacteria 722
427 nmdc:mga06r32_1160206_c1 3300050510 Unclassified 720
428 nmdc:mga06r32_189613_c1 3300050510 Bacteria 2043
429 Ga0500578_0216201 3300053086 Bacteria 1167
430 Ga0500643_000222 3300053087 Bacteria 53015
431 Ga0500643_066278 3300053087 Bacteria 1007
432 Ga0500583_0348293 3300053092 Bacteria 718
433 Ga0500651_0121142 3300053093 Bacteria 1588
434 Ga0500641_0001254 3300053096 Bacteria 9025
435 Ga0500556_0103138 3300053104 Bacteria 1100
436 Ga0500562_010821 3300053108 Bacteria 2315
437 Ga0500572_069185 3300053111 Bacteria 1088
438 Ga0500595_005468 3300053119 Bacteria 5543
439 Ga0500608_030193 3300053122 Bacteria 2568
440 Ga0500614_008460 3300053123 Bacteria 2181
441 Ga0500642_0110943 3300053130 Bacteria 1281
442 Ga0500559_0086323 3300053136 Bacteria 1432
443 Ga0500590_092034 3300053148 Bacteria 1471
444 Ga0500604_0204652 3300053151 Bacteria 679
445 Ga0500616_0141255 3300053153 Bacteria 1125
446 Ga0500619_257244 3300053154 Bacteria 573
447 Ga0500622_0008976 3300053156 Bacteria 5558
448 Ga0500622_0062275 3300053156 Bacteria 1900
449 Ga0500645_000949 3300053730 Bacteria 16508
450 Ga0500645_062931 3300053730 Bacteria 1071
451 Ga0500552_035174 3300053733 Bacteria 792
452 Ga0501084_0003478 3300054114 Bacteria 12791
453 Ga0501084_0008912 3300054114 Bacteria 8298
454 Ga0501084_0125144 3300054114 Bacteria 2163
455 Ga0501082_0011003 3300060353 Bacteria 7780
456 Ga0501082_0047134 3300060353 Unclassified 3714
457 Ga0501082_0457147 3300060353 Bacteria 1116
458 Ga0466962_0167504 3300061719 Bacteria 1069
459 Ga0530510_0004285 3300061734 Bacteria 9867
460 Ga0530510_0021920 3300061734 Unclassified 4547
461 2526063007 2524614857 Bacteria 4146328
462 2715499752 2713897090 Bacteria 3353799
463 2740061843 2739367875 Bacteria 4157290
464 2787509943 2786546548 Bacteria 4745694
465 2834581526 2834578030 Bacteria 3530182
466 8054568455 8054563764 Bacteria 5592885
467 Ga0105240_10000133
468 JGI24737J22298_10004757
469 JGI24737J22298_10009854
470 JGI24735J21928_10057984
471 rootH2_10001019
472 Ga0065712_10218016
473 Ga0065715_10980605
474 Ga0065707_10155856
475 Ga0065707_10310282
476 Ga0070658_10745150
477 Ga0070676_10633676
478 Ga0070690_100706089
479 Ga0070670_100338743
480 Ga0070677_10315409
481 Ga0068869_100449056
482 Ga0070666_10478404
483 Ga0070680_100343514
484 Ga0068868_100335871
485 Ga0068868_100506180
486 Ga0068868_100769695
487 Ga0070660_100021225
488 Ga0070660_100697735
489 Ga0070689_100130535
490 Ga0070661_100895383
491 Ga0070692_10000457
492 Ga0070668_100009416
493 Ga0070668_100416465
494 Ga0070668_100542432
495 Ga0070669_100533900
496 Ga0070675_100062334
497 Ga0070675_100159453
498 Ga0070671_100007488
499 Ga0070671_100484092
500 Ga0070673_100188114
501 Ga0070673_101167095
502 Ga0070659_100001481
503 Ga0070659_100114057
504 Ga0070659_101201970
505 Ga0070667_100004769
506 Ga0070667_101486378
507 Ga0070714_100026969
508 Ga0070711_101283191
509 Ga0070694_100003228
510 Ga0070694_100955749
511 Ga0070663_100059171
512 Ga0070663_100158437
513 Ga0070662_100011424
514 Ga0070662_100263828
515 Ga0070662_100417011
516 Ga0070662_100422475
517 Ga0070662_100436485
518 Ga0070662_100729265
519 Ga0070706_100595382
520 Ga0070707_100600752
521 Ga0070699_100013745
522 Ga0070679_100335581
523 Ga0070684_101232937
524 Ga0068853_100099290
525 Ga0070672_100390018
526 Ga0070672_101688868
527 Ga0070686_100515184
528 Ga0070695_100003196
529 Ga0070696_100451376
530 Ga0070696_100996237
531 Ga0070693_100992440
532 Ga0070665_100001257
533 Ga0070704_100680195
534 Ga0070704_101131292
535 Ga0068855_100019513
536 Ga0068855_100772237
537 Ga0070664_100014759
538 Ga0070664_100207884
539 Ga0068857_100034375
540 Ga0068857_100097750
541 Ga0068857_101822912
542 Ga0068854_100159379
543 Ga0068859_100110788
544 Ga0068859_100346621
545 Ga0068859_101064797
546 Ga0068859_101395861
547 Ga0068859_101519268
548 Ga0068864_100017938
549 Ga0068864_100294308
550 Ga0068863_100290472
551 Ga0068863_100579406
552 Ga0068863_100840595
553 Ga0068858_100022679
554 Ga0068858_100301320
555 Ga0068860_100008281
556 Ga0068860_100067344
557 Ga0068860_100922939
558 Ga0068862_100107228
559 Ga0068862_100238746
560 Ga0068862_102060566
561 Ga0081455_10178255
562 Ga0081455_10823739
563 Ga0081538_10225166
564 Ga0081539_10082626
565 Ga0075364_10209451
566 Ga0075362_10020443
567 Ga0097621_100190443
568 Ga0097621_100736190
569 Ga0068871_100045358
570 Ga0068871_100813832
571 Ga0075431_100130537
572 Ga0075431_101254076
573 Ga0075429_101021926
574 Ga0068865_101151884
575 Ga0097620_100110786
576 Ga0097620_100346645
577 Ga0097620_101064759
578 Ga0097620_101395758
579 Ga0097620_101519666
580 Ga0105250_10108164
581 Ga0105240_10006569
582 Ga0105240_10074560
583 Ga0105240_10615142
584 Ga0105240_11402780
585 Ga0105245_10551700
586 Ga0105245_12162103
587 Ga0105247_10093851
588 Ga0114129_10028458
589 Ga0105241_10459235
590 Ga0105241_10669479
591 Ga0105241_11249485
592 Ga0105248_10023309
593 Ga0105248_10106147
594 Ga0105237_10006218
595 Ga0105237_10061644
596 Ga0105238_10027637
597 Ga0105238_10562422
598 Ga0105238_11565912
599 Ga0105249_10054521
600 Ga0105029_102807
601 Ga0105028_103980
602 Ga0105239_10133019
603 Ga0105239_10293411
604 Ga0105239_10631044
605 Ga0105239_11067760
606 Ga0157373_10000131
607 Ga0157371_10746695
608 Ga0157370_10000129
609 Ga0157370_10865880
610 Ga0157369_10127458
611 Ga0157369_10589282
612 Ga0157374_10000030
613 Ga0157374_10072520
614 Ga0157378_11178844
615 Ga0163162_10191889
616 Ga0163162_10723821
617 Ga0163162_11279529
618 Ga0157372_10453124
619 Ga0157372_10500392
620 Ga0157375_11130808
621 Ga0157375_11838797
622 Ga0163163_10264822
623 Ga0163163_10926796
624 Ga0163163_12157415
625 Ga0163163_12894906
626 Ga0157380_11654852
627 Ga0157380_11766333
628 Ga0157379_10582203
629 Ga0157379_11826499
630 Ga0157376_10716100
631 Ga0157376_12677590
632 Ga0213873_10125186
633 Ga0213874_10079939
634 Ga0213876_10137884
635 Ga0213875_10004902
636 Ga0213875_10107948
637 Ga0213875_10131472
638 Ga0213871_10001409
639 Ga0213871_10268807
640 Ga0207688_10181978
641 Ga0207680_10150178
642 Ga0207647_10000327
643 Ga0207647_10029719
644 Ga0207645_10275396
645 Ga0207705_11121792
646 Ga0207654_10554076
647 Ga0207695_10000222
648 Ga0207695_10010897
649 Ga0207695_10138194
650 Ga0207695_10715530
651 Ga0207671_10017325
652 Ga0207671_10056227
653 Ga0207660_10161501
654 Ga0207649_10387673
655 Ga0207681_11055506
656 Ga0207694_10012877
657 Ga0207694_10326034
658 Ga0207650_10298591
659 Ga0207659_10275053
660 Ga0207644_10000465
661 Ga0207644_10020809
662 Ga0207690_10085196
663 Ga0207690_10141533
664 Ga0207690_10652852
665 Ga0207706_10004098
666 Ga0207706_10012243
667 Ga0207706_10108547
668 Ga0207706_10315575
669 Ga0207706_10370049
670 Ga0207706_10979842
671 Ga0207691_10369519
672 Ga0207691_10604126
673 Ga0207711_10081373
674 Ga0207711_10485158
675 Ga0207679_10161752
676 Ga0207679_10460259
677 Ga0207679_10987231
678 Ga0207679_11524060
679 Ga0207667_10018675
680 Ga0207651_10085767
681 Ga0207712_10000491
682 Ga0207668_10002897
683 Ga0207668_10016416
684 Ga0207668_10938556
685 Ga0207640_10018236
686 Ga0207640_10022873
687 Ga0207640_10725316
688 Ga0207658_11206150
689 Ga0207658_11395710
690 Ga0207677_10454484
691 Ga0207703_10002126
692 Ga0207703_10276566
693 Ga0207703_10721910
694 Ga0207639_10113191
695 Ga0207639_11142993
696 Ga0207678_10025491
697 Ga0207678_10064553
698 Ga0207678_10534295
699 Ga0207702_10010294
700 Ga0207641_10229872
701 Ga0207641_10534710
702 Ga0207676_10018911
703 Ga0207676_10273855
704 Ga0207676_10600852
705 Ga0207676_11264858
706 Ga0207674_10003393
707 Ga0207674_10049391
708 Ga0207674_10705253
709 Ga0207675_100070177
710 Ga0207675_101149117
711 Ga0207675_102257631
712 Ga0207683_10732173
713 Ga0207698_10087488
714 Ga0207698_10888082
715 Ga0268266_11877819
716 Ga0268265_10057188
717 Ga0268264_10124678
718 Ga0268264_10439021
719 Ga0265318_10058316
720 Ga0265338_10020462
721 Ga0265325_10028383
722 Ga0265331_10028942
723 Ga0265327_10002462
724 Ga0265316_10010329
725 Ga0307408_100055524
726 Ga0307508_10364471
727 Ga0316579_10441852
728 Ga0307405_10696470
729 Ga0307413_10054626
730 Ga0307410_10138177
731 Ga0307410_10272435
732 Ga0307406_10056826
733 Ga0307412_10577770
734 Ga0307412_11159590
735 Ga0307409_100040091
736 Ga0307409_101575538
737 Ga0307416_101176283
738 Ga0307414_10836721
739 Ga0307411_10112279
740 Ga0373953_0102295
741 Ga0373955_0204293
742 Ga0373933_0990630
743 Ga0373937_0441122
744 Ga0373937_0476861
745 Ga0316582_0039479
746 Ga0395899_0735064
747 Ga0395900_0135879
748 Ga0395898_0024219
749 Ga0395898_0955667
750 Ga0395905_0077248
751 Ga0395905_0341910
752 Ga0436364_0108958
753 Ga0436364_0373975
754 Ga0436364_1455128
755 Ga0436364_1498961
756 Ga0400489_32935
757 Ga0436365_1107144
758 Ga0436365_1542972
759 Ga0436365_1643968
760 Ga0436360_0558071
761 Ga0436360_0670139
762 Ga0436360_0741342
763 Ga0436361_0987153
764 Ga0436363_0771515
765 Ga0436363_1094923
766 Ga0436362_0168774
767 Ga0436362_1072232
768 Ga0436362_1258392
769 Ga0439466_0122838
770 Ga0450888_011103
771 Ga0450893_0026340
772 Ga0466966_0619990
773 Ga0466961_0198504
774 Ga0453684_0682596
775 Ga0466971_0030195
776 Ga0466968_0424046
777 Ga0466957_0125865
778 Ga0466959_0401137
779 Ga0451576_0007254
780 Ga0451576_0105659
781 Ga0466958_0069658
782 Ga0466967_0136140
783 Ga0466967_1291164
784 Ga0466967_1400658
785 Ga0495603_0560851
786 Ga0495580_0086513
787 Ga0495580_0146066
788 Ga0495664_0110102
789 Ga0495594_0568004
790 Ga0495620_0066195
791 Ga0495628_0411161
792 Ga0495637_0210934
793 Ga0495643_0045607
794 Ga0495663_0107108
795 Ga0495654_0174191
796 Ga0495640_0075563
797 Ga0495587_0080712
798 Ga0495609_0171242
799 Ga0495597_0000634
800 Ga0495645_0142578
801 Ga0495645_0741757
802 Ga0495667_0495448
803 Ga0495668_0262027
804 Ga0495635_0988585
805 Ga0495599_0524526
806 Ga0495624_0089325
807 Ga0495604_0217679
808 Ga0495674_0003008
809 Ga0495687_185383
810 Ga0495675_0070985
811 Ga0495684_1028939
812 Ga0495602_0057612
813 Ga0495602_0220502
814 Ga0496102_0285195
815 Ga0496102_0369486
816 Ga0496106_1578822
817 Ga0496107_0064994
818 Ga0496108_0117352
819 Ga0496109_0638660
820 Ga0496112_0040896
821 Ga0496113_0130393
822 Ga0496116_0212161
823 Ga0496117_0025102
824 Ga0496118_0015326
825 Ga0496119_0027441
826 Ga0496121_0000627
827 Ga0496121_0121681
828 Ga0501032_0096928
829 Ga0501033_0303109
830 Ga0501033_0402299
831 Ga0501034_0149248
832 Ga0501034_0718152
833 Ga0501034_0821110
834 Ga0501036_0144385
835 Ga0501036_0162002
836 Ga0501036_0237026
837 Ga0501038_0000045
838 Ga0501038_0114934
839 Ga0501039_0003553
840 Ga0501039_0028933
841 Ga0501040_0013106
842 Ga0501040_0013174
843 Ga0501041_0084385
844 Ga0501041_0207698
845 Ga0501041_0675281
846 Ga0501042_0001222
847 Ga0501042_0077384
848 Ga0501042_0104959
849 Ga0501042_0798251
850 Ga0501043_0251807
851 Ga0501046_0052916
852 Ga0501046_0107034
853 Ga0501046_0218304
854 Ga0501048_0010431
855 Ga0501048_0012346
856 Ga0501048_0059433
857 Ga0501068_0039063
858 Ga0501068_0182678
859 Ga0501069_0187738
860 Ga0501070_0257483
861 Ga0501071_0069220
862 Ga0501071_0099962
863 Ga0501071_0400125
864 Ga0501072_0002066
865 Ga0501072_0024659
866 Ga0501072_0724564
867 Ga0501073_0589497
868 Ga0501074_0248302
869 Ga0501075_0008095
870 Ga0501075_0011045
871 Ga0501075_1008784
872 Ga0501076_0034790
873 Ga0501076_0071417
874 Ga0501076_0140689
875 Ga0501077_0024199
876 Ga0501077_0074103
877 Ga0501077_0415132
878 Ga0501079_0084636
879 Ga0501080_0040589
880 Ga0501080_0068161
881 Ga0501081_0014757
882 Ga0501083_0024531
883 Ga0501083_0426431
884 Ga0501035_0215264
885 Ga0501035_0333637
886 Ga0501045_0024148
887 Ga0501045_0036386
888 nmdc:mga03683_31565_c1
889 nmdc:mga03683_5319_c1
890 nmdc:mga00v17_184553_c1
891 nmdc:mga05p37_18398_c1
892 nmdc:mga09592_946447_c1
893 nmdc:mga06r32_1160206_c1
894 nmdc:mga06r32_189613_c1
895 Ga0500578_0216201
896 Ga0500643_000222
897 Ga0500643_066278
898 Ga0500583_0348293
899 Ga0500651_0121142
900 Ga0500641_0001254
901 Ga0500556_0103138
902 Ga0500562_010821
903 Ga0500572_069185
904 Ga0500595_005468
905 Ga0500608_030193
906 Ga0500614_008460
907 Ga0500642_0110943
908 Ga0500559_0086323
909 Ga0500590_092034
910 Ga0500604_0204652
911 Ga0500616_0141255
912 Ga0500619_257244
913 Ga0500622_0008976
914 Ga0500622_0062275
915 Ga0500645_000949
916 Ga0500645_062931
917 Ga0500552_035174
918 Ga0501084_0003478
919 Ga0501084_0008912
920 Ga0501084_0125144
921 Ga0501082_0011003
922 Ga0501082_0047134
923 Ga0501082_0457147
924 Ga0466962_0167504
925 Ga0530510_0004285
926 Ga0530510_0021920
927 2526063007
928 2715499752
929 2740061843
930 2787509943
931 2834581526
932 8054568455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

126

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

32

82

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9945 2 121
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9817 1 122
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.977 2 122
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9683 2 122
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.9672 2 108
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9937 3 119 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.982 2 120 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9819 1 122 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9797 2 120 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9747 2 120 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A853FS71-F1-model_v4 Glycine cleavage system H protein 0.9999 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A432VJA8-F1-model_v4 Glycine cleavage system H protein 0.9995 1 123 GO:0005737
GO:0005960
GO:0019464
AF-A0A6A8QNK0-F1-model_v4 Glycine cleavage system H protein 0.9993 2 122 GO:0005737
GO:0005960
GO:0019464
AF-A0A0Q6L2U3-F1-model_v4 Glycine cleavage system H protein 0.9986 3 123 GO:0005829
GO:0005960
GO:0019464
AF-A4TXH1-F1-model_v4 Glycine cleavage system H protein 0.9979 1 122 GO:0005737
GO:0005960
GO:0019464

Map