F448809

General Info

Members Datasets Scaffolds Average Seq Length
461 273 423 230

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0053208|Ga0501047_0053208_3181_3903
Length 240
Sequence MPSKARVLVVDDEPQMHRFLGPALNAAGYEHVRSETGRQALAEMARRPPDAVVLDLGLPDIDGQEVLRKARDFYEGPIVILSARDREMEKIEALDAGADDYVEKPFRVGELLARLRVAMRRQARHAEAPPPVIEAGDLVIDLPRRLVTRHGEAVRLSPKEYDLLAKLAEADGKVLTHKELLLSLWGPAHLHDMQYLRVFIGQLRQKIETDPAEPKLILTQPGIGYRFMADAIRAGPLSPS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2643221736 Bosea sp. Root483D1 Isolate Unclassified
15 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
16 2818991435 Caulobacter henricii 536 Isolate Unclassified
17 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
18 2841760612 Bosea sp. Tri-49 Isolate Nodule
19 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
20 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2844104063 Bosea sp. Tri-39 Isolate Nodule
23 2849560528 Caulobacter zeae 410 Isolate Unclassified
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2851153111 Caulobacter radicis 736 Isolate Unclassified
26 2851182111 Bosea sp. Tri-44 Isolate Nodule
27 2851246043 Bosea sp. Tri-54 Isolate Nodule
28 2857472729 Cohnella sp. R-74144 Isolate Unclassified
29 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
30 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
31 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
32 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
33 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
34 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
35 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
36 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
37 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
253 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
256 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
259 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
262 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
263 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
271 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 0.43
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.75
Nodule 1.52
Rhizoplane 2.39
Rhizosphere 52.93
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1033251 2162886007 Bacteria 14331
2 rootH1_10001606 3300003316 Bacteria 5745
3 rootL2_10009547 3300003322 Bacteria 13883
4 Ga0006562J51391_1040738 3300003578 Bacteria 5980
5 Ga0006562J51391_1040739 3300003578 Bacteria 5840
6 Ga0055537_1021099 3300003773 Bacteria 975
7 Ga0055536_1000492 3300003781 Bacteria 27396
8 Ga0055528_1003284 3300003790 Bacteria 8223
9 Ga0055530_10002951 3300003791 Bacteria 10267
10 Ga0055530_10003766 3300003791 Bacteria 8369
11 Ga0055540_1024070 3300003792 Bacteria 1519
12 Ga0055531_10000526 3300003794 Bacteria 34418
13 Ga0055531_10001323 3300003794 Bacteria 18554
14 Ga0055531_10001503 3300003794 Bacteria 17129
15 Ga0055531_10007028 3300003794 Bacteria 6231
16 Ga0055541_1002814 3300003841 Bacteria 3374
17 Ga0065165_1000089 3300005262 Bacteria 150859
18 Ga0065165_1000602 3300005262 Bacteria 52602
19 Ga0065165_1000615 3300005262 Bacteria 51725
20 Ga0070670_100064766 3300005331 Bacteria 3136
21 Ga0070666_10119359 3300005335 Bacteria 1828
22 Ga0070666_10201822 3300005335 Bacteria 1399
23 Ga0070668_100006229 3300005347 Bacteria 8836
24 Ga0070668_100006525 3300005347 Bacteria 8649
25 Ga0070671_100113386 3300005355 Bacteria 2278
26 Ga0070667_100000169 3300005367 Bacteria 81539
27 Ga0070667_100008230 3300005367 Bacteria 8644
28 Ga0070663_100554777 3300005455 Bacteria 961
29 Ga0070684_100654636 3300005535 Bacteria 978
30 Ga0068853_100216163 3300005539 Bacteria 1749
31 Ga0070665_100000610 3300005548 Bacteria 49084
32 Ga0070664_100817217 3300005564 Bacteria 872
33 Ga0068856_100083863 3300005614 Bacteria 3165
34 Ga0068859_100009457 3300005617 Bacteria 9841
35 Ga0068864_100000182 3300005618 Bacteria 58155
36 Ga0068864_100000220 3300005618 Bacteria 51737
37 Ga0068864_100159005 3300005618 Bacteria 2053
38 Ga0068864_100376671 3300005618 Bacteria 1344
39 Ga0068863_100000101 3300005841 Bacteria 92384
40 Ga0068863_100000185 3300005841 Bacteria 66169
41 Ga0068863_100010741 3300005841 Bacteria 8886
42 Ga0068863_100342728 3300005841 Bacteria 1454
43 Ga0068863_100361988 3300005841 Bacteria 1414
44 Ga0068858_100000260 3300005842 Bacteria 56470
45 Ga0068858_100005192 3300005842 Bacteria 12758
46 Ga0068860_100000211 3300005843 Bacteria 91286
47 Ga0068860_100002211 3300005843 Bacteria 20477
48 Ga0068862_100000514 3300005844 Bacteria 41173
49 Ga0068862_100026586 3300005844 Bacteria 4865
50 Ga0075365_10149476 3300006038 Bacteria 1625
51 Ga0075368_10020939 3300006042 Bacteria 2480
52 Ga0075364_10000257 3300006051 Bacteria 25641
53 Ga0075362_10115414 3300006177 Bacteria 1267
54 Ga0075367_10002033 3300006178 Bacteria 9046
55 Ga0075369_10007218 3300006186 Bacteria 4224
56 Ga0075366_10174258 3300006195 Bacteria 1306
57 Ga0075366_10269351 3300006195 Bacteria 1040
58 Ga0075370_10118531 3300006353 Bacteria 1540
59 Ga0075370_10216460 3300006353 Bacteria 1131
60 Ga0075370_10226669 3300006353 Bacteria 1105
61 Ga0075428_100183654 3300006844 Bacteria 2263
62 Ga0075429_100067367 3300006880 Bacteria 3115
63 Ga0068865_100003518 3300006881 Bacteria 9388
64 Ga0097620_100009457 3300006931 Bacteria 9841
65 Ga0105240_10008146 3300009093 Bacteria 15030
66 Ga0105240_10016466 3300009093 Bacteria 10006
67 Ga0105247_10057676 3300009101 Bacteria 2401
68 Ga0114129_10009638 3300009147 Bacteria 13779
69 Ga0105248_10000685 3300009177 Bacteria 38290
70 Ga0105248_10013274 3300009177 Bacteria 9068
71 Ga0105248_10133470 3300009177 Bacteria 2801
72 Ga0105248_10165309 3300009177 Bacteria 2495
73 Ga0105248_10356436 3300009177 Bacteria 1647
74 Ga0105249_10001221 3300009553 Bacteria 22640
75 Ga0105249_10366527 3300009553 Bacteria 1463
76 Ga0105239_10207045 3300010375 Bacteria 2198
77 Ga0105239_10557786 3300010375 Bacteria 1305
78 Ga0157371_10002938 3300013102 Bacteria 15895
79 Ga0157369_10063047 3300013105 Bacteria 3994
80 Ga0157374_10171320 3300013296 Bacteria 2118
81 Ga0163162_10049558 3300013306 Bacteria 4209
82 Ga0163163_10049337 3300014325 Bacteria 4142
83 Ga0163163_10159130 3300014325 Bacteria 2303
84 Ga0163163_10223899 3300014325 Bacteria 1930
85 Ga0213872_10003853 3300021361 Bacteria 8152
86 Ga0213876_10000544 3300021384 Bacteria 28326
87 Ga0209566_100627 3300025225 Bacteria 21729
88 Ga0209026_1001342 3300025250 Bacteria 11023
89 Ga0209026_1019398 3300025250 Bacteria 1066
90 Ga0209233_1019891 3300025261 Bacteria 1773
91 Ga0209565_1002647 3300025263 Bacteria 6302
92 Ga0209455_1028377 3300025272 Bacteria 979
93 Ga0209673_1000941 3300025273 Bacteria 36504
94 Ga0209673_1025428 3300025273 Bacteria 1969
95 Ga0209130_1000087 3300025284 Bacteria 155407
96 Ga0209675_1007043 3300025291 Bacteria 4384
97 Ga0209676_1000057 3300025292 Bacteria 361061
98 Ga0209676_1000468 3300025292 Bacteria 67646
99 Ga0209025_1001185 3300025294 Bacteria 36914
100 Ga0209025_1017267 3300025294 Bacteria 4180
101 Ga0209025_1031095 3300025294 Bacteria 2535
102 Ga0209564_1000818 3300025295 Bacteria 42378
103 Ga0209564_1008755 3300025295 Bacteria 4935
104 Ga0209758_1001974 3300025297 Bacteria 22165
105 Ga0209758_1008396 3300025297 Bacteria 6706
106 Ga0209050_1000098 3300025298 Bacteria 236717
107 Ga0209050_1000486 3300025298 Bacteria 69279
108 Ga0209050_1000522 3300025298 Bacteria 63985
109 Ga0209050_1022224 3300025298 Bacteria 2278
110 Ga0209050_1053425 3300025298 Bacteria 1004
111 Ga0209256_1000641 3300025299 Bacteria 47608
112 Ga0209256_1004707 3300025299 Bacteria 8363
113 Ga0209256_1005553 3300025299 Bacteria 7201
114 Ga0207426_1026477 3300025302 Bacteria 1942
115 Ga0209051_1036036 3300025303 Bacteria 1833
116 Ga0209257_1000235 3300025304 Bacteria 129620
117 Ga0209257_1000350 3300025304 Bacteria 95008
118 Ga0209257_1000520 3300025304 Bacteria 66890
119 Ga0209257_1001269 3300025304 Bacteria 30981
120 Ga0209257_1015918 3300025304 Bacteria 3083
121 Ga0207680_10049955 3300025903 Bacteria 2493
122 Ga0207705_10339660 3300025909 Bacteria 1156
123 Ga0207654_10358291 3300025911 Bacteria 1006
124 Ga0207695_10001222 3300025913 Bacteria 44042
125 Ga0207695_10017426 3300025913 Bacteria 8359
126 Ga0207694_10602971 3300025924 Bacteria 924
127 Ga0207694_10878890 3300025924 Bacteria 758
128 Ga0207650_10000160 3300025925 Bacteria 81491
129 Ga0207650_10307073 3300025925 Bacteria 1297
130 Ga0207644_10178900 3300025931 Bacteria 1661
131 Ga0207704_10000680 3300025938 Bacteria 15055
132 Ga0207711_10028739 3300025941 Bacteria 4683
133 Ga0207711_10058478 3300025941 Bacteria 3318
134 Ga0207711_10206467 3300025941 Bacteria 1794
135 Ga0207711_10459954 3300025941 Bacteria 1185
136 Ga0207712_10000203 3300025961 Bacteria 59867
137 Ga0207712_10133775 3300025961 Bacteria 1893
138 Ga0207668_10000116 3300025972 Bacteria 56072
139 Ga0207668_10030398 3300025972 Bacteria 3549
140 Ga0207658_10000341 3300025986 Bacteria 46166
141 Ga0207658_10011222 3300025986 Bacteria 6104
142 Ga0207703_10000113 3300026035 Bacteria 96214
143 Ga0207703_10003627 3300026035 Bacteria 12877
144 Ga0207703_10098925 3300026035 Bacteria 2468
145 Ga0207639_10862855 3300026041 Bacteria 845
146 Ga0207678_10380836 3300026067 Bacteria 1220
147 Ga0207678_10553633 3300026067 Bacteria 1006
148 Ga0207702_10124634 3300026078 Bacteria 2311
149 Ga0207641_10000109 3300026088 Bacteria 121126
150 Ga0207641_10005917 3300026088 Bacteria 10368
151 Ga0207641_10007409 3300026088 Bacteria 9128
152 Ga0207641_10048774 3300026088 Bacteria 3576
153 Ga0207676_10000337 3300026095 Bacteria 40385
154 Ga0207676_10000588 3300026095 Bacteria 29881
155 Ga0207676_10333249 3300026095 Bacteria 1397
156 Ga0207675_100046221 3300026118 Bacteria 4066
157 Ga0207675_100707847 3300026118 Bacteria 1016
158 Ga0268266_10561452 3300028379 Bacteria 1094
159 Ga0268265_10002154 3300028380 Bacteria 15249
160 Ga0268264_10000270 3300028381 Bacteria 90954
161 Ga0268264_10367226 3300028381 Bacteria 1374
162 Ga0265319_1107584 3300028563 Bacteria 873
163 Ga0265318_10084373 3300028577 Bacteria 1172
164 Ga0307517_10001670 3300028786 Bacteria 36710
165 Ga0307517_10032853 3300028786 Bacteria 5983
166 Ga0307517_10151375 3300028786 Bacteria 1590
167 Ga0307515_10032462 3300028794 Bacteria 8650
168 Ga0307515_10034337 3300028794 Bacteria 8310
169 Ga0307515_10125610 3300028794 Bacteria 2869
170 Ga0265338_10020391 3300028800 Bacteria 6974
171 Ga0265338_10025565 3300028800 Bacteria 5988
172 Ga0265338_10085751 3300028800 Bacteria 2624
173 Ga0265338_10099785 3300028800 Bacteria 2370
174 Ga0265338_10180698 3300028800 Bacteria 1609
175 Ga0265324_10049320 3300029957 Bacteria 1448
176 Ga0265328_10000812 3300031239 Bacteria 14422
177 Ga0265328_10041171 3300031239 Bacteria 1701
178 Ga0265320_10091249 3300031240 Bacteria 1411
179 Ga0265327_10017720 3300031251 Bacteria 4451
180 Ga0265327_10062736 3300031251 Bacteria 1890
181 Ga0307513_10004606 3300031456 Bacteria 18358
182 Ga0265314_10239850 3300031711 Bacteria 1047
183 Ga0307516_10000022 3300031730 Bacteria 191854
184 Ga0307405_10155522 3300031731 Bacteria 1613
185 Ga0307416_100319115 3300032002 Bacteria 1555
186 Ga0307414_10018647 3300032004 Bacteria 4279
187 Ga0307414_10075260 3300032004 Bacteria 2449
188 Ga0307414_10223003 3300032004 Bacteria 1549
189 Ga0307411_10101058 3300032005 Bacteria 2040
190 Ga0307510_10019492 3300033180 Bacteria 7957
191 Ga0373944_0034969 3300035089 Bacteria 1529
192 Ga0373927_0013837 3300035695 Bacteria 5355
193 Ga0373925_0000760 3300037068 Bacteria 29657
194 Ga0395899_0000003 3300037312 Bacteria 1232684
195 Ga0395899_0000516 3300037312 Bacteria 42796
196 Ga0395899_0001452 3300037312 Bacteria 20214
197 Ga0395899_0002510 3300037312 Bacteria 14876
198 Ga0395899_0116065 3300037312 Bacteria 1921
199 Ga0395900_0000010 3300037418 Bacteria 461364
200 Ga0395898_0002619 3300037466 Bacteria 20927
201 Ga0395905_0147882 3300037471 Bacteria 2210
202 Ga0436364_1236068 3300037853 Bacteria 1510
203 Ga0436364_1562220 3300037853 Bacteria 2373
204 Ga0395901_0000007 3300038443 Bacteria 497408
205 Ga0237819_08123 3300038705 Bacteria 1466
206 Ga0436365_1544656 3300039437 Bacteria 122419
207 Ga0436361_0064356 3300039447 Bacteria 3999
208 Ga0436363_0406098 3300039450 Bacteria 4367
209 Ga0436362_0966972 3300039453 Bacteria 913
210 Ga0439435_0006182 3300042436 Bacteria 2680
211 Ga0466965_0060547 3300044683 Bacteria 1891
212 Ga0466966_0047836 3300044684 Bacteria 2726
213 Ga0453684_0209930 3300044712 Unclassified 2264
214 Ga0453684_0234750 3300044712 Bacteria 2115
215 Ga0453684_0478082 3300044712 Bacteria 1382
216 Ga0453684_0512899 3300044712 Bacteria 1326
217 Ga0466971_0308242 3300044719 Bacteria 761
218 Ga0466968_0085866 3300044735 Bacteria 1389
219 Ga0466959_0003037 3300045049 Bacteria 10850
220 Ga0466959_0020496 3300045049 Bacteria 4872
221 Ga0451576_0000058 3300045051 Bacteria 298769
222 Ga0495590_0006738 3300046457 Bacteria 4467
223 Ga0495629_0037061 3300046459 Bacteria 3437
224 Ga0495629_0294681 3300046459 Bacteria 1111
225 Ga0495638_0000419 3300046460 Bacteria 51336
226 Ga0495638_0000443 3300046460 Bacteria 49906
227 Ga0495638_0002701 3300046460 Bacteria 14266
228 Ga0495638_0019659 3300046460 Bacteria 4467
229 Ga0495650_0000007 3300046471 Bacteria 718072
230 Ga0495650_0026021 3300046471 Bacteria 2730
231 Ga0495650_0124336 3300046471 Bacteria 946
232 Ga0495583_0000037 3300046506 Bacteria 244437
233 Ga0495583_0136595 3300046506 Bacteria 1023
234 Ga0495606_0001606 3300046507 Bacteria 29482
235 Ga0495606_0081722 3300046507 Bacteria 2008
236 Ga0495606_0087496 3300046507 Bacteria 1923
237 Ga0495606_0153099 3300046507 Bacteria 1352
238 Ga0495606_0259839 3300046507 Bacteria 959
239 Ga0495610_0000040 3300046512 Bacteria 165165
240 Ga0495610_0003437 3300046512 Bacteria 12345
241 Ga0495616_0000026 3300046513 Bacteria 141705
242 Ga0495620_0020050 3300046515 Bacteria 3273
243 Ga0495620_0022786 3300046515 Bacteria 3009
244 Ga0495631_0007680 3300046518 Bacteria 5475
245 Ga0495632_0004616 3300046519 Bacteria 9326
246 Ga0495632_0013381 3300046519 Bacteria 4684
247 Ga0495632_0034618 3300046519 Bacteria 2583
248 Ga0495637_0010129 3300046520 Bacteria 4573
249 Ga0495637_0011340 3300046520 Bacteria 4285
250 Ga0495643_0004412 3300046522 Bacteria 9852
251 Ga0495648_0000068 3300046524 Bacteria 138518
252 Ga0495654_0000095 3300046530 Bacteria 100179
253 Ga0495609_0071528 3300046538 Bacteria 1524
254 Ga0495609_0072879 3300046538 Bacteria 1507
255 Ga0495609_0095937 3300046538 Bacteria 1287
256 Ga0495597_0005410 3300046542 Bacteria 6762
257 Ga0495597_0006234 3300046542 Bacteria 6186
258 Ga0495597_0016365 3300046542 Bacteria 3501
259 Ga0495622_0000804 3300046557 Bacteria 17378
260 Ga0495633_0002973 3300046558 Bacteria 11589
261 Ga0495668_0000019 3300046616 Bacteria 416042
262 Ga0495668_0018873 3300046616 Bacteria 3984
263 Ga0495668_0037233 3300046616 Bacteria 2722
264 Ga0495668_0175065 3300046616 Bacteria 1175
265 Ga0495611_0001049 3300046648 Bacteria 14612
266 Ga0495625_0000080 3300046660 Bacteria 156895
267 Ga0495625_0000759 3300046660 Bacteria 44970
268 Ga0495625_0000793 3300046660 Bacteria 43797
269 Ga0495625_0013830 3300046660 Bacteria 6465
270 Ga0495625_0073911 3300046660 Bacteria 2388
271 Ga0495625_0137256 3300046660 Bacteria 1652
272 Ga0495599_0348233 3300046678 Bacteria 888
273 Ga0495669_0022824 3300046684 Bacteria 2720
274 Ga0495669_0180754 3300046684 Bacteria 1005
275 Ga0495613_0003661 3300046689 Bacteria 11519
276 Ga0495613_0114214 3300046689 Bacteria 1944
277 Ga0495671_0032336 3300046692 Bacteria 2671
278 Ga0495671_0093056 3300046692 Bacteria 1475
279 Ga0495649_0000928 3300046694 Bacteria 23215
280 Ga0495660_0001672 3300046810 Bacteria 14854
281 Ga0495660_0019582 3300046810 Bacteria 3885
282 Ga0495660_0106441 3300046810 Bacteria 1437
283 Ga0495672_0002465 3300047320 Bacteria 17011
284 Ga0495672_0073275 3300047320 Bacteria 1932
285 Ga0495683_0076173 3300047323 Bacteria 1642
286 Ga0495687_040951 3300047443 Bacteria 2037
287 Ga0495673_0000132 3300047469 Bacteria 138001
288 Ga0495673_0003359 3300047469 Bacteria 10587
289 Ga0495681_0027795 3300047470 Bacteria 2921
290 Ga0495686_0000617 3300047472 Bacteria 49100
291 Ga0495686_0012381 3300047472 Bacteria 5968
292 Ga0495686_0040540 3300047472 Bacteria 2969
293 Ga0495686_0151438 3300047472 Bacteria 1361
294 Ga0495593_0024086 3300047673 Bacteria 3377
295 Ga0496102_0050630 3300048905 Bacteria 3783
296 Ga0496102_0083525 3300048905 Bacteria 2947
297 Ga0496103_0463438 3300048906 Bacteria 812
298 Ga0496106_0045878 3300048909 Bacteria 3284
299 Ga0496106_0556840 3300048909 Bacteria 920
300 Ga0496107_0000023 3300048910 Bacteria 125918
301 Ga0496107_0228297 3300048910 Bacteria 1385
302 Ga0496111_0122981 3300048914 Bacteria 1917
303 Ga0496115_0042016 3300048918 Bacteria 3641
304 Ga0496115_0410857 3300048918 Bacteria 1097
305 Ga0496115_0717676 3300048918 Bacteria 784
306 Ga0496116_0107799 3300048919 Bacteria 1646
307 Ga0496119_0047442 3300048922 Bacteria 2672
308 Ga0496121_0000009 3300048924 Bacteria 836971
309 Ga0496121_0001031 3300048924 Bacteria 49668
310 Ga0496124_0014207 3300048927 Bacteria 7714
311 Ga0496125_0000481 3300048928 Bacteria 70594
312 Ga0496125_0002840 3300048928 Bacteria 21805
313 Ga0496125_0073185 3300048928 Bacteria 2666
314 Ga0496126_0022224 3300048929 Bacteria 6175
315 Ga0496126_0200258 3300048929 Bacteria 1687
316 Ga0495678_001686 3300049459 Bacteria 16735
317 Ga0501033_0429051 3300049570 Bacteria 920
318 Ga0501034_0846645 3300049571 Bacteria 805
319 Ga0501047_0012301 3300049581 Bacteria 8099
320 Ga0501047_0053208 3300049581 Bacteria 3914
321 Ga0501047_0203312 3300049581 Bacteria 1841
322 Ga0501047_0326588 3300049581 Bacteria 1373
323 Ga0501238_001946 3300049671 Bacteria 2420
324 Ga0501238_005737 3300049671 Bacteria 1583
325 Ga0501035_0217067 3300049822 Bacteria 1634
326 Ga0501044_0068331 3300049823 Bacteria 3620
327 nmdc:mga00v17_436_c1 3300050491 Bacteria 23432
328 nmdc:mga0yw44_110499_c1 3300050492 Bacteria 1760
329 nmdc:mga0k408_106040_c1 3300050493 Bacteria 1660
330 nmdc:mga0k408_213293_c1 3300050493 Bacteria 1153
331 nmdc:mga0k408_75081_c1 3300050493 Bacteria 1975
332 nmdc:mga06z11_27994_c1 3300050494 Bacteria 2700
333 nmdc:mga07m45_138263_c1 3300050496 Bacteria 1410
334 nmdc:mga07m45_268780_c1 3300050496 Bacteria 992
335 nmdc:mga07m45_340_c1 3300050496 Bacteria 18991
336 nmdc:mga05p37_24481_c1 3300050507 Bacteria 7338
337 nmdc:mga09592_78745_c1 3300050508 Bacteria 2805
338 nmdc:mga0sz30_4001_c1 3300050516 Bacteria 5308
339 Ga0500635_0000107 3300053080 Bacteria 49911
340 Ga0500635_0000131 3300053080 Bacteria 43413
341 Ga0500578_0002245 3300053086 Bacteria 16755
342 Ga0500578_0176383 3300053086 Bacteria 1319
343 Ga0500643_000233 3300053087 Bacteria 51480
344 Ga0500643_007205 3300053087 Bacteria 4538
345 Ga0500644_0000015 3300053088 Bacteria 108763
346 Ga0500644_0019867 3300053088 Bacteria 1989
347 Ga0500647_0006311 3300053091 Bacteria 4999
348 Ga0500647_0013773 3300053091 Bacteria 3663
349 Ga0500583_0008213 3300053092 Bacteria 3730
350 Ga0500651_0017672 3300053093 Bacteria 4406
351 Ga0500651_0066558 3300053093 Bacteria 2244
352 Ga0500566_0006578 3300053094 Bacteria 6889
353 Ga0500566_0056532 3300053094 Bacteria 2231
354 Ga0500641_0000807 3300053096 Bacteria 11307
355 Ga0500641_0006587 3300053096 Bacteria 4123
356 Ga0500554_012967 3300053102 Bacteria 2111
357 Ga0500556_0000178 3300053104 Bacteria 52397
358 Ga0500556_0004634 3300053104 Bacteria 3905
359 Ga0500557_002030 3300053105 Bacteria 3577
360 Ga0500562_001309 3300053108 Bacteria 6143
361 Ga0500562_008560 3300053108 Bacteria 2584
362 Ga0500562_027778 3300053108 Bacteria 1485
363 Ga0500569_000805 3300053109 Bacteria 5524
364 Ga0500569_001888 3300053109 Bacteria 4041
365 Ga0500594_0000362 3300053118 Bacteria 10110
366 Ga0500594_0117074 3300053118 Bacteria 834
367 Ga0500595_000877 3300053119 Bacteria 17141
368 Ga0500595_001682 3300053119 Bacteria 11621
369 Ga0500595_028144 3300053119 Bacteria 1918
370 Ga0500607_208957 3300053121 Bacteria 828
371 Ga0500608_000154 3300053122 Bacteria 28470
372 Ga0500608_013256 3300053122 Bacteria 3648
373 Ga0500608_081960 3300053122 Bacteria 1521
374 Ga0500614_001436 3300053123 Bacteria 5704
375 Ga0500614_005773 3300053123 Bacteria 2599
376 Ga0500658_0002450 3300053134 Bacteria 7173
377 Ga0500658_0051394 3300053134 Bacteria 1685
378 Ga0500559_0000002 3300053136 Bacteria 262002
379 Ga0500559_0000005 3300053136 Bacteria 230231
380 Ga0500559_0001879 3300053136 Bacteria 11415
381 Ga0500559_0004143 3300053136 Bacteria 6956
382 Ga0500559_0010229 3300053136 Bacteria 4032
383 Ga0500559_0017143 3300053136 Bacteria 3057
384 Ga0500559_0041053 3300053136 Bacteria 2016
385 Ga0500559_0202564 3300053136 Bacteria 936
386 Ga0500564_000018 3300053138 Bacteria 52235
387 Ga0500573_0040977 3300053140 Bacteria 2674
388 Ga0500577_0010572 3300053142 Bacteria 2722
389 Ga0500590_007454 3300053148 Bacteria 5403
390 Ga0500603_016231 3300053150 Bacteria 1764
391 Ga0500616_0026665 3300053153 Bacteria 3196
392 Ga0500616_0066337 3300053153 Bacteria 1853
393 Ga0500616_0100637 3300053153 Bacteria 1413
394 Ga0500619_020771 3300053154 Bacteria 1882
395 Ga0500620_009524 3300053155 Bacteria 2512
396 Ga0500622_0001016 3300053156 Bacteria 23549
397 Ga0500622_0011115 3300053156 Bacteria 4916
398 Ga0500622_0015139 3300053156 Bacteria 4135
399 Ga0500622_0027830 3300053156 Bacteria 2978
400 Ga0500622_0035604 3300053156 Bacteria 2605
401 Ga0500624_003119 3300053157 Bacteria 2184
402 Ga0500633_0021348 3300053160 Bacteria 1968
403 Ga0500633_0088099 3300053160 Bacteria 1131
404 Ga0500639_095523 3300053163 Bacteria 1473
405 Ga0500636_0000923 3300053177 Bacteria 15824
406 Ga0500636_0012546 3300053177 Bacteria 4967
407 Ga0500636_0013651 3300053177 Bacteria 4773
408 Ga0500636_0169322 3300053177 Bacteria 1183
409 Ga0500637_0000997 3300053178 Bacteria 11565
410 Ga0500637_0003641 3300053178 Bacteria 7164
411 Ga0500637_0003954 3300053178 Bacteria 6933
412 Ga0500637_0019629 3300053178 Bacteria 3647
413 Ga0500576_040431 3300053725 Bacteria 2100
414 Ga0500576_141388 3300053725 Bacteria 914
415 Ga0500625_048835 3300053729 Bacteria 1963
416 Ga0500645_000566 3300053730 Bacteria 24221
417 Ga0500645_001125 3300053730 Bacteria 14567
418 Ga0500645_001571 3300053730 Bacteria 11367
419 Ga0500609_000785 3300053731 Bacteria 4757
420 Ga0500596_000724 3300053735 Bacteria 6462
421 Ga0500596_001473 3300053735 Bacteria 4758
422 Ga0500601_012862 3300053737 Bacteria 945
423 Ga0530510_0012603 3300061734 Bacteria 5943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100319115 Ga0307416_1003191152 205
2 3300049581 Ga0501047_0326588 Ga0501047_0326588_449_1144 208
3 3300049823 Ga0501044_0068331 Ga0501044_0068331_884_1579 208
4 3300005455 Ga0070663_100554777 Ga0070663_1005547772 212
5 3300005614 Ga0068856_100083863 Ga0068856_1000838632 212
6 3300026067 Ga0207678_10553633 Ga0207678_105536332 212
7 3300026078 Ga0207702_10124634 Ga0207702_101246343 212
8 3300028786 Ga0307517_10151375 Ga0307517_101513752 212
9 3300048905 Ga0496102_0083525 Ga0496102_0083525_534_1247 213
10 3300061734 Ga0530510_0012603 Ga0530510_0012603_2583_3275 213
11 3300009177 Ga0105248_10165309 Ga0105248_101653092 214
12 3300025941 Ga0207711_10028739 Ga0207711_100287392 214
13 3300046459 Ga0495629_0294681 Ga0495629_0294681_211_924 214
14 3300046507 Ga0495606_0153099 Ga0495606_0153099_101_814 214
15 3300046515 Ga0495620_0020050 Ga0495620_0020050_1040_1753 214
16 3300046522 Ga0495643_0004412 Ga0495643_0004412_5194_5907 214
17 3300046538 Ga0495609_0072879 Ga0495609_0072879_423_1136 214
18 3300046542 Ga0495597_0006234 Ga0495597_0006234_823_1536 214
19 3300046557 Ga0495622_0000804 Ga0495622_0000804_4668_5381 214
20 3300047673 Ga0495593_0024086 Ga0495593_0024086_1748_2461 214
21 3300048906 Ga0496103_0463438 Ga0496103_0463438_31_744 214
22 3300048922 Ga0496119_0047442 Ga0496119_0047442_1389_2102 214
23 3300048924 Ga0496121_0000009 Ga0496121_0000009_718679_719392 214
24 3300053093 Ga0500651_0066558 Ga0500651_0066558_46_759 214
25 3300053094 Ga0500566_0056532 Ga0500566_0056532_1043_1756 214
26 3300053109 Ga0500569_001888 Ga0500569_001888_1035_1748 214
27 3300053119 Ga0500595_000877 Ga0500595_000877_9588_10301 214
28 3300053123 Ga0500614_001436 Ga0500614_001436_2871_3584 214
29 3300053136 Ga0500559_0017143 Ga0500559_0017143_1635_2348 214
30 3300053148 Ga0500590_007454 Ga0500590_007454_1698_2411 214
31 3300053154 Ga0500619_020771 Ga0500619_020771_71_784 214
32 3300053163 Ga0500639_095523 Ga0500639_095523_174_887 214
33 3300053178 Ga0500637_0019629 Ga0500637_0019629_654_1367 214
34 3300053729 Ga0500625_048835 Ga0500625_048835_257_970 214
35 3300053735 Ga0500596_001473 Ga0500596_001473_3770_4483 214
36 3300046678 Ga0495599_0348233 Ga0495599_0348233_106_822 215
37 3300046684 Ga0495669_0180754 Ga0495669_0180754_191_907 215
38 3300046689 Ga0495613_0114214 Ga0495613_0114214_441_1157 215
39 3300033180 Ga0307510_10019492 Ga0307510_100194922 219
40 3300053086 Ga0500578_0176383 Ga0500578_0176383_101_763 219
41 3300053134 Ga0500658_0051394 Ga0500658_0051394_790_1452 219
42 3300044735 Ga0466968_0085866 Ga0466968_0085866_354_1058 220
43 3300014325 Ga0163163_10223899 Ga0163163_102238992 221
44 iso_pu_bacteria 2883577096 2883579411 221
45 iso_pu_bacteria 2884960567 2884963357 221
46 iso_pu_bacteria 2857504554 2857509103 223
47 3300031239 Ga0265328_10000812 Ga0265328_100008122 224
48 3300031239 Ga0265328_10041171 Ga0265328_100411712 224
49 3300037853 Ga0436364_1562220 Ga0436364_1562220_818_1534 224
50 3300046507 Ga0495606_0001606 Ga0495606_0001606_551_1234 224
51 3300046520 Ga0495637_0011340 Ga0495637_0011340_2311_2994 224
52 3300046530 Ga0495654_0000095 Ga0495654_0000095_84711_85394 224
53 3300046660 Ga0495625_0000080 Ga0495625_0000080_72748_73431 224
54 3300046660 Ga0495625_0000759 Ga0495625_0000759_42956_43639 224
55 3300046660 Ga0495625_0000793 Ga0495625_0000793_36026_36709 224
56 3300046660 Ga0495625_0013830 Ga0495625_0013830_259_942 224
57 3300048918 Ga0496115_0042016 Ga0496115_0042016_1011_1694 224
58 3300053104 Ga0500556_0000178 Ga0500556_0000178_14964_15647 224
59 3300053134 Ga0500658_0002450 Ga0500658_0002450_3986_4669 224
60 3300053730 Ga0500645_001571 Ga0500645_001571_5950_6633 224
61 iso_pu_bacteria 2510917020 2511122430 224
62 iso_pu_bacteria 2582581279 2585147986 224
63 iso_pu_bacteria 2585428106 2587917861 224
64 iso_pu_bacteria 2643221545 2643750430 224
65 iso_pu_bacteria 2643221552 2643778475 224
66 iso_pu_bacteria 2643221583 2643924886 224
67 iso_pu_bacteria 2643221584 2643931371 224
68 iso_pu_bacteria 2643221640 2644226012 224
69 iso_pu_bacteria 2643221642 2644235501 224
70 iso_pu_bacteria 2643221691 2644507320 224
71 iso_pu_bacteria 2643221736 2644747341 224
72 iso_pu_bacteria 2791355048 2792462774 224
73 iso_pu_bacteria 2818991435 2819537997 224
74 iso_pu_bacteria 2818991454 2819648442 224
75 iso_pu_bacteria 2841760612 2841761898 224
76 iso_pu_bacteria 2841911363 2841916609 224
77 iso_pu_bacteria 2841917233 2841922506 224
78 iso_pu_bacteria 2843744320 2843749498 224
79 iso_pu_bacteria 2844104063 2844104923 224
80 iso_pu_bacteria 2849560528 2849562461 224
81 iso_pu_bacteria 2849573788 2849574926 224
82 iso_pu_bacteria 2851153111 2851155713 224
83 iso_pu_bacteria 2851182111 2851184883 224
84 iso_pu_bacteria 2851246043 2851247911 224
85 iso_pu_bacteria 2857472729 2857475153 224
86 iso_pu_bacteria 2898329390 2898332259 224
87 iso_pu_bacteria 2928531327 2928535188 224
88 iso_pu_bacteria 2928972540 2928973225 224
89 iso_pu_bacteria 2941485952 2941488251 224
90 iso_pu_bacteria 2977240413 2977242998 224
91 iso_pu_bacteria 2980182181 2980186047 224
92 iso_pu_bacteria 8057529695 8057529935 224
93 3300006353 Ga0075370_10118531 Ga0075370_101185312 225
94 3300021384 Ga0213876_10000544 Ga0213876_100005443 225
95 3300037853 Ga0436364_1236068 Ga0436364_1236068_417_1124 225
96 3300039437 Ga0436365_1544656 Ga0436365_1544656_11980_12687 225
97 3300039450 Ga0436363_0406098 Ga0436363_0406098_789_1496 225
98 3300003316 rootH1_10001606 rootH1_100016065 226
99 3300003322 rootL2_10009547 rootL2_1000954714 226
100 3300003773 Ga0055537_1021099 Ga0055537_10210991 226
101 3300003781 Ga0055536_1000492 Ga0055536_100049213 226
102 3300003790 Ga0055528_1003284 Ga0055528_10032844 226
103 3300003791 Ga0055530_10002951 Ga0055530_100029515 226
104 3300003792 Ga0055540_1024070 Ga0055540_10240702 226
105 3300003794 Ga0055531_10001503 Ga0055531_1000150310 226
106 3300005262 Ga0065165_1000615 Ga0065165_100061519 226
107 3300005335 Ga0070666_10119359 Ga0070666_101193592 226
108 3300005347 Ga0070668_100006229 Ga0070668_1000062295 226
109 3300005355 Ga0070671_100113386 Ga0070671_1001133862 226
110 3300005367 Ga0070667_100008230 Ga0070667_1000082302 226
111 3300005617 Ga0068859_100009457 Ga0068859_1000094573 226
112 3300005618 Ga0068864_100376671 Ga0068864_1003766712 226
113 3300005841 Ga0068863_100010741 Ga0068863_1000107413 226
114 3300005843 Ga0068860_100002211 Ga0068860_1000022112 226
115 3300005844 Ga0068862_100026586 Ga0068862_1000265863 226
116 3300006195 Ga0075366_10174258 Ga0075366_101742582 226
117 3300006931 Ga0097620_100009457 Ga0097620_1000094573 226
118 3300009177 Ga0105248_10356436 Ga0105248_103564362 226
119 3300009553 Ga0105249_10366527 Ga0105249_103665272 226
120 3300010375 Ga0105239_10557786 Ga0105239_105577861 226
121 3300025263 Ga0209565_1002647 Ga0209565_10026476 226
122 3300025273 Ga0209673_1000941 Ga0209673_100094131 226
123 3300025273 Ga0209673_1025428 Ga0209673_10254282 226
124 3300025291 Ga0209675_1007043 Ga0209675_10070435 226
125 3300025292 Ga0209676_1000057 Ga0209676_100005761 226
126 3300025295 Ga0209564_1000818 Ga0209564_100081835 226
127 3300025295 Ga0209564_1008755 Ga0209564_10087552 226
128 3300025297 Ga0209758_1008396 Ga0209758_10083963 226
129 3300025298 Ga0209050_1000522 Ga0209050_100052233 226
130 3300025298 Ga0209050_1022224 Ga0209050_10222241 226
131 3300025298 Ga0209050_1053425 Ga0209050_10534252 226
132 3300025299 Ga0209256_1000641 Ga0209256_100064118 226
133 3300025299 Ga0209256_1004707 Ga0209256_10047072 226
134 3300025299 Ga0209256_1005553 Ga0209256_10055531 226
135 3300025303 Ga0209051_1036036 Ga0209051_10360362 226
136 3300025304 Ga0209257_1000350 Ga0209257_100035042 226
137 3300025304 Ga0209257_1015918 Ga0209257_10159183 226
138 3300025931 Ga0207644_10178900 Ga0207644_101789002 226
139 3300025941 Ga0207711_10459954 Ga0207711_104599542 226
140 3300025961 Ga0207712_10133775 Ga0207712_101337752 226
141 3300025972 Ga0207668_10030398 Ga0207668_100303982 226
142 3300025986 Ga0207658_10011222 Ga0207658_100112222 226
143 3300026035 Ga0207703_10098925 Ga0207703_100989253 226
144 3300026067 Ga0207678_10380836 Ga0207678_103808362 226
145 3300026088 Ga0207641_10007409 Ga0207641_100074095 226
146 3300026095 Ga0207676_10333249 Ga0207676_103332492 226
147 3300026118 Ga0207675_100046221 Ga0207675_1000462213 226
148 3300028381 Ga0268264_10367226 Ga0268264_103672262 226
149 3300028794 Ga0307515_10032462 Ga0307515_100324624 226
150 3300028794 Ga0307515_10034337 Ga0307515_100343375 226
151 3300035089 Ga0373944_0034969 Ga0373944_0034969_591_1304 226
152 3300035695 Ga0373927_0013837 Ga0373927_0013837_3151_3864 226
153 3300037068 Ga0373925_0000760 Ga0373925_0000760_3129_3842 226
154 3300042436 Ga0439435_0006182 Ga0439435_0006182_628_1347 226
155 3300046457 Ga0495590_0006738 Ga0495590_0006738_138_836 226
156 3300046460 Ga0495638_0000419 Ga0495638_0000419_9476_10168 226
157 3300046460 Ga0495638_0000443 Ga0495638_0000443_23755_24453 226
158 3300046460 Ga0495638_0002701 Ga0495638_0002701_3521_4213 226
159 3300046471 Ga0495650_0000007 Ga0495650_0000007_111948_112640 226
160 3300046471 Ga0495650_0026021 Ga0495650_0026021_1139_1828 226
161 3300046471 Ga0495650_0124336 Ga0495650_0124336_117_815 226
162 3300046506 Ga0495583_0000037 Ga0495583_0000037_14161_14868 226
163 3300046512 Ga0495610_0000040 Ga0495610_0000040_149902_150594 226
164 3300046512 Ga0495610_0003437 Ga0495610_0003437_8329_9027 226
165 3300046513 Ga0495616_0000026 Ga0495616_0000026_9254_9946 226
166 3300046518 Ga0495631_0007680 Ga0495631_0007680_3006_3704 226
167 3300046519 Ga0495632_0004616 Ga0495632_0004616_3838_4530 226
168 3300046519 Ga0495632_0013381 Ga0495632_0013381_2072_2764 226
169 3300046519 Ga0495632_0034618 Ga0495632_0034618_315_1007 226
170 3300046520 Ga0495637_0010129 Ga0495637_0010129_2245_2937 226
171 3300046538 Ga0495609_0095937 Ga0495609_0095937_385_1077 226
172 3300046616 Ga0495668_0000019 Ga0495668_0000019_43145_43843 226
173 3300046616 Ga0495668_0037233 Ga0495668_0037233_26_724 226
174 3300046616 Ga0495668_0175065 Ga0495668_0175065_242_934 226
175 3300046660 Ga0495625_0137256 Ga0495625_0137256_124_822 226
176 3300046692 Ga0495671_0032336 Ga0495671_0032336_1144_1836 226
177 3300046692 Ga0495671_0093056 Ga0495671_0093056_82_780 226
178 3300046810 Ga0495660_0001672 Ga0495660_0001672_13042_13749 226
179 3300046810 Ga0495660_0019582 Ga0495660_0019582_1219_1926 226
180 3300046810 Ga0495660_0106441 Ga0495660_0106441_231_929 226
181 3300047320 Ga0495672_0002465 Ga0495672_0002465_8329_9021 226
182 3300047323 Ga0495683_0076173 Ga0495683_0076173_228_920 226
183 3300047469 Ga0495673_0000132 Ga0495673_0000132_90500_91192 226
184 3300047470 Ga0495681_0027795 Ga0495681_0027795_1587_2279 226
185 3300047472 Ga0495686_0000617 Ga0495686_0000617_30709_31407 226
186 3300047472 Ga0495686_0012381 Ga0495686_0012381_4527_5219 226
187 3300047472 Ga0495686_0151438 Ga0495686_0151438_253_960 226
188 3300048909 Ga0496106_0045878 Ga0496106_0045878_1683_2375 226
189 3300048910 Ga0496107_0000023 Ga0496107_0000023_22350_23042 226
190 3300048924 Ga0496121_0001031 Ga0496121_0001031_2619_3311 226
191 3300048928 Ga0496125_0073185 Ga0496125_0073185_352_1050 226
192 3300048929 Ga0496126_0022224 Ga0496126_0022224_3786_4484 226
193 3300049459 Ga0495678_001686 Ga0495678_001686_4576_5274 226
194 3300049581 Ga0501047_0053208 Ga0501047_0053208_3181_3903 226
195 3300049671 Ga0501238_001946 Ga0501238_001946_796_1485 226
196 3300049671 Ga0501238_005737 Ga0501238_005737_412_1101 226
197 3300050493 nmdc:mga0k408_213293_c1 nmdc:mga0k408_213293_c1_59_751 226
198 3300050496 nmdc:mga07m45_268780_c1 nmdc:mga07m45_268780_c1_16_723 226
199 3300053080 Ga0500635_0000131 Ga0500635_0000131_35895_36608 226
200 3300053086 Ga0500578_0002245 Ga0500578_0002245_11259_11957 226
201 3300053087 Ga0500643_000233 Ga0500643_000233_2841_3533 226
202 3300053088 Ga0500644_0019867 Ga0500644_0019867_395_1093 226
203 3300053096 Ga0500641_0006587 Ga0500641_0006587_712_1404 226
204 3300053104 Ga0500556_0004634 Ga0500556_0004634_2671_3363 226
205 3300053105 Ga0500557_002030 Ga0500557_002030_2046_2738 226
206 3300053108 Ga0500562_001309 Ga0500562_001309_11_718 226
207 3300053108 Ga0500562_008560 Ga0500562_008560_863_1561 226
208 3300053108 Ga0500562_027778 Ga0500562_027778_81_773 226
209 3300053118 Ga0500594_0000362 Ga0500594_0000362_1134_1832 226
210 3300053122 Ga0500608_000154 Ga0500608_000154_5695_6393 226
211 3300053122 Ga0500608_081960 Ga0500608_081960_560_1252 226
212 3300053136 Ga0500559_0004143 Ga0500559_0004143_654_1352 226
213 3300053136 Ga0500559_0010229 Ga0500559_0010229_1824_2516 226
214 3300053136 Ga0500559_0041053 Ga0500559_0041053_258_971 226
215 3300053142 Ga0500577_0010572 Ga0500577_0010572_955_1647 226
216 3300053150 Ga0500603_016231 Ga0500603_016231_599_1312 226
217 3300053153 Ga0500616_0026665 Ga0500616_0026665_888_1580 226
218 3300053153 Ga0500616_0066337 Ga0500616_0066337_450_1142 226
219 3300053156 Ga0500622_0001016 Ga0500622_0001016_17670_18368 226
220 3300053156 Ga0500622_0027830 Ga0500622_0027830_783_1475 226
221 3300053156 Ga0500622_0035604 Ga0500622_0035604_77_769 226
222 3300053157 Ga0500624_003119 Ga0500624_003119_1011_1724 226
223 3300053160 Ga0500633_0088099 Ga0500633_0088099_299_997 226
224 3300053177 Ga0500636_0012546 Ga0500636_0012546_3799_4512 226
225 3300053178 Ga0500637_0000997 Ga0500637_0000997_5056_5769 226
226 3300053730 Ga0500645_000566 Ga0500645_000566_10823_11515 226
227 3300053731 Ga0500609_000785 Ga0500609_000785_2794_3486 226
228 iso_pu_bacteria 2582581280 2585153822 226
229 iso_pu_bacteria 2582581293 2585198035 226
230 iso_pu_bacteria 2884960567 2884964937 226
231 3300003578 Ga0006562J51391_1040738 Ga0006562J51391_10407384 227
232 3300003578 Ga0006562J51391_1040739 Ga0006562J51391_10407394 227
233 3300003791 Ga0055530_10003766 Ga0055530_100037662 227
234 3300003794 Ga0055531_10000526 Ga0055531_100005267 227
235 3300003794 Ga0055531_10001323 Ga0055531_100013232 227
236 3300003794 Ga0055531_10007028 Ga0055531_100070286 227
237 3300003841 Ga0055541_1002814 Ga0055541_10028142 227
238 3300005262 Ga0065165_1000089 Ga0065165_100008931 227
239 3300005262 Ga0065165_1000602 Ga0065165_100060211 227
240 3300005331 Ga0070670_100064766 Ga0070670_1000647662 227
241 3300005335 Ga0070666_10201822 Ga0070666_102018222 227
242 3300005347 Ga0070668_100006525 Ga0070668_1000065253 227
243 3300005367 Ga0070667_100000169 Ga0070667_10000016938 227
244 3300005535 Ga0070684_100654636 Ga0070684_1006546361 227
245 3300005539 Ga0068853_100216163 Ga0068853_1002161632 227
246 3300005548 Ga0070665_100000610 Ga0070665_10000061013 227
247 3300005564 Ga0070664_100817217 Ga0070664_1008172172 227
248 3300005618 Ga0068864_100000182 Ga0068864_10000018211 227
249 3300005618 Ga0068864_100000220 Ga0068864_10000022010 227
250 3300005618 Ga0068864_100159005 Ga0068864_1001590051 227
251 3300005841 Ga0068863_100000101 Ga0068863_10000010187 227
252 3300005841 Ga0068863_100000185 Ga0068863_10000018536 227
253 3300005841 Ga0068863_100342728 Ga0068863_1003427282 227
254 3300005841 Ga0068863_100361988 Ga0068863_1003619882 227
255 3300005842 Ga0068858_100000260 Ga0068858_10000026050 227
256 3300005842 Ga0068858_100005192 Ga0068858_1000051923 227
257 3300005843 Ga0068860_100000211 Ga0068860_10000021141 227
258 3300005844 Ga0068862_100000514 Ga0068862_10000051440 227
259 3300006038 Ga0075365_10149476 Ga0075365_101494762 227
260 3300006042 Ga0075368_10020939 Ga0075368_100209392 227
261 3300006051 Ga0075364_10000257 Ga0075364_100002577 227
262 3300006177 Ga0075362_10115414 Ga0075362_101154142 227
263 3300006178 Ga0075367_10002033 Ga0075367_100020335 227
264 3300006195 Ga0075366_10269351 Ga0075366_102693512 227
265 3300006353 Ga0075370_10216460 Ga0075370_102164602 227
266 3300006353 Ga0075370_10226669 Ga0075370_102266692 227
267 3300006844 Ga0075428_100183654 Ga0075428_1001836542 227
268 3300006880 Ga0075429_100067367 Ga0075429_1000673673 227
269 3300006881 Ga0068865_100003518 Ga0068865_1000035182 227
270 3300009093 Ga0105240_10008146 Ga0105240_1000814614 227
271 3300009093 Ga0105240_10016466 Ga0105240_100164668 227
272 3300009101 Ga0105247_10057676 Ga0105247_100576762 227
273 3300009147 Ga0114129_10009638 Ga0114129_100096383 227
274 3300009177 Ga0105248_10000685 Ga0105248_1000068516 227
275 3300009177 Ga0105248_10013274 Ga0105248_100132742 227
276 3300009177 Ga0105248_10133470 Ga0105248_101334702 227
277 3300009553 Ga0105249_10001221 Ga0105249_1000122119 227
278 3300010375 Ga0105239_10207045 Ga0105239_102070452 227
279 3300013102 Ga0157371_10002938 Ga0157371_1000293811 227
280 3300013105 Ga0157369_10063047 Ga0157369_100630472 227
281 3300013296 Ga0157374_10171320 Ga0157374_101713201 227
282 3300013306 Ga0163162_10049558 Ga0163162_100495582 227
283 3300014325 Ga0163163_10049337 Ga0163163_100493372 227
284 3300014325 Ga0163163_10159130 Ga0163163_101591302 227
285 3300021361 Ga0213872_10003853 Ga0213872_100038534 227
286 3300025225 Ga0209566_100627 Ga0209566_10062719 227
287 3300025250 Ga0209026_1001342 Ga0209026_10013428 227
288 3300025250 Ga0209026_1019398 Ga0209026_10193982 227
289 3300025261 Ga0209233_1019891 Ga0209233_10198912 227
290 3300025272 Ga0209455_1028377 Ga0209455_10283772 227
291 3300025284 Ga0209130_1000087 Ga0209130_100008734 227
292 3300025292 Ga0209676_1000468 Ga0209676_100046830 227
293 3300025294 Ga0209025_1001185 Ga0209025_100118525 227
294 3300025294 Ga0209025_1017267 Ga0209025_10172672 227
295 3300025294 Ga0209025_1031095 Ga0209025_10310951 227
296 3300025297 Ga0209758_1001974 Ga0209758_100197410 227
297 3300025298 Ga0209050_1000098 Ga0209050_1000098158 227
298 3300025298 Ga0209050_1000486 Ga0209050_100048634 227
299 3300025302 Ga0207426_1026477 Ga0207426_10264772 227
300 3300025304 Ga0209257_1000235 Ga0209257_100023561 227
301 3300025304 Ga0209257_1000520 Ga0209257_100052020 227
302 3300025304 Ga0209257_1001269 Ga0209257_100126920 227
303 3300025903 Ga0207680_10049955 Ga0207680_100499552 227
304 3300025909 Ga0207705_10339660 Ga0207705_103396601 227
305 3300025911 Ga0207654_10358291 Ga0207654_103582912 227
306 3300025913 Ga0207695_10001222 Ga0207695_100012224 227
307 3300025913 Ga0207695_10017426 Ga0207695_100174264 227
308 3300025924 Ga0207694_10602971 Ga0207694_106029712 227
309 3300025924 Ga0207694_10878890 Ga0207694_108788901 227
310 3300025925 Ga0207650_10000160 Ga0207650_1000016052 227
311 3300025925 Ga0207650_10307073 Ga0207650_103070732 227
312 3300025938 Ga0207704_10000680 Ga0207704_100006808 227
313 3300025941 Ga0207711_10058478 Ga0207711_100584782 227
314 3300025941 Ga0207711_10206467 Ga0207711_102064673 227
315 3300025961 Ga0207712_10000203 Ga0207712_1000020326 227
316 3300025972 Ga0207668_10000116 Ga0207668_1000011612 227
317 3300025986 Ga0207658_10000341 Ga0207658_100003415 227
318 3300026035 Ga0207703_10000113 Ga0207703_100001132 227
319 3300026035 Ga0207703_10003627 Ga0207703_1000362710 227
320 3300026041 Ga0207639_10862855 Ga0207639_108628551 227
321 3300026088 Ga0207641_10000109 Ga0207641_1000010965 227
322 3300026088 Ga0207641_10005917 Ga0207641_100059179 227
323 3300026088 Ga0207641_10048774 Ga0207641_100487742 227
324 3300026095 Ga0207676_10000337 Ga0207676_1000033719 227
325 3300026095 Ga0207676_10000588 Ga0207676_1000058819 227
326 3300026118 Ga0207675_100707847 Ga0207675_1007078472 227
327 3300028379 Ga0268266_10561452 Ga0268266_105614522 227
328 3300028380 Ga0268265_10002154 Ga0268265_1000215413 227
329 3300028381 Ga0268264_10000270 Ga0268264_1000027051 227
330 3300028563 Ga0265319_1107584 Ga0265319_11075841 227
331 3300028577 Ga0265318_10084373 Ga0265318_100843732 227
332 3300028786 Ga0307517_10001670 Ga0307517_1000167015 227
333 3300028786 Ga0307517_10032853 Ga0307517_100328532 227
334 3300028794 Ga0307515_10125610 Ga0307515_101256102 227
335 3300028800 Ga0265338_10020391 Ga0265338_100203912 227
336 3300028800 Ga0265338_10025565 Ga0265338_100255653 227
337 3300028800 Ga0265338_10085751 Ga0265338_100857512 227
338 3300028800 Ga0265338_10099785 Ga0265338_100997852 227
339 3300028800 Ga0265338_10180698 Ga0265338_101806981 227
340 3300029957 Ga0265324_10049320 Ga0265324_100493201 227
341 3300031240 Ga0265320_10091249 Ga0265320_100912492 227
342 3300031251 Ga0265327_10017720 Ga0265327_100177204 227
343 3300031251 Ga0265327_10062736 Ga0265327_100627362 227
344 3300031456 Ga0307513_10004606 Ga0307513_1000460615 227
345 3300031711 Ga0265314_10239850 Ga0265314_102398502 227
346 3300031730 Ga0307516_10000022 Ga0307516_1000002238 227
347 3300031731 Ga0307405_10155522 Ga0307405_101555222 227
348 3300032004 Ga0307414_10018647 Ga0307414_100186474 227
349 3300032004 Ga0307414_10075260 Ga0307414_100752602 227
350 3300032004 Ga0307414_10223003 Ga0307414_102230032 227
351 3300032005 Ga0307411_10101058 Ga0307411_101010584 227
352 3300037312 Ga0395899_0000003 Ga0395899_0000003_1220240_1220929 227
353 3300037312 Ga0395899_0000516 Ga0395899_0000516_4883_5572 227
354 3300037418 Ga0395900_0000010 Ga0395900_0000010_20501_21190 227
355 3300037466 Ga0395898_0002619 Ga0395898_0002619_5851_6540 227
356 3300037471 Ga0395905_0147882 Ga0395905_0147882_306_995 227
357 3300038443 Ga0395901_0000007 Ga0395901_0000007_104863_105552 227
358 3300038705 Ga0237819_08123 Ga0237819_08123_163_858 227
359 3300039447 Ga0436361_0064356 Ga0436361_0064356_634_1323 227
360 3300039453 Ga0436362_0966972 Ga0436362_0966972_161_874 227
361 3300044712 Ga0453684_0209930 Ga0453684_0209930_1298_1996 227
362 3300044712 Ga0453684_0234750 Ga0453684_0234750_1381_2082 227
363 3300044712 Ga0453684_0512899 Ga0453684_0512899_35_718 227
364 3300044719 Ga0466971_0308242 Ga0466971_0308242_51_740 227
365 3300045049 Ga0466959_0020496 Ga0466959_0020496_698_1387 227
366 3300045051 Ga0451576_0000058 Ga0451576_0000058_262465_263160 227
367 3300046459 Ga0495629_0037061 Ga0495629_0037061_753_1442 227
368 3300046460 Ga0495638_0019659 Ga0495638_0019659_1211_1900 227
369 3300046506 Ga0495583_0136595 Ga0495583_0136595_77_766 227
370 3300046507 Ga0495606_0081722 Ga0495606_0081722_657_1349 227
371 3300046507 Ga0495606_0087496 Ga0495606_0087496_317_1006 227
372 3300046507 Ga0495606_0259839 Ga0495606_0259839_87_776 227
373 3300046515 Ga0495620_0022786 Ga0495620_0022786_119_808 227
374 3300046524 Ga0495648_0000068 Ga0495648_0000068_90048_90740 227
375 3300046538 Ga0495609_0071528 Ga0495609_0071528_730_1419 227
376 3300046542 Ga0495597_0005410 Ga0495597_0005410_4699_5388 227
377 3300046542 Ga0495597_0016365 Ga0495597_0016365_1926_2618 227
378 3300046558 Ga0495633_0002973 Ga0495633_0002973_1303_1992 227
379 3300046616 Ga0495668_0018873 Ga0495668_0018873_2564_3253 227
380 3300046648 Ga0495611_0001049 Ga0495611_0001049_9590_10279 227
381 3300046660 Ga0495625_0073911 Ga0495625_0073911_972_1661 227
382 3300046684 Ga0495669_0022824 Ga0495669_0022824_1208_1897 227
383 3300046689 Ga0495613_0003661 Ga0495613_0003661_252_941 227
384 3300046694 Ga0495649_0000928 Ga0495649_0000928_21295_21984 227
385 3300047320 Ga0495672_0073275 Ga0495672_0073275_1078_1773 227
386 3300047443 Ga0495687_040951 Ga0495687_040951_1080_1769 227
387 3300047469 Ga0495673_0003359 Ga0495673_0003359_5382_6074 227
388 3300047472 Ga0495686_0040540 Ga0495686_0040540_566_1255 227
389 3300048905 Ga0496102_0050630 Ga0496102_0050630_351_1052 227
390 3300048910 Ga0496107_0228297 Ga0496107_0228297_542_1231 227
391 3300048914 Ga0496111_0122981 Ga0496111_0122981_1094_1792 227
392 3300048918 Ga0496115_0410857 Ga0496115_0410857_365_1054 227
393 3300048918 Ga0496115_0717676 Ga0496115_0717676_52_741 227
394 3300048919 Ga0496116_0107799 Ga0496116_0107799_844_1542 227
395 3300048928 Ga0496125_0000481 Ga0496125_0000481_43007_43705 227
396 3300048928 Ga0496125_0002840 Ga0496125_0002840_11959_12663 227
397 3300048929 Ga0496126_0200258 Ga0496126_0200258_833_1528 227
398 3300049570 Ga0501033_0429051 Ga0501033_0429051_51_743 227
399 3300049571 Ga0501034_0846645 Ga0501034_0846645_95_790 227
400 3300049581 Ga0501047_0012301 Ga0501047_0012301_3088_3777 227
401 3300049581 Ga0501047_0203312 Ga0501047_0203312_923_1612 227
402 3300049822 Ga0501035_0217067 Ga0501035_0217067_452_1153 227
403 3300050491 nmdc:mga00v17_436_c1 nmdc:mga00v17_436_c1_409_1119 227
404 3300050492 nmdc:mga0yw44_110499_c1 nmdc:mga0yw44_110499_c1_647_1336 227
405 3300050493 nmdc:mga0k408_106040_c1 nmdc:mga0k408_106040_c1_47_739 227
406 3300050493 nmdc:mga0k408_75081_c1 nmdc:mga0k408_75081_c1_786_1496 227
407 3300050494 nmdc:mga06z11_27994_c1 nmdc:mga06z11_27994_c1_16_726 227
408 3300050496 nmdc:mga07m45_138263_c1 nmdc:mga07m45_138263_c1_628_1317 227
409 3300050496 nmdc:mga07m45_340_c1 nmdc:mga07m45_340_c1_21_731 227
410 3300050507 nmdc:mga05p37_24481_c1 nmdc:mga05p37_24481_c1_886_1581 227
411 3300050508 nmdc:mga09592_78745_c1 nmdc:mga09592_78745_c1_161_856 227
412 3300053080 Ga0500635_0000107 Ga0500635_0000107_10898_11587 227
413 3300053087 Ga0500643_007205 Ga0500643_007205_2950_3642 227
414 3300053088 Ga0500644_0000015 Ga0500644_0000015_14437_15129 227
415 3300053091 Ga0500647_0006311 Ga0500647_0006311_585_1274 227
416 3300053091 Ga0500647_0013773 Ga0500647_0013773_2128_2817 227
417 3300053092 Ga0500583_0008213 Ga0500583_0008213_1732_2421 227
418 3300053093 Ga0500651_0017672 Ga0500651_0017672_638_1327 227
419 3300053094 Ga0500566_0006578 Ga0500566_0006578_32_721 227
420 3300053096 Ga0500641_0000807 Ga0500641_0000807_9762_10460 227
421 3300053102 Ga0500554_012967 Ga0500554_012967_550_1245 227
422 3300053109 Ga0500569_000805 Ga0500569_000805_2315_3004 227
423 3300053118 Ga0500594_0117074 Ga0500594_0117074_22_717 227
424 3300053119 Ga0500595_001682 Ga0500595_001682_10166_10855 227
425 3300053119 Ga0500595_028144 Ga0500595_028144_324_1013 227
426 3300053121 Ga0500607_208957 Ga0500607_208957_81_776 227
427 3300053122 Ga0500608_013256 Ga0500608_013256_389_1078 227
428 3300053123 Ga0500614_005773 Ga0500614_005773_1398_2087 227
429 3300053136 Ga0500559_0000002 Ga0500559_0000002_190960_191703 227
430 3300053136 Ga0500559_0001879 Ga0500559_0001879_9201_9890 227
431 3300053136 Ga0500559_0202564 Ga0500559_0202564_40_729 227
432 3300053138 Ga0500564_000018 Ga0500564_000018_3640_4332 227
433 3300053140 Ga0500573_0040977 Ga0500573_0040977_1937_2626 227
434 3300053153 Ga0500616_0100637 Ga0500616_0100637_43_738 227
435 3300053155 Ga0500620_009524 Ga0500620_009524_337_1026 227
436 3300053156 Ga0500622_0011115 Ga0500622_0011115_1136_1828 227
437 3300053156 Ga0500622_0015139 Ga0500622_0015139_2520_3230 227
438 3300053177 Ga0500636_0000923 Ga0500636_0000923_10551_11240 227
439 3300053177 Ga0500636_0013651 Ga0500636_0013651_2895_3590 227
440 3300053177 Ga0500636_0169322 Ga0500636_0169322_176_865 227
441 3300053178 Ga0500637_0003641 Ga0500637_0003641_3535_4224 227
442 3300053178 Ga0500637_0003954 Ga0500637_0003954_2133_2822 227
443 3300053725 Ga0500576_040431 Ga0500576_040431_968_1657 227
444 3300053725 Ga0500576_141388 Ga0500576_141388_159_869 227
445 3300053730 Ga0500645_001125 Ga0500645_001125_13089_13778 227
446 3300053735 Ga0500596_000724 Ga0500596_000724_1356_2045 227
447 3300053737 Ga0500601_012862 Ga0500601_012862_185_874 227
448 2162886007 SwRhRL2b_contig_1033251 SwRhRL2b_0603.00007850 228
449 3300006186 Ga0075369_10007218 Ga0075369_100072182 228
450 3300037312 Ga0395899_0001452 Ga0395899_0001452_19471_20172 228
451 3300037312 Ga0395899_0002510 Ga0395899_0002510_13229_13930 228
452 3300037312 Ga0395899_0116065 Ga0395899_0116065_386_1087 228
453 3300044683 Ga0466965_0060547 Ga0466965_0060547_12_713 228
454 3300044684 Ga0466966_0047836 Ga0466966_0047836_1028_1729 228
455 3300044712 Ga0453684_0478082 Ga0453684_0478082_575_1261 228
456 3300045049 Ga0466959_0003037 Ga0466959_0003037_8327_9028 228
457 3300048909 Ga0496106_0556840 Ga0496106_0556840_195_887 228
458 3300048927 Ga0496124_0014207 Ga0496124_0014207_5902_6612 228
459 3300050516 nmdc:mga0sz30_4001_c1 nmdc:mga0sz30_4001_c1_4061_4771 228
460 3300053136 Ga0500559_0000005 Ga0500559_0000005_65701_66405 228
461 3300053160 Ga0500633_0021348 Ga0500633_0021348_63_761 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

151

227

0.98

PF00072

Response_reg

Response regulator receiver domain

7

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9893 6 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9886 6 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9876 6 122
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9823 6 123
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9797 6 123
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9989 6 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9879 6 81 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9875 6 81 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9832 6 124 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9743 6 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1U1M754-F1-model_v4 deleted 0.8602 27 228
AF-A0A7C4KIW9-F1-model_v4 Response regulator transcription factor 0.8568 1 174 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2U3MV66-F1-model_v4 KDP operon transcriptional regulatory protein KdpE 0.8555 3 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-B0T7K3-F1-model_v4 Two component transcriptional regulator, winged helix family 0.8472 42 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2U3MV66-F1-model_v4 KDP operon transcriptional regulatory protein KdpE 0.8422 3 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
91.28 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map