F447981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 457 | 289 | 457 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300010159|Ga0099796_10254114|Ga0099796_102541142 |
| Length | 76 |
| Sequence | MAHEVVLPQLGFSMTDGSLVEWLVKDGDNIQAGAAIFSLETDKSVQEIESPAAGKIRILKAAGQTYAVGEILAVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 127 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 147 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 148 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 149 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 150 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 152 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 153 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 156 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 157 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 158 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 159 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 160 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 163 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 164 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 165 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 166 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 167 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 168 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 169 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 170 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 171 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 172 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 173 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 174 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 175 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 176 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 177 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 178 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 179 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 180 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 181 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 182 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 183 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 184 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 185 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 186 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 187 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 276 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 278 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 282 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 285 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 286 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 287 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.1 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 84.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000005 | 3300001979 | Bacteria | 87250 |
| 2 | JGI24737J22298_10000035 | 3300001990 | Bacteria | 39357 |
| 3 | JGI24751J29686_10013487 | 3300002459 | Bacteria | 1687 |
| 4 | Ga0065714_10261868 | 3300005288 | Bacteria | 755 |
| 5 | Ga0065704_10206420 | 3300005289 | Unclassified | 1111 |
| 6 | Ga0065704_10312160 | 3300005289 | Unclassified | 866 |
| 7 | Ga0065707_10000650 | 3300005295 | Bacteria | 17766 |
| 8 | Ga0065707_10329442 | 3300005295 | Bacteria | 946 |
| 9 | Ga0065707_10475088 | 3300005295 | Bacteria | 772 |
| 10 | Ga0070658_10006589 | 3300005327 | Bacteria | 9413 |
| 11 | Ga0070658_10010567 | 3300005327 | Bacteria | 7398 |
| 12 | Ga0070683_100640773 | 3300005329 | Bacteria | 1017 |
| 13 | Ga0068869_100087752 | 3300005334 | Bacteria | 2334 |
| 14 | Ga0068869_100211419 | 3300005334 | Bacteria | 1534 |
| 15 | Ga0068868_100008430 | 3300005338 | Bacteria | 7380 |
| 16 | Ga0068868_100117825 | 3300005338 | Bacteria | 2164 |
| 17 | Ga0070660_100313746 | 3300005339 | Bacteria | 1287 |
| 18 | Ga0070660_100645285 | 3300005339 | Bacteria | 886 |
| 19 | Ga0070661_100000015 | 3300005344 | Bacteria | 156690 |
| 20 | Ga0070661_100000903 | 3300005344 | Bacteria | 21290 |
| 21 | Ga0070669_101023640 | 3300005353 | Bacteria | 709 |
| 22 | Ga0070671_101276421 | 3300005355 | Bacteria | 647 |
| 23 | Ga0070673_100601228 | 3300005364 | Bacteria | 1003 |
| 24 | Ga0070673_101728157 | 3300005364 | Bacteria | 592 |
| 25 | Ga0070688_100573678 | 3300005365 | Bacteria | 860 |
| 26 | Ga0070659_100012886 | 3300005366 | Bacteria | 6214 |
| 27 | Ga0070659_100262835 | 3300005366 | Bacteria | 1432 |
| 28 | Ga0070659_101249452 | 3300005366 | Bacteria | 658 |
| 29 | Ga0070667_100000694 | 3300005367 | Bacteria | 32459 |
| 30 | Ga0070667_100162817 | 3300005367 | Bacteria | 1966 |
| 31 | Ga0070708_100368142 | 3300005445 | Bacteria | 1355 |
| 32 | Ga0070663_100021576 | 3300005455 | Bacteria | 4287 |
| 33 | Ga0070663_100022834 | 3300005455 | Bacteria | 4186 |
| 34 | Ga0070663_100902843 | 3300005455 | Bacteria | 763 |
| 35 | Ga0070678_100067935 | 3300005456 | Bacteria | 2655 |
| 36 | Ga0070662_100036764 | 3300005457 | Bacteria | 3467 |
| 37 | Ga0068867_100112098 | 3300005459 | Bacteria | 2097 |
| 38 | Ga0068867_100347907 | 3300005459 | Bacteria | 1236 |
| 39 | Ga0070685_11519875 | 3300005466 | Unclassified | 516 |
| 40 | Ga0070707_100153523 | 3300005468 | Bacteria | 2242 |
| 41 | Ga0070699_100125407 | 3300005518 | Bacteria | 2260 |
| 42 | Ga0070684_100013015 | 3300005535 | Bacteria | 6694 |
| 43 | Ga0068853_100031044 | 3300005539 | Bacteria | 4517 |
| 44 | Ga0068853_100111825 | 3300005539 | Bacteria | 2427 |
| 45 | Ga0068853_100686125 | 3300005539 | Bacteria | 976 |
| 46 | Ga0068853_101804121 | 3300005539 | Bacteria | 593 |
| 47 | Ga0070665_100405739 | 3300005548 | Bacteria | 1371 |
| 48 | Ga0070665_100538950 | 3300005548 | Bacteria | 1179 |
| 49 | Ga0070665_100681383 | 3300005548 | Bacteria | 1041 |
| 50 | Ga0068855_100081673 | 3300005563 | Bacteria | 3746 |
| 51 | Ga0068855_100514985 | 3300005563 | Bacteria | 1299 |
| 52 | Ga0070664_100000015 | 3300005564 | Bacteria | 128718 |
| 53 | Ga0070664_100007168 | 3300005564 | Bacteria | 8986 |
| 54 | Ga0068857_100087366 | 3300005577 | Bacteria | 2789 |
| 55 | Ga0068857_100110858 | 3300005577 | Bacteria | 2466 |
| 56 | Ga0068857_100140614 | 3300005577 | Bacteria | 2182 |
| 57 | Ga0068854_100021361 | 3300005578 | Bacteria | 4392 |
| 58 | Ga0068854_100037838 | 3300005578 | Bacteria | 3389 |
| 59 | Ga0068854_101047946 | 3300005578 | Bacteria | 724 |
| 60 | Ga0068856_100074577 | 3300005614 | Bacteria | 3359 |
| 61 | Ga0068852_100033145 | 3300005616 | Bacteria | 4286 |
| 62 | Ga0068852_100098202 | 3300005616 | Bacteria | 2637 |
| 63 | Ga0068852_100136609 | 3300005616 | Bacteria | 2264 |
| 64 | Ga0068852_100385202 | 3300005616 | Bacteria | 1376 |
| 65 | Ga0068852_100744232 | 3300005616 | Bacteria | 992 |
| 66 | Ga0068859_100192286 | 3300005617 | Bacteria | 2125 |
| 67 | Ga0068859_100827115 | 3300005617 | Bacteria | 1013 |
| 68 | Ga0068864_100336482 | 3300005618 | Bacteria | 1421 |
| 69 | Ga0068866_10739982 | 3300005718 | Bacteria | 678 |
| 70 | Ga0068861_100003019 | 3300005719 | Bacteria | 11113 |
| 71 | Ga0068851_10003361 | 3300005834 | Bacteria | 7117 |
| 72 | Ga0068870_10318765 | 3300005840 | Bacteria | 987 |
| 73 | Ga0068863_100151482 | 3300005841 | Bacteria | 2219 |
| 74 | Ga0068863_101952233 | 3300005841 | Bacteria | 597 |
| 75 | Ga0068860_100016210 | 3300005843 | Bacteria | 7268 |
| 76 | Ga0068860_100051362 | 3300005843 | Bacteria | 3923 |
| 77 | Ga0068860_100969107 | 3300005843 | Bacteria | 868 |
| 78 | Ga0068860_101182539 | 3300005843 | Bacteria | 785 |
| 79 | Ga0075362_10017470 | 3300006177 | Bacteria | 2955 |
| 80 | Ga0075362_10113942 | 3300006177 | Bacteria | 1275 |
| 81 | Ga0075362_10409571 | 3300006177 | Bacteria | 685 |
| 82 | Ga0075367_10030769 | 3300006178 | Bacteria | 3079 |
| 83 | Ga0075366_10017075 | 3300006195 | Bacteria | 4173 |
| 84 | Ga0075366_10086544 | 3300006195 | Bacteria | 1875 |
| 85 | Ga0075366_10335277 | 3300006195 | Bacteria | 927 |
| 86 | Ga0075370_10013122 | 3300006353 | Bacteria | 4396 |
| 87 | Ga0075370_10419328 | 3300006353 | Bacteria | 804 |
| 88 | Ga0068871_101023479 | 3300006358 | Bacteria | 770 |
| 89 | Ga0068865_100067885 | 3300006881 | Bacteria | 2520 |
| 90 | Ga0097620_100192295 | 3300006931 | Bacteria | 2125 |
| 91 | Ga0097620_100827116 | 3300006931 | Bacteria | 1013 |
| 92 | Ga0105250_10083437 | 3300009092 | Bacteria | 1297 |
| 93 | Ga0105240_10008102 | 3300009093 | Bacteria | 15088 |
| 94 | Ga0105240_10015784 | 3300009093 | Bacteria | 10249 |
| 95 | Ga0105240_10270998 | 3300009093 | Bacteria | 1954 |
| 96 | Ga0105240_12216359 | 3300009093 | Bacteria | 569 |
| 97 | Ga0105245_10121818 | 3300009098 | Bacteria | 2438 |
| 98 | Ga0105245_10678099 | 3300009098 | Bacteria | 1063 |
| 99 | Ga0105247_10017410 | 3300009101 | Bacteria | 4314 |
| 100 | Ga0105247_10749752 | 3300009101 | Unclassified | 740 |
| 101 | Ga0105247_11049843 | 3300009101 | Bacteria | 640 |
| 102 | Ga0105243_10077425 | 3300009148 | Bacteria | 2705 |
| 103 | Ga0105241_10013755 | 3300009174 | Bacteria | 5928 |
| 104 | Ga0105241_10087732 | 3300009174 | Bacteria | 2449 |
| 105 | Ga0105241_11050887 | 3300009174 | Bacteria | 764 |
| 106 | Ga0105242_10095776 | 3300009176 | Bacteria | 2506 |
| 107 | Ga0105248_10071390 | 3300009177 | Unclassified | 3901 |
| 108 | Ga0105237_10000736 | 3300009545 | Bacteria | 45152 |
| 109 | Ga0105237_10040247 | 3300009545 | Bacteria | 4714 |
| 110 | Ga0105237_10561871 | 3300009545 | Bacteria | 1148 |
| 111 | Ga0105237_10937157 | 3300009545 | Bacteria | 873 |
| 112 | Ga0105238_10000822 | 3300009551 | Bacteria | 32108 |
| 113 | Ga0105238_11148837 | 3300009551 | Bacteria | 800 |
| 114 | Ga0099796_10254114 | 3300010159 | Bacteria | 731 |
| 115 | Ga0105239_10001794 | 3300010375 | Bacteria | 28177 |
| 116 | Ga0105239_10002743 | 3300010375 | Bacteria | 22119 |
| 117 | Ga0105239_10605889 | 3300010375 | Bacteria | 1249 |
| 118 | Ga0105246_10040038 | 3300011119 | Bacteria | 3161 |
| 119 | Ga0157373_10012249 | 3300013100 | Bacteria | 6305 |
| 120 | Ga0157371_10000111 | 3300013102 | Bacteria | 123977 |
| 121 | Ga0157371_10173484 | 3300013102 | Bacteria | 1541 |
| 122 | Ga0157370_10022785 | 3300013104 | Bacteria | 6230 |
| 123 | Ga0157370_10100194 | 3300013104 | Bacteria | 2714 |
| 124 | Ga0157370_10247139 | 3300013104 | Bacteria | 1650 |
| 125 | Ga0157369_10000126 | 3300013105 | Bacteria | 109644 |
| 126 | Ga0157369_10007456 | 3300013105 | Bacteria | 12599 |
| 127 | Ga0157369_10092229 | 3300013105 | Bacteria | 3232 |
| 128 | Ga0157374_10590382 | 3300013296 | Bacteria | 1120 |
| 129 | Ga0157374_11802204 | 3300013296 | Bacteria | 637 |
| 130 | Ga0163162_10138600 | 3300013306 | Bacteria | 2544 |
| 131 | Ga0163162_10641242 | 3300013306 | Bacteria | 1186 |
| 132 | Ga0163162_11735630 | 3300013306 | Unclassified | 713 |
| 133 | Ga0157372_10248725 | 3300013307 | Bacteria | 2063 |
| 134 | Ga0157375_10031824 | 3300013308 | Bacteria | 4995 |
| 135 | Ga0157375_11637002 | 3300013308 | Bacteria | 761 |
| 136 | Ga0163163_10041826 | 3300014325 | Bacteria | 4484 |
| 137 | Ga0157380_10001410 | 3300014326 | Bacteria | 15719 |
| 138 | Ga0157377_11038578 | 3300014745 | Bacteria | 623 |
| 139 | Ga0157379_10153130 | 3300014968 | Unclassified | 2080 |
| 140 | Ga0157379_10950362 | 3300014968 | Unclassified | 817 |
| 141 | Ga0182007_10157521 | 3300015262 | Bacteria | 775 |
| 142 | Ga0213872_10184468 | 3300021361 | Bacteria | 900 |
| 143 | Ga0213875_10001099 | 3300021388 | Bacteria | 18747 |
| 144 | Ga0209233_1017417 | 3300025261 | Bacteria | 1958 |
| 145 | Ga0207656_10043473 | 3300025321 | Bacteria | 1916 |
| 146 | Ga0207655_1009463 | 3300025728 | Bacteria | 6041 |
| 147 | Ga0207710_10525527 | 3300025900 | Bacteria | 615 |
| 148 | Ga0207647_10180294 | 3300025904 | Bacteria | 1227 |
| 149 | Ga0207647_10403092 | 3300025904 | Bacteria | 770 |
| 150 | Ga0207645_10117326 | 3300025907 | Bacteria | 1726 |
| 151 | Ga0207705_10000273 | 3300025909 | Bacteria | 49361 |
| 152 | Ga0207705_10016908 | 3300025909 | Bacteria | 5225 |
| 153 | Ga0207705_11258022 | 3300025909 | Bacteria | 566 |
| 154 | Ga0207654_10000157 | 3300025911 | Bacteria | 43470 |
| 155 | Ga0207654_10172250 | 3300025911 | Bacteria | 1406 |
| 156 | Ga0207654_10645027 | 3300025911 | Bacteria | 758 |
| 157 | Ga0207695_10001225 | 3300025913 | Bacteria | 43972 |
| 158 | Ga0207695_10037983 | 3300025913 | Bacteria | 5191 |
| 159 | Ga0207695_10250448 | 3300025913 | Bacteria | 1671 |
| 160 | Ga0207671_10000018 | 3300025914 | Bacteria | 318130 |
| 161 | Ga0207671_10000676 | 3300025914 | Bacteria | 44438 |
| 162 | Ga0207671_10002655 | 3300025914 | Bacteria | 18788 |
| 163 | Ga0207671_10266173 | 3300025914 | Bacteria | 1350 |
| 164 | Ga0207657_10000074 | 3300025919 | Bacteria | 93185 |
| 165 | Ga0207657_10032080 | 3300025919 | Bacteria | 4750 |
| 166 | Ga0207657_11139472 | 3300025919 | Bacteria | 595 |
| 167 | Ga0207649_10000008 | 3300025920 | Bacteria | 315683 |
| 168 | Ga0207649_10001814 | 3300025920 | Bacteria | 12190 |
| 169 | Ga0207646_10195448 | 3300025922 | Bacteria | 1827 |
| 170 | Ga0207694_10012995 | 3300025924 | Bacteria | 6269 |
| 171 | Ga0207694_10162123 | 3300025924 | Bacteria | 1806 |
| 172 | Ga0207694_10969312 | 3300025924 | Bacteria | 719 |
| 173 | Ga0207687_10190966 | 3300025927 | Bacteria | 1594 |
| 174 | Ga0207687_10193273 | 3300025927 | Bacteria | 1585 |
| 175 | Ga0207687_10367327 | 3300025927 | Bacteria | 1176 |
| 176 | Ga0207644_10114328 | 3300025931 | Bacteria | 2045 |
| 177 | Ga0207644_10598077 | 3300025931 | Bacteria | 916 |
| 178 | Ga0207690_10001426 | 3300025932 | Bacteria | 14972 |
| 179 | Ga0207706_10020821 | 3300025933 | Bacteria | 5891 |
| 180 | Ga0207706_10574565 | 3300025933 | Bacteria | 969 |
| 181 | Ga0207706_11428109 | 3300025933 | Bacteria | 567 |
| 182 | Ga0207686_10000455 | 3300025934 | Bacteria | 27218 |
| 183 | Ga0207704_10051827 | 3300025938 | Bacteria | 2484 |
| 184 | Ga0207691_10112597 | 3300025940 | Bacteria | 2418 |
| 185 | Ga0207689_10162425 | 3300025942 | Bacteria | 1840 |
| 186 | Ga0207689_10285123 | 3300025942 | Bacteria | 1368 |
| 187 | Ga0207661_10571687 | 3300025944 | Bacteria | 1036 |
| 188 | Ga0207679_10000008 | 3300025945 | Bacteria | 412057 |
| 189 | Ga0207679_10039310 | 3300025945 | Bacteria | 3377 |
| 190 | Ga0207679_11700277 | 3300025945 | Bacteria | 577 |
| 191 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 192 | Ga0207667_10000422 | 3300025949 | Bacteria | 57069 |
| 193 | Ga0207667_10468724 | 3300025949 | Bacteria | 1279 |
| 194 | Ga0207651_10689308 | 3300025960 | Bacteria | 899 |
| 195 | Ga0207651_10728962 | 3300025960 | Bacteria | 875 |
| 196 | Ga0207640_10417363 | 3300025981 | Bacteria | 1097 |
| 197 | Ga0207640_10872490 | 3300025981 | Bacteria | 784 |
| 198 | Ga0207658_10007422 | 3300025986 | Bacteria | 7477 |
| 199 | Ga0207658_11328139 | 3300025986 | Bacteria | 658 |
| 200 | Ga0207677_10021742 | 3300026023 | Bacteria | 3927 |
| 201 | Ga0207677_10199980 | 3300026023 | Bacteria | 1587 |
| 202 | Ga0207703_10954245 | 3300026035 | Bacteria | 822 |
| 203 | Ga0207703_11004712 | 3300026035 | Bacteria | 800 |
| 204 | Ga0207639_10001113 | 3300026041 | Bacteria | 18264 |
| 205 | Ga0207639_10271050 | 3300026041 | Bacteria | 1489 |
| 206 | Ga0207639_10464329 | 3300026041 | Bacteria | 1151 |
| 207 | Ga0207639_10681621 | 3300026041 | Bacteria | 953 |
| 208 | Ga0207678_10000056 | 3300026067 | Bacteria | 86903 |
| 209 | Ga0207678_10038439 | 3300026067 | Bacteria | 4158 |
| 210 | Ga0207702_10000087 | 3300026078 | Bacteria | 105856 |
| 211 | Ga0207641_11682743 | 3300026088 | Bacteria | 636 |
| 212 | Ga0207641_11771736 | 3300026088 | Bacteria | 619 |
| 213 | Ga0207648_10937594 | 3300026089 | Bacteria | 810 |
| 214 | Ga0207676_10454428 | 3300026095 | Unclassified | 1208 |
| 215 | Ga0207674_10000121 | 3300026116 | Bacteria | 90479 |
| 216 | Ga0207674_10008453 | 3300026116 | Bacteria | 11889 |
| 217 | Ga0207674_10260657 | 3300026116 | Bacteria | 1681 |
| 218 | Ga0207674_10535894 | 3300026116 | Bacteria | 1131 |
| 219 | Ga0207675_100004458 | 3300026118 | Bacteria | 13529 |
| 220 | Ga0207683_10167803 | 3300026121 | Bacteria | 1987 |
| 221 | Ga0207698_10007449 | 3300026142 | Bacteria | 6853 |
| 222 | Ga0207698_10007557 | 3300026142 | Bacteria | 6814 |
| 223 | Ga0207698_10022572 | 3300026142 | Bacteria | 4377 |
| 224 | Ga0207698_10036664 | 3300026142 | Bacteria | 3602 |
| 225 | Ga0207698_11093971 | 3300026142 | Bacteria | 810 |
| 226 | Ga0209813_10112395 | 3300027866 | Bacteria | 940 |
| 227 | Ga0268266_10349086 | 3300028379 | Bacteria | 1390 |
| 228 | Ga0268264_10003717 | 3300028381 | Bacteria | 13111 |
| 229 | Ga0268264_10061599 | 3300028381 | Bacteria | 3148 |
| 230 | Ga0268264_10070808 | 3300028381 | Bacteria | 2953 |
| 231 | Ga0268264_11112681 | 3300028381 | Bacteria | 798 |
| 232 | Ga0265338_10224982 | 3300028800 | Unclassified | 1399 |
| 233 | Ga0307511_10000656 | 3300030521 | Bacteria | 36892 |
| 234 | Ga0307511_10101474 | 3300030521 | Bacteria | 1886 |
| 235 | Ga0307513_10485254 | 3300031456 | Bacteria | 955 |
| 236 | Ga0307408_100128977 | 3300031548 | Bacteria | 1970 |
| 237 | Ga0307408_101191501 | 3300031548 | Bacteria | 710 |
| 238 | Ga0307508_10467092 | 3300031616 | Bacteria | 855 |
| 239 | Ga0307516_10000363 | 3300031730 | Bacteria | 59029 |
| 240 | Ga0307516_10000935 | 3300031730 | Bacteria | 40230 |
| 241 | Ga0307405_10250099 | 3300031731 | Bacteria | 1318 |
| 242 | Ga0307407_11656427 | 3300031903 | Bacteria | 509 |
| 243 | Ga0307416_100125751 | 3300032002 | Bacteria | 2296 |
| 244 | Ga0307414_10380890 | 3300032004 | Bacteria | 1220 |
| 245 | Ga0307411_10129770 | 3300032005 | Bacteria | 1840 |
| 246 | Ga0373946_0651066 | 3300035171 | Bacteria | 549 |
| 247 | Ga0316574_0157195 | 3300035398 | Unclassified | 1465 |
| 248 | Ga0373927_0296103 | 3300035695 | Unclassified | 1065 |
| 249 | Ga0316584_0145185 | 3300036712 | Bacteria | 1768 |
| 250 | Ga0373925_0243698 | 3300037068 | Bacteria | 1440 |
| 251 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 252 | Ga0395900_0000090 | 3300037418 | Bacteria | 169213 |
| 253 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 254 | Ga0395905_0035294 | 3300037471 | Bacteria | 4695 |
| 255 | Ga0395905_0052766 | 3300037471 | Bacteria | 3806 |
| 256 | Ga0395905_0113931 | 3300037471 | Bacteria | 2541 |
| 257 | Ga0395905_1087877 | 3300037471 | Bacteria | 703 |
| 258 | Ga0395905_1553125 | 3300037471 | Bacteria | 566 |
| 259 | Ga0436364_0206190 | 3300037853 | Bacteria | 18748 |
| 260 | Ga0395901_0000096 | 3300038443 | Bacteria | 118723 |
| 261 | Ga0436361_0462301 | 3300039447 | Bacteria | 1995 |
| 262 | Ga0439436_0004367 | 3300041404 | Bacteria | 4330 |
| 263 | Ga0439438_018409 | 3300041405 | Bacteria | 1991 |
| 264 | Ga0439447_003200 | 3300041407 | Bacteria | 5831 |
| 265 | Ga0439447_003283 | 3300041407 | Bacteria | 5753 |
| 266 | Ga0439447_021042 | 3300041407 | Bacteria | 1722 |
| 267 | Ga0439447_033135 | 3300041407 | Bacteria | 1289 |
| 268 | Ga0439453_0074224 | 3300041408 | Bacteria | 724 |
| 269 | Ga0439466_0001270 | 3300041411 | Bacteria | 9813 |
| 270 | Ga0439466_0013928 | 3300041411 | Bacteria | 2937 |
| 271 | Ga0439466_0086609 | 3300041411 | Bacteria | 984 |
| 272 | Ga0451800_0537557 | 3300041459 | Bacteria | 652 |
| 273 | Ga0451833_0464823 | 3300041491 | Bacteria | 695 |
| 274 | Ga0451841_1339644 | 3300041498 | Bacteria | 663 |
| 275 | Ga0451851_1363885 | 3300041507 | Bacteria | 731 |
| 276 | Ga0451853_1179022 | 3300041512 | Bacteria | 593 |
| 277 | Ga0439431_0099577 | 3300041997 | Bacteria | 798 |
| 278 | Ga0439437_059059 | 3300042000 | Bacteria | 518 |
| 279 | Ga0439442_003490 | 3300042002 | Bacteria | 3107 |
| 280 | Ga0439445_0077812 | 3300042004 | Bacteria | 924 |
| 281 | Ga0439448_0111614 | 3300042005 | Bacteria | 934 |
| 282 | Ga0439432_055267 | 3300042006 | Bacteria | 1232 |
| 283 | Ga0439449_0000685 | 3300042007 | Bacteria | 12906 |
| 284 | Ga0439451_115054 | 3300042009 | Bacteria | 546 |
| 285 | Ga0439452_000097 | 3300042010 | Bacteria | 74034 |
| 286 | Ga0439452_033569 | 3300042010 | Bacteria | 1245 |
| 287 | Ga0439457_121492 | 3300042014 | Bacteria | 617 |
| 288 | Ga0439462_0124477 | 3300042015 | Bacteria | 718 |
| 289 | Ga0439462_0179527 | 3300042015 | Bacteria | 600 |
| 290 | Ga0450911_020428 | 3300042115 | Bacteria | 865 |
| 291 | Ga0450917_016777 | 3300042120 | Bacteria | 628 |
| 292 | Ga0450919_045427 | 3300042121 | Bacteria | 513 |
| 293 | Ga0450922_015240 | 3300042124 | Bacteria | 763 |
| 294 | Ga0450888_013259 | 3300042126 | Bacteria | 985 |
| 295 | Ga0450890_009979 | 3300042127 | Bacteria | 1220 |
| 296 | Ga0450890_040655 | 3300042127 | Bacteria | 687 |
| 297 | Ga0450892_007982 | 3300042130 | Bacteria | 900 |
| 298 | Ga0450894_008540 | 3300042131 | Bacteria | 1326 |
| 299 | Ga0450894_029467 | 3300042131 | Bacteria | 762 |
| 300 | Ga0450896_016615 | 3300042133 | Bacteria | 1058 |
| 301 | Ga0450898_023474 | 3300042134 | Bacteria | 1097 |
| 302 | Ga0450898_033780 | 3300042134 | Bacteria | 948 |
| 303 | Ga0450902_000036 | 3300042137 | Bacteria | 11633 |
| 304 | Ga0450902_104775 | 3300042137 | Bacteria | 505 |
| 305 | Ga0450904_017801 | 3300042139 | Bacteria | 714 |
| 306 | Ga0450889_016098 | 3300042144 | Bacteria | 806 |
| 307 | Ga0450906_003443 | 3300042145 | Bacteria | 3404 |
| 308 | Ga0450910_024342 | 3300042147 | Unclassified | 929 |
| 309 | Ga0450909_033110 | 3300042185 | Bacteria | 786 |
| 310 | Ga0450909_057128 | 3300042185 | Bacteria | 613 |
| 311 | Ga0439434_0003238 | 3300042435 | Bacteria | 4781 |
| 312 | Ga0439434_0142621 | 3300042435 | Bacteria | 790 |
| 313 | Ga0439435_0054405 | 3300042436 | Bacteria | 1152 |
| 314 | Ga0439464_0032748 | 3300042439 | Bacteria | 1461 |
| 315 | Ga0450918_016821 | 3300042531 | Bacteria | 1272 |
| 316 | Ga0450893_0003000 | 3300042532 | Bacteria | 2656 |
| 317 | Ga0450893_0009885 | 3300042532 | Bacteria | 1561 |
| 318 | Ga0450893_0011595 | 3300042532 | Bacteria | 1458 |
| 319 | Ga0439440_0291816 | 3300042993 | Bacteria | 506 |
| 320 | Ga0466969_0040069 | 3300044656 | Bacteria | 2349 |
| 321 | Ga0466969_0058586 | 3300044656 | Bacteria | 1874 |
| 322 | Ga0466972_0090436 | 3300044658 | Bacteria | 1452 |
| 323 | Ga0466972_0421699 | 3300044658 | Unclassified | 626 |
| 324 | Ga0453683_0945142 | 3300044673 | Bacteria | 571 |
| 325 | Ga0466965_0013067 | 3300044683 | Bacteria | 3913 |
| 326 | Ga0466966_0000033 | 3300044684 | Bacteria | 101862 |
| 327 | Ga0466966_0031451 | 3300044684 | Bacteria | 3441 |
| 328 | Ga0466961_0000428 | 3300044693 | Bacteria | 26796 |
| 329 | Ga0466961_0404245 | 3300044693 | Bacteria | 828 |
| 330 | Ga0466963_0028390 | 3300044694 | Bacteria | 3592 |
| 331 | Ga0466963_0302621 | 3300044694 | Bacteria | 1125 |
| 332 | Ga0466964_0035925 | 3300044706 | Bacteria | 1984 |
| 333 | Ga0453684_0026763 | 3300044712 | Bacteria | 8311 |
| 334 | Ga0466971_0052112 | 3300044719 | Bacteria | 1843 |
| 335 | Ga0466970_0048027 | 3300044765 | Bacteria | 2275 |
| 336 | Ga0466957_0035050 | 3300044842 | Bacteria | 3011 |
| 337 | Ga0466959_0079309 | 3300045049 | Bacteria | 2367 |
| 338 | Ga0466959_0141535 | 3300045049 | Bacteria | 1699 |
| 339 | Ga0451576_0043364 | 3300045051 | Bacteria | 4747 |
| 340 | Ga0451576_0809330 | 3300045051 | Bacteria | 984 |
| 341 | Ga0466958_0008900 | 3300045836 | Bacteria | 5576 |
| 342 | Ga0466958_0023611 | 3300045836 | Bacteria | 3612 |
| 343 | Ga0495590_0171019 | 3300046457 | Bacteria | 792 |
| 344 | Ga0495629_0525373 | 3300046459 | Bacteria | 796 |
| 345 | Ga0495638_0006821 | 3300046460 | Bacteria | 8244 |
| 346 | Ga0495638_0062041 | 3300046460 | Bacteria | 2308 |
| 347 | Ga0495638_0064465 | 3300046460 | Bacteria | 2257 |
| 348 | Ga0495651_0626667 | 3300046462 | Bacteria | 676 |
| 349 | Ga0495653_0751366 | 3300046463 | Bacteria | 589 |
| 350 | Ga0495580_0001122 | 3300046472 | Bacteria | 23573 |
| 351 | Ga0495582_0274297 | 3300046473 | Bacteria | 968 |
| 352 | Ga0495639_0003142 | 3300046475 | Bacteria | 7173 |
| 353 | Ga0495639_0158934 | 3300046475 | Bacteria | 1093 |
| 354 | Ga0495594_0076217 | 3300046499 | Bacteria | 1870 |
| 355 | Ga0495594_0387631 | 3300046499 | Bacteria | 795 |
| 356 | Ga0495596_0001198 | 3300046500 | Bacteria | 15142 |
| 357 | Ga0495608_0236354 | 3300046511 | Bacteria | 1143 |
| 358 | Ga0495628_0054173 | 3300046516 | Bacteria | 3163 |
| 359 | Ga0495630_0111477 | 3300046517 | Bacteria | 2072 |
| 360 | Ga0495630_0810414 | 3300046517 | Bacteria | 715 |
| 361 | Ga0495632_0111875 | 3300046519 | Bacteria | 1282 |
| 362 | Ga0495637_0013567 | 3300046520 | Bacteria | 3864 |
| 363 | Ga0495648_0000094 | 3300046524 | Bacteria | 110608 |
| 364 | Ga0495666_0100230 | 3300046526 | Bacteria | 1365 |
| 365 | Ga0495652_0226834 | 3300046529 | Bacteria | 1400 |
| 366 | Ga0495609_0010585 | 3300046538 | Bacteria | 4419 |
| 367 | Ga0495597_0004722 | 3300046542 | Bacteria | 7385 |
| 368 | Ga0495622_0000390 | 3300046557 | Bacteria | 29815 |
| 369 | Ga0495622_0004352 | 3300046557 | Bacteria | 6591 |
| 370 | Ga0495622_0209687 | 3300046557 | Bacteria | 866 |
| 371 | Ga0495668_0605343 | 3300046616 | Bacteria | 605 |
| 372 | Ga0495625_0009562 | 3300046660 | Bacteria | 8100 |
| 373 | Ga0495625_0146014 | 3300046660 | Bacteria | 1593 |
| 374 | Ga0495613_0449317 | 3300046689 | Bacteria | 873 |
| 375 | Ga0495624_0014801 | 3300046690 | Bacteria | 5283 |
| 376 | Ga0495670_0747572 | 3300046691 | Bacteria | 533 |
| 377 | Ga0495671_0476301 | 3300046692 | Bacteria | 596 |
| 378 | Ga0495649_0567594 | 3300046694 | Unclassified | 561 |
| 379 | Ga0495604_0355752 | 3300047317 | Bacteria | 972 |
| 380 | Ga0495674_0201291 | 3300047319 | Bacteria | 1652 |
| 381 | Ga0495674_1242239 | 3300047319 | Unclassified | 561 |
| 382 | Ga0495672_0000299 | 3300047320 | Bacteria | 67952 |
| 383 | Ga0495676_0006620 | 3300047321 | Bacteria | 10683 |
| 384 | Ga0495676_0354545 | 3300047321 | Unclassified | 980 |
| 385 | Ga0495687_000094 | 3300047443 | Bacteria | 136181 |
| 386 | Ga0495687_058195 | 3300047443 | Bacteria | 1604 |
| 387 | Ga0495673_0000205 | 3300047469 | Bacteria | 89721 |
| 388 | Ga0495593_0004146 | 3300047673 | Bacteria | 8623 |
| 389 | Ga0495626_0102114 | 3300048091 | Bacteria | 1249 |
| 390 | Ga0496101_0409704 | 3300048904 | Bacteria | 1068 |
| 391 | Ga0496102_0082074 | 3300048905 | Unclassified | 2973 |
| 392 | Ga0496103_0132005 | 3300048906 | Unclassified | 1595 |
| 393 | Ga0496103_0332183 | 3300048906 | Bacteria | 978 |
| 394 | Ga0496105_0325057 | 3300048908 | Bacteria | 1232 |
| 395 | Ga0496106_0486997 | 3300048909 | Bacteria | 991 |
| 396 | Ga0496106_1017110 | 3300048909 | Bacteria | 651 |
| 397 | Ga0496107_0089012 | 3300048910 | Bacteria | 2254 |
| 398 | Ga0496113_0645763 | 3300048916 | Bacteria | 846 |
| 399 | Ga0496116_0270024 | 3300048919 | Bacteria | 832 |
| 400 | Ga0496117_0150032 | 3300048920 | Unclassified | 1381 |
| 401 | Ga0496117_0393945 | 3300048920 | Bacteria | 701 |
| 402 | Ga0496118_0004258 | 3300048921 | Bacteria | 17116 |
| 403 | Ga0496118_0174823 | 3300048921 | Bacteria | 1306 |
| 404 | Ga0496119_0036641 | 3300048922 | Unclassified | 3199 |
| 405 | Ga0496121_0000563 | 3300048924 | Bacteria | 69884 |
| 406 | Ga0496121_0003811 | 3300048924 | Bacteria | 21015 |
| 407 | Ga0496121_0004609 | 3300048924 | Bacteria | 18364 |
| 408 | Ga0496121_0043638 | 3300048924 | Unclassified | 3880 |
| 409 | Ga0496124_0313501 | 3300048927 | Bacteria | 1127 |
| 410 | Ga0496125_0416422 | 3300048928 | Bacteria | 780 |
| 411 | Ga0496126_0457946 | 3300048929 | Unclassified | 1026 |
| 412 | Ga0496126_0954827 | 3300048929 | Bacteria | 646 |
| 413 | Ga0495682_0126409 | 3300049460 | Unclassified | 915 |
| 414 | Ga0501032_0654877 | 3300049569 | Bacteria | 667 |
| 415 | Ga0501033_0030073 | 3300049570 | Bacteria | 4081 |
| 416 | Ga0501036_0162210 | 3300049572 | Bacteria | 1884 |
| 417 | Ga0501042_0193390 | 3300049578 | Bacteria | 1467 |
| 418 | Ga0501046_0785763 | 3300049580 | Unclassified | 668 |
| 419 | Ga0501047_0078379 | 3300049581 | Bacteria | 3177 |
| 420 | Ga0501047_0355521 | 3300049581 | Bacteria | 1301 |
| 421 | Ga0501074_0391397 | 3300049590 | Bacteria | 986 |
| 422 | Ga0501079_0221936 | 3300049741 | Bacteria | 1477 |
| 423 | Ga0501080_0006813 | 3300049742 | Bacteria | 10302 |
| 424 | Ga0501035_0151432 | 3300049822 | Bacteria | 2012 |
| 425 | Ga0501035_0440001 | 3300049822 | Bacteria | 1080 |
| 426 | Ga0501044_0007080 | 3300049823 | Bacteria | 12344 |
| 427 | Ga0501044_0958576 | 3300049823 | Unclassified | 728 |
| 428 | nmdc:mga03683_2078_c1 | 3300050489 | Bacteria | 6145 |
| 429 | nmdc:mga03683_97576_c1 | 3300050489 | Bacteria | 1288 |
| 430 | nmdc:mga03n38_662324_c1 | 3300050490 | Unclassified | 599 |
| 431 | nmdc:mga00v17_902221_c1 | 3300050491 | Bacteria | 559 |
| 432 | nmdc:mga0k408_48633_c1 | 3300050493 | Bacteria | 2454 |
| 433 | nmdc:mga0k408_613930_c1 | 3300050493 | Bacteria | 641 |
| 434 | nmdc:mga0k408_73674_c1 | 3300050493 | Bacteria | 926 |
| 435 | nmdc:mga06z11_201356_c1 | 3300050494 | Bacteria | 1157 |
| 436 | nmdc:mga04h51_103439_c1 | 3300050495 | Bacteria | 1041 |
| 437 | nmdc:mga07m45_59505_c1 | 3300050496 | Bacteria | 2161 |
| 438 | nmdc:mga07m45_6148_c1 | 3300050496 | Bacteria | 6054 |
| 439 | nmdc:mga0sz30_347528_c1 | 3300050516 | Bacteria | 663 |
| 440 | Ga0500643_186921 | 3300053087 | Bacteria | 555 |
| 441 | Ga0500583_0324742 | 3300053092 | Bacteria | 750 |
| 442 | Ga0500562_007353 | 3300053108 | Bacteria | 2778 |
| 443 | Ga0500572_171102 | 3300053111 | Unclassified | 711 |
| 444 | Ga0500607_105091 | 3300053121 | Bacteria | 1395 |
| 445 | Ga0500559_0130306 | 3300053136 | Bacteria | 1175 |
| 446 | Ga0500577_0239267 | 3300053142 | Bacteria | 788 |
| 447 | Ga0500622_0004035 | 3300053156 | Bacteria | 9448 |
| 448 | Ga0500634_0282062 | 3300053161 | Bacteria | 670 |
| 449 | Ga0500636_0000085 | 3300053177 | Bacteria | 46234 |
| 450 | Ga0500637_0044967 | 3300053178 | Bacteria | 2503 |
| 451 | Ga0500637_0171801 | 3300053178 | Unclassified | 1245 |
| 452 | Ga0500611_001360 | 3300053727 | Bacteria | 2667 |
| 453 | Ga0500625_001201 | 3300053729 | Bacteria | 8559 |
| 454 | Ga0590074_037345 | 3300059423 | Bacteria | 869 |
| 455 | Ga0590075_024696 | 3300059424 | Bacteria | 1509 |
| 456 | Ga0466962_0046390 | 3300061719 | Bacteria | 2076 |
| 457 | Ga0466962_0273457 | 3300061719 | Bacteria | 833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002459 | JGI24751J29686_10013487 | JGI24751J29686_100134872 | 65 |
| 2 | 3300009092 | Ga0105250_10083437 | Ga0105250_100834371 | 65 |
| 3 | 3300009101 | Ga0105247_10017410 | Ga0105247_100174102 | 65 |
| 4 | 3300009177 | Ga0105248_10071390 | Ga0105248_100713903 | 65 |
| 5 | 3300013306 | Ga0163162_11735630 | Ga0163162_117356301 | 65 |
| 6 | 3300014325 | Ga0163163_10041826 | Ga0163163_100418263 | 65 |
| 7 | 3300014968 | Ga0157379_10950362 | Ga0157379_109503622 | 65 |
| 8 | 3300035398 | Ga0316574_0157195 | Ga0316574_0157195_299_496 | 65 |
| 9 | 3300036712 | Ga0316584_0145185 | Ga0316584_0145185_1305_1502 | 65 |
| 10 | 3300048904 | Ga0496101_0409704 | Ga0496101_0409704_30_227 | 65 |
| 11 | 3300048905 | Ga0496102_0082074 | Ga0496102_0082074_482_679 | 65 |
| 12 | 3300048906 | Ga0496103_0132005 | Ga0496103_0132005_31_228 | 65 |
| 13 | 3300048909 | Ga0496106_1017110 | Ga0496106_1017110_377_574 | 65 |
| 14 | 3300048910 | Ga0496107_0089012 | Ga0496107_0089012_1873_2070 | 65 |
| 15 | 3300048919 | Ga0496116_0270024 | Ga0496116_0270024_606_803 | 65 |
| 16 | 3300048920 | Ga0496117_0150032 | Ga0496117_0150032_1123_1320 | 65 |
| 17 | 3300048921 | Ga0496118_0004258 | Ga0496118_0004258_11894_12091 | 65 |
| 18 | 3300048922 | Ga0496119_0036641 | Ga0496119_0036641_577_774 | 65 |
| 19 | 3300048924 | Ga0496121_0000563 | Ga0496121_0000563_58650_58847 | 65 |
| 20 | 3300048924 | Ga0496121_0043638 | Ga0496121_0043638_375_572 | 65 |
| 21 | 3300005289 | Ga0065704_10312160 | Ga0065704_103121602 | 75 |
| 22 | 3300005295 | Ga0065707_10329442 | Ga0065707_103294421 | 75 |
| 23 | 3300005295 | Ga0065707_10475088 | Ga0065707_104750882 | 75 |
| 24 | 3300005468 | Ga0070707_100153523 | Ga0070707_1001535231 | 75 |
| 25 | 3300005617 | Ga0068859_100192286 | Ga0068859_1001922862 | 75 |
| 26 | 3300005618 | Ga0068864_100336482 | Ga0068864_1003364823 | 75 |
| 27 | 3300005841 | Ga0068863_100151482 | Ga0068863_1001514823 | 75 |
| 28 | 3300005843 | Ga0068860_100016210 | Ga0068860_1000162102 | 75 |
| 29 | 3300006931 | Ga0097620_100192295 | Ga0097620_1001922953 | 75 |
| 30 | 3300025922 | Ga0207646_10195448 | Ga0207646_101954481 | 75 |
| 31 | 3300026088 | Ga0207641_11682743 | Ga0207641_116827432 | 75 |
| 32 | 3300026095 | Ga0207676_10454428 | Ga0207676_104544282 | 75 |
| 33 | 3300028381 | Ga0268264_10003717 | Ga0268264_100037176 | 75 |
| 34 | 3300048929 | Ga0496126_0457946 | Ga0496126_0457946_504_731 | 75 |
| 35 | 3300053087 | Ga0500643_186921 | Ga0500643_186921_296_523 | 75 |
| 36 | 3300001979 | JGI24740J21852_10000005 | JGI24740J21852_1000000544 | 76 |
| 37 | 3300001990 | JGI24737J22298_10000035 | JGI24737J22298_1000003535 | 76 |
| 38 | 3300005288 | Ga0065714_10261868 | Ga0065714_102618681 | 76 |
| 39 | 3300005289 | Ga0065704_10206420 | Ga0065704_102064201 | 76 |
| 40 | 3300005295 | Ga0065707_10000650 | Ga0065707_1000065015 | 76 |
| 41 | 3300005327 | Ga0070658_10006589 | Ga0070658_100065893 | 76 |
| 42 | 3300005327 | Ga0070658_10010567 | Ga0070658_100105678 | 76 |
| 43 | 3300005329 | Ga0070683_100640773 | Ga0070683_1006407732 | 76 |
| 44 | 3300005334 | Ga0068869_100087752 | Ga0068869_1000877522 | 76 |
| 45 | 3300005334 | Ga0068869_100211419 | Ga0068869_1002114192 | 76 |
| 46 | 3300005338 | Ga0068868_100008430 | Ga0068868_1000084304 | 76 |
| 47 | 3300005338 | Ga0068868_100117825 | Ga0068868_1001178252 | 76 |
| 48 | 3300005339 | Ga0070660_100313746 | Ga0070660_1003137462 | 76 |
| 49 | 3300005339 | Ga0070660_100645285 | Ga0070660_1006452852 | 76 |
| 50 | 3300005344 | Ga0070661_100000015 | Ga0070661_10000001510 | 76 |
| 51 | 3300005344 | Ga0070661_100000903 | Ga0070661_10000090317 | 76 |
| 52 | 3300005353 | Ga0070669_101023640 | Ga0070669_1010236402 | 76 |
| 53 | 3300005355 | Ga0070671_101276421 | Ga0070671_1012764211 | 76 |
| 54 | 3300005364 | Ga0070673_100601228 | Ga0070673_1006012282 | 76 |
| 55 | 3300005364 | Ga0070673_101728157 | Ga0070673_1017281572 | 76 |
| 56 | 3300005365 | Ga0070688_100573678 | Ga0070688_1005736782 | 76 |
| 57 | 3300005366 | Ga0070659_100012886 | Ga0070659_1000128863 | 76 |
| 58 | 3300005366 | Ga0070659_100262835 | Ga0070659_1002628352 | 76 |
| 59 | 3300005366 | Ga0070659_101249452 | Ga0070659_1012494521 | 76 |
| 60 | 3300005367 | Ga0070667_100000694 | Ga0070667_1000006942 | 76 |
| 61 | 3300005367 | Ga0070667_100162817 | Ga0070667_1001628172 | 76 |
| 62 | 3300005445 | Ga0070708_100368142 | Ga0070708_1003681422 | 76 |
| 63 | 3300005455 | Ga0070663_100021576 | Ga0070663_1000215764 | 76 |
| 64 | 3300005455 | Ga0070663_100022834 | Ga0070663_1000228345 | 76 |
| 65 | 3300005455 | Ga0070663_100902843 | Ga0070663_1009028432 | 76 |
| 66 | 3300005456 | Ga0070678_100067935 | Ga0070678_1000679353 | 76 |
| 67 | 3300005457 | Ga0070662_100036764 | Ga0070662_1000367642 | 76 |
| 68 | 3300005459 | Ga0068867_100112098 | Ga0068867_1001120982 | 76 |
| 69 | 3300005459 | Ga0068867_100347907 | Ga0068867_1003479072 | 76 |
| 70 | 3300005466 | Ga0070685_11519875 | Ga0070685_115198752 | 76 |
| 71 | 3300005518 | Ga0070699_100125407 | Ga0070699_1001254073 | 76 |
| 72 | 3300005535 | Ga0070684_100013015 | Ga0070684_1000130153 | 76 |
| 73 | 3300005539 | Ga0068853_100031044 | Ga0068853_1000310443 | 76 |
| 74 | 3300005539 | Ga0068853_100111825 | Ga0068853_1001118253 | 76 |
| 75 | 3300005539 | Ga0068853_100686125 | Ga0068853_1006861251 | 76 |
| 76 | 3300005539 | Ga0068853_101804121 | Ga0068853_1018041212 | 76 |
| 77 | 3300005548 | Ga0070665_100405739 | Ga0070665_1004057392 | 76 |
| 78 | 3300005548 | Ga0070665_100538950 | Ga0070665_1005389502 | 76 |
| 79 | 3300005548 | Ga0070665_100681383 | Ga0070665_1006813832 | 76 |
| 80 | 3300005563 | Ga0068855_100081673 | Ga0068855_1000816734 | 76 |
| 81 | 3300005563 | Ga0068855_100514985 | Ga0068855_1005149852 | 76 |
| 82 | 3300005564 | Ga0070664_100000015 | Ga0070664_10000001595 | 76 |
| 83 | 3300005564 | Ga0070664_100007168 | Ga0070664_1000071689 | 76 |
| 84 | 3300005577 | Ga0068857_100087366 | Ga0068857_1000873663 | 76 |
| 85 | 3300005577 | Ga0068857_100110858 | Ga0068857_1001108583 | 76 |
| 86 | 3300005577 | Ga0068857_100140614 | Ga0068857_1001406143 | 76 |
| 87 | 3300005578 | Ga0068854_100021361 | Ga0068854_1000213615 | 76 |
| 88 | 3300005578 | Ga0068854_100037838 | Ga0068854_1000378384 | 76 |
| 89 | 3300005578 | Ga0068854_101047946 | Ga0068854_1010479462 | 76 |
| 90 | 3300005614 | Ga0068856_100074577 | Ga0068856_1000745772 | 76 |
| 91 | 3300005616 | Ga0068852_100033145 | Ga0068852_1000331453 | 76 |
| 92 | 3300005616 | Ga0068852_100098202 | Ga0068852_1000982022 | 76 |
| 93 | 3300005616 | Ga0068852_100136609 | Ga0068852_1001366093 | 76 |
| 94 | 3300005616 | Ga0068852_100385202 | Ga0068852_1003852023 | 76 |
| 95 | 3300005616 | Ga0068852_100744232 | Ga0068852_1007442322 | 76 |
| 96 | 3300005617 | Ga0068859_100827115 | Ga0068859_1008271152 | 76 |
| 97 | 3300005718 | Ga0068866_10739982 | Ga0068866_107399822 | 76 |
| 98 | 3300005719 | Ga0068861_100003019 | Ga0068861_1000030193 | 76 |
| 99 | 3300005834 | Ga0068851_10003361 | Ga0068851_100033616 | 76 |
| 100 | 3300005840 | Ga0068870_10318765 | Ga0068870_103187652 | 76 |
| 101 | 3300005841 | Ga0068863_101952233 | Ga0068863_1019522332 | 76 |
| 102 | 3300005843 | Ga0068860_100051362 | Ga0068860_1000513625 | 76 |
| 103 | 3300005843 | Ga0068860_100969107 | Ga0068860_1009691072 | 76 |
| 104 | 3300005843 | Ga0068860_101182539 | Ga0068860_1011825392 | 76 |
| 105 | 3300006177 | Ga0075362_10017470 | Ga0075362_100174703 | 76 |
| 106 | 3300006177 | Ga0075362_10113942 | Ga0075362_101139422 | 76 |
| 107 | 3300006177 | Ga0075362_10409571 | Ga0075362_104095712 | 76 |
| 108 | 3300006178 | Ga0075367_10030769 | Ga0075367_100307692 | 76 |
| 109 | 3300006195 | Ga0075366_10017075 | Ga0075366_100170754 | 76 |
| 110 | 3300006195 | Ga0075366_10086544 | Ga0075366_100865443 | 76 |
| 111 | 3300006195 | Ga0075366_10335277 | Ga0075366_103352772 | 76 |
| 112 | 3300006353 | Ga0075370_10013122 | Ga0075370_100131223 | 76 |
| 113 | 3300006353 | Ga0075370_10419328 | Ga0075370_104193282 | 76 |
| 114 | 3300006358 | Ga0068871_101023479 | Ga0068871_1010234792 | 76 |
| 115 | 3300006881 | Ga0068865_100067885 | Ga0068865_1000678853 | 76 |
| 116 | 3300006931 | Ga0097620_100827116 | Ga0097620_1008271162 | 76 |
| 117 | 3300009093 | Ga0105240_10008102 | Ga0105240_1000810210 | 76 |
| 118 | 3300009093 | Ga0105240_10015784 | Ga0105240_100157845 | 76 |
| 119 | 3300009093 | Ga0105240_10270998 | Ga0105240_102709982 | 76 |
| 120 | 3300009093 | Ga0105240_12216359 | Ga0105240_122163592 | 76 |
| 121 | 3300009098 | Ga0105245_10121818 | Ga0105245_101218183 | 76 |
| 122 | 3300009098 | Ga0105245_10678099 | Ga0105245_106780992 | 76 |
| 123 | 3300009101 | Ga0105247_10749752 | Ga0105247_107497521 | 76 |
| 124 | 3300009101 | Ga0105247_11049843 | Ga0105247_110498432 | 76 |
| 125 | 3300009148 | Ga0105243_10077425 | Ga0105243_100774252 | 76 |
| 126 | 3300009174 | Ga0105241_10013755 | Ga0105241_100137557 | 76 |
| 127 | 3300009174 | Ga0105241_10087732 | Ga0105241_100877322 | 76 |
| 128 | 3300009174 | Ga0105241_11050887 | Ga0105241_110508871 | 76 |
| 129 | 3300009176 | Ga0105242_10095776 | Ga0105242_100957763 | 76 |
| 130 | 3300009545 | Ga0105237_10000736 | Ga0105237_1000073620 | 76 |
| 131 | 3300009545 | Ga0105237_10040247 | Ga0105237_100402474 | 76 |
| 132 | 3300009545 | Ga0105237_10561871 | Ga0105237_105618712 | 76 |
| 133 | 3300009545 | Ga0105237_10937157 | Ga0105237_109371572 | 76 |
| 134 | 3300009551 | Ga0105238_10000822 | Ga0105238_1000082217 | 76 |
| 135 | 3300009551 | Ga0105238_11148837 | Ga0105238_111488372 | 76 |
| 136 | 3300010159 | Ga0099796_10254114 | Ga0099796_102541142 | 76 |
| 137 | 3300010375 | Ga0105239_10001794 | Ga0105239_1000179411 | 76 |
| 138 | 3300010375 | Ga0105239_10002743 | Ga0105239_100027434 | 76 |
| 139 | 3300010375 | Ga0105239_10605889 | Ga0105239_106058892 | 76 |
| 140 | 3300011119 | Ga0105246_10040038 | Ga0105246_100400386 | 76 |
| 141 | 3300013100 | Ga0157373_10012249 | Ga0157373_100122496 | 76 |
| 142 | 3300013102 | Ga0157371_10000111 | Ga0157371_1000011192 | 76 |
| 143 | 3300013102 | Ga0157371_10173484 | Ga0157371_101734842 | 76 |
| 144 | 3300013104 | Ga0157370_10022785 | Ga0157370_100227853 | 76 |
| 145 | 3300013104 | Ga0157370_10100194 | Ga0157370_101001943 | 76 |
| 146 | 3300013104 | Ga0157370_10247139 | Ga0157370_102471392 | 76 |
| 147 | 3300013105 | Ga0157369_10000126 | Ga0157369_1000012621 | 76 |
| 148 | 3300013105 | Ga0157369_10007456 | Ga0157369_100074568 | 76 |
| 149 | 3300013105 | Ga0157369_10092229 | Ga0157369_100922292 | 76 |
| 150 | 3300013296 | Ga0157374_10590382 | Ga0157374_105903822 | 76 |
| 151 | 3300013296 | Ga0157374_11802204 | Ga0157374_118022042 | 76 |
| 152 | 3300013306 | Ga0163162_10138600 | Ga0163162_101386003 | 76 |
| 153 | 3300013306 | Ga0163162_10641242 | Ga0163162_106412422 | 76 |
| 154 | 3300013307 | Ga0157372_10248725 | Ga0157372_102487252 | 76 |
| 155 | 3300013308 | Ga0157375_10031824 | Ga0157375_100318243 | 76 |
| 156 | 3300013308 | Ga0157375_11637002 | Ga0157375_116370022 | 76 |
| 157 | 3300014326 | Ga0157380_10001410 | Ga0157380_100014103 | 76 |
| 158 | 3300014745 | Ga0157377_11038578 | Ga0157377_110385782 | 76 |
| 159 | 3300014968 | Ga0157379_10153130 | Ga0157379_101531301 | 76 |
| 160 | 3300015262 | Ga0182007_10157521 | Ga0182007_101575212 | 76 |
| 161 | 3300021361 | Ga0213872_10184468 | Ga0213872_101844682 | 76 |
| 162 | 3300021388 | Ga0213875_10001099 | Ga0213875_1000109916 | 76 |
| 163 | 3300025261 | Ga0209233_1017417 | Ga0209233_10174173 | 76 |
| 164 | 3300025321 | Ga0207656_10043473 | Ga0207656_100434732 | 76 |
| 165 | 3300025728 | Ga0207655_1009463 | Ga0207655_10094635 | 76 |
| 166 | 3300025900 | Ga0207710_10525527 | Ga0207710_105255272 | 76 |
| 167 | 3300025904 | Ga0207647_10180294 | Ga0207647_101802943 | 76 |
| 168 | 3300025904 | Ga0207647_10403092 | Ga0207647_104030922 | 76 |
| 169 | 3300025907 | Ga0207645_10117326 | Ga0207645_101173263 | 76 |
| 170 | 3300025909 | Ga0207705_10000273 | Ga0207705_1000027319 | 76 |
| 171 | 3300025909 | Ga0207705_10016908 | Ga0207705_100169083 | 76 |
| 172 | 3300025909 | Ga0207705_11258022 | Ga0207705_112580222 | 76 |
| 173 | 3300025911 | Ga0207654_10000157 | Ga0207654_1000015730 | 76 |
| 174 | 3300025911 | Ga0207654_10172250 | Ga0207654_101722502 | 76 |
| 175 | 3300025911 | Ga0207654_10645027 | Ga0207654_106450272 | 76 |
| 176 | 3300025913 | Ga0207695_10001225 | Ga0207695_1000122514 | 76 |
| 177 | 3300025913 | Ga0207695_10037983 | Ga0207695_100379832 | 76 |
| 178 | 3300025913 | Ga0207695_10250448 | Ga0207695_102504482 | 76 |
| 179 | 3300025914 | Ga0207671_10000018 | Ga0207671_1000001894 | 76 |
| 180 | 3300025914 | Ga0207671_10000676 | Ga0207671_1000067618 | 76 |
| 181 | 3300025914 | Ga0207671_10002655 | Ga0207671_1000265517 | 76 |
| 182 | 3300025914 | Ga0207671_10266173 | Ga0207671_102661731 | 76 |
| 183 | 3300025919 | Ga0207657_10000074 | Ga0207657_1000007442 | 76 |
| 184 | 3300025919 | Ga0207657_10032080 | Ga0207657_100320803 | 76 |
| 185 | 3300025919 | Ga0207657_11139472 | Ga0207657_111394722 | 76 |
| 186 | 3300025920 | Ga0207649_10000008 | Ga0207649_1000000887 | 76 |
| 187 | 3300025920 | Ga0207649_10001814 | Ga0207649_1000181412 | 76 |
| 188 | 3300025924 | Ga0207694_10012995 | Ga0207694_100129954 | 76 |
| 189 | 3300025924 | Ga0207694_10162123 | Ga0207694_101621232 | 76 |
| 190 | 3300025924 | Ga0207694_10969312 | Ga0207694_109693122 | 76 |
| 191 | 3300025927 | Ga0207687_10190966 | Ga0207687_101909662 | 76 |
| 192 | 3300025927 | Ga0207687_10193273 | Ga0207687_101932732 | 76 |
| 193 | 3300025927 | Ga0207687_10367327 | Ga0207687_103673272 | 76 |
| 194 | 3300025931 | Ga0207644_10114328 | Ga0207644_101143283 | 76 |
| 195 | 3300025931 | Ga0207644_10598077 | Ga0207644_105980772 | 76 |
| 196 | 3300025932 | Ga0207690_10001426 | Ga0207690_100014266 | 76 |
| 197 | 3300025933 | Ga0207706_10020821 | Ga0207706_100208212 | 76 |
| 198 | 3300025933 | Ga0207706_10574565 | Ga0207706_105745652 | 76 |
| 199 | 3300025933 | Ga0207706_11428109 | Ga0207706_114281092 | 76 |
| 200 | 3300025934 | Ga0207686_10000455 | Ga0207686_100004557 | 76 |
| 201 | 3300025938 | Ga0207704_10051827 | Ga0207704_100518272 | 76 |
| 202 | 3300025940 | Ga0207691_10112597 | Ga0207691_101125972 | 76 |
| 203 | 3300025942 | Ga0207689_10162425 | Ga0207689_101624252 | 76 |
| 204 | 3300025942 | Ga0207689_10285123 | Ga0207689_102851232 | 76 |
| 205 | 3300025944 | Ga0207661_10571687 | Ga0207661_105716872 | 76 |
| 206 | 3300025945 | Ga0207679_10000008 | Ga0207679_10000008302 | 76 |
| 207 | 3300025945 | Ga0207679_10039310 | Ga0207679_100393104 | 76 |
| 208 | 3300025945 | Ga0207679_11700277 | Ga0207679_117002771 | 76 |
| 209 | 3300025949 | Ga0207667_10000004 | Ga0207667_10000004547 | 76 |
| 210 | 3300025949 | Ga0207667_10000422 | Ga0207667_1000042251 | 76 |
| 211 | 3300025949 | Ga0207667_10468724 | Ga0207667_104687242 | 76 |
| 212 | 3300025960 | Ga0207651_10689308 | Ga0207651_106893082 | 76 |
| 213 | 3300025960 | Ga0207651_10728962 | Ga0207651_107289622 | 76 |
| 214 | 3300025981 | Ga0207640_10417363 | Ga0207640_104173633 | 76 |
| 215 | 3300025981 | Ga0207640_10872490 | Ga0207640_108724902 | 76 |
| 216 | 3300025986 | Ga0207658_10007422 | Ga0207658_100074224 | 76 |
| 217 | 3300025986 | Ga0207658_11328139 | Ga0207658_113281392 | 76 |
| 218 | 3300026023 | Ga0207677_10021742 | Ga0207677_100217422 | 76 |
| 219 | 3300026023 | Ga0207677_10199980 | Ga0207677_101999802 | 76 |
| 220 | 3300026035 | Ga0207703_10954245 | Ga0207703_109542452 | 76 |
| 221 | 3300026035 | Ga0207703_11004712 | Ga0207703_110047121 | 76 |
| 222 | 3300026041 | Ga0207639_10001113 | Ga0207639_100011133 | 76 |
| 223 | 3300026041 | Ga0207639_10271050 | Ga0207639_102710502 | 76 |
| 224 | 3300026041 | Ga0207639_10464329 | Ga0207639_104643292 | 76 |
| 225 | 3300026041 | Ga0207639_10681621 | Ga0207639_106816212 | 76 |
| 226 | 3300026067 | Ga0207678_10000056 | Ga0207678_1000005643 | 76 |
| 227 | 3300026067 | Ga0207678_10038439 | Ga0207678_100384394 | 76 |
| 228 | 3300026078 | Ga0207702_10000087 | Ga0207702_1000008763 | 76 |
| 229 | 3300026088 | Ga0207641_11771736 | Ga0207641_117717362 | 76 |
| 230 | 3300026089 | Ga0207648_10937594 | Ga0207648_109375942 | 76 |
| 231 | 3300026116 | Ga0207674_10000121 | Ga0207674_1000012142 | 76 |
| 232 | 3300026116 | Ga0207674_10008453 | Ga0207674_100084534 | 76 |
| 233 | 3300026116 | Ga0207674_10260657 | Ga0207674_102606572 | 76 |
| 234 | 3300026116 | Ga0207674_10535894 | Ga0207674_105358942 | 76 |
| 235 | 3300026118 | Ga0207675_100004458 | Ga0207675_1000044583 | 76 |
| 236 | 3300026121 | Ga0207683_10167803 | Ga0207683_101678032 | 76 |
| 237 | 3300026142 | Ga0207698_10007449 | Ga0207698_100074493 | 76 |
| 238 | 3300026142 | Ga0207698_10007557 | Ga0207698_100075572 | 76 |
| 239 | 3300026142 | Ga0207698_10022572 | Ga0207698_100225723 | 76 |
| 240 | 3300026142 | Ga0207698_10036664 | Ga0207698_100366643 | 76 |
| 241 | 3300026142 | Ga0207698_11093971 | Ga0207698_110939712 | 76 |
| 242 | 3300027866 | Ga0209813_10112395 | Ga0209813_101123952 | 76 |
| 243 | 3300028379 | Ga0268266_10349086 | Ga0268266_103490862 | 76 |
| 244 | 3300028381 | Ga0268264_10061599 | Ga0268264_100615992 | 76 |
| 245 | 3300028381 | Ga0268264_10070808 | Ga0268264_100708082 | 76 |
| 246 | 3300028381 | Ga0268264_11112681 | Ga0268264_111126812 | 76 |
| 247 | 3300028800 | Ga0265338_10224982 | Ga0265338_102249822 | 76 |
| 248 | 3300030521 | Ga0307511_10000656 | Ga0307511_1000065624 | 76 |
| 249 | 3300030521 | Ga0307511_10101474 | Ga0307511_101014744 | 76 |
| 250 | 3300031456 | Ga0307513_10485254 | Ga0307513_104852542 | 76 |
| 251 | 3300031548 | Ga0307408_100128977 | Ga0307408_1001289773 | 76 |
| 252 | 3300031548 | Ga0307408_101191501 | Ga0307408_1011915012 | 76 |
| 253 | 3300031616 | Ga0307508_10467092 | Ga0307508_104670922 | 76 |
| 254 | 3300031730 | Ga0307516_10000363 | Ga0307516_1000036332 | 76 |
| 255 | 3300031730 | Ga0307516_10000935 | Ga0307516_1000093513 | 76 |
| 256 | 3300031731 | Ga0307405_10250099 | Ga0307405_102500993 | 76 |
| 257 | 3300031903 | Ga0307407_11656427 | Ga0307407_116564271 | 76 |
| 258 | 3300032002 | Ga0307416_100125751 | Ga0307416_1001257512 | 76 |
| 259 | 3300032004 | Ga0307414_10380890 | Ga0307414_103808902 | 76 |
| 260 | 3300032005 | Ga0307411_10129770 | Ga0307411_101297702 | 76 |
| 261 | 3300035171 | Ga0373946_0651066 | Ga0373946_0651066_231_461 | 76 |
| 262 | 3300035695 | Ga0373927_0296103 | Ga0373927_0296103_430_660 | 76 |
| 263 | 3300037068 | Ga0373925_0243698 | Ga0373925_0243698_803_1033 | 76 |
| 264 | 3300037312 | Ga0395899_0000005 | Ga0395899_0000005_49571_49801 | 76 |
| 265 | 3300037418 | Ga0395900_0000090 | Ga0395900_0000090_119413_119643 | 76 |
| 266 | 3300037466 | Ga0395898_0000003 | Ga0395898_0000003_49571_49801 | 76 |
| 267 | 3300037471 | Ga0395905_0035294 | Ga0395905_0035294_3398_3628 | 76 |
| 268 | 3300037471 | Ga0395905_0052766 | Ga0395905_0052766_2308_2538 | 76 |
| 269 | 3300037471 | Ga0395905_0113931 | Ga0395905_0113931_1958_2188 | 76 |
| 270 | 3300037471 | Ga0395905_1087877 | Ga0395905_1087877_300_530 | 76 |
| 271 | 3300037471 | Ga0395905_1553125 | Ga0395905_1553125_67_297 | 76 |
| 272 | 3300037853 | Ga0436364_0206190 | Ga0436364_0206190_8706_8936 | 76 |
| 273 | 3300038443 | Ga0395901_0000096 | Ga0395901_0000096_45210_45440 | 76 |
| 274 | 3300039447 | Ga0436361_0462301 | Ga0436361_0462301_405_635 | 76 |
| 275 | 3300041404 | Ga0439436_0004367 | Ga0439436_0004367_959_1189 | 76 |
| 276 | 3300041405 | Ga0439438_018409 | Ga0439438_018409_1375_1605 | 76 |
| 277 | 3300041407 | Ga0439447_003200 | Ga0439447_003200_3765_3995 | 76 |
| 278 | 3300041407 | Ga0439447_003283 | Ga0439447_003283_1760_1990 | 76 |
| 279 | 3300041407 | Ga0439447_021042 | Ga0439447_021042_457_687 | 76 |
| 280 | 3300041407 | Ga0439447_033135 | Ga0439447_033135_160_390 | 76 |
| 281 | 3300041408 | Ga0439453_0074224 | Ga0439453_0074224_415_645 | 76 |
| 282 | 3300041411 | Ga0439466_0001270 | Ga0439466_0001270_1673_1903 | 76 |
| 283 | 3300041411 | Ga0439466_0013928 | Ga0439466_0013928_1406_1636 | 76 |
| 284 | 3300041411 | Ga0439466_0086609 | Ga0439466_0086609_26_256 | 76 |
| 285 | 3300041459 | Ga0451800_0537557 | Ga0451800_0537557_235_465 | 76 |
| 286 | 3300041491 | Ga0451833_0464823 | Ga0451833_0464823_274_504 | 76 |
| 287 | 3300041498 | Ga0451841_1339644 | Ga0451841_1339644_360_590 | 76 |
| 288 | 3300041507 | Ga0451851_1363885 | Ga0451851_1363885_439_669 | 76 |
| 289 | 3300041512 | Ga0451853_1179022 | Ga0451853_1179022_59_289 | 76 |
| 290 | 3300041997 | Ga0439431_0099577 | Ga0439431_0099577_175_405 | 76 |
| 291 | 3300042000 | Ga0439437_059059 | Ga0439437_059059_163_393 | 76 |
| 292 | 3300042002 | Ga0439442_003490 | Ga0439442_003490_2844_3074 | 76 |
| 293 | 3300042004 | Ga0439445_0077812 | Ga0439445_0077812_267_497 | 76 |
| 294 | 3300042005 | Ga0439448_0111614 | Ga0439448_0111614_515_745 | 76 |
| 295 | 3300042006 | Ga0439432_055267 | Ga0439432_055267_350_580 | 76 |
| 296 | 3300042007 | Ga0439449_0000685 | Ga0439449_0000685_1365_1595 | 76 |
| 297 | 3300042009 | Ga0439451_115054 | Ga0439451_115054_135_365 | 76 |
| 298 | 3300042010 | Ga0439452_000097 | Ga0439452_000097_56181_56411 | 76 |
| 299 | 3300042010 | Ga0439452_033569 | Ga0439452_033569_161_391 | 76 |
| 300 | 3300042014 | Ga0439457_121492 | Ga0439457_121492_217_447 | 76 |
| 301 | 3300042015 | Ga0439462_0124477 | Ga0439462_0124477_428_658 | 76 |
| 302 | 3300042015 | Ga0439462_0179527 | Ga0439462_0179527_343_573 | 76 |
| 303 | 3300042115 | Ga0450911_020428 | Ga0450911_020428_228_458 | 76 |
| 304 | 3300042120 | Ga0450917_016777 | Ga0450917_016777_170_400 | 76 |
| 305 | 3300042121 | Ga0450919_045427 | Ga0450919_045427_241_471 | 76 |
| 306 | 3300042124 | Ga0450922_015240 | Ga0450922_015240_220_450 | 76 |
| 307 | 3300042126 | Ga0450888_013259 | Ga0450888_013259_170_400 | 76 |
| 308 | 3300042127 | Ga0450890_009979 | Ga0450890_009979_804_1034 | 76 |
| 309 | 3300042127 | Ga0450890_040655 | Ga0450890_040655_38_268 | 76 |
| 310 | 3300042130 | Ga0450892_007982 | Ga0450892_007982_384_614 | 76 |
| 311 | 3300042131 | Ga0450894_008540 | Ga0450894_008540_813_1043 | 76 |
| 312 | 3300042131 | Ga0450894_029467 | Ga0450894_029467_395_625 | 76 |
| 313 | 3300042133 | Ga0450896_016615 | Ga0450896_016615_114_344 | 76 |
| 314 | 3300042134 | Ga0450898_023474 | Ga0450898_023474_823_1053 | 76 |
| 315 | 3300042134 | Ga0450898_033780 | Ga0450898_033780_203_433 | 76 |
| 316 | 3300042137 | Ga0450902_000036 | Ga0450902_000036_1836_2066 | 76 |
| 317 | 3300042137 | Ga0450902_104775 | Ga0450902_104775_183_413 | 76 |
| 318 | 3300042139 | Ga0450904_017801 | Ga0450904_017801_207_437 | 76 |
| 319 | 3300042144 | Ga0450889_016098 | Ga0450889_016098_445_675 | 76 |
| 320 | 3300042145 | Ga0450906_003443 | Ga0450906_003443_3080_3310 | 76 |
| 321 | 3300042147 | Ga0450910_024342 | Ga0450910_024342_489_719 | 76 |
| 322 | 3300042185 | Ga0450909_033110 | Ga0450909_033110_402_632 | 76 |
| 323 | 3300042185 | Ga0450909_057128 | Ga0450909_057128_212_442 | 76 |
| 324 | 3300042435 | Ga0439434_0003238 | Ga0439434_0003238_575_805 | 76 |
| 325 | 3300042435 | Ga0439434_0142621 | Ga0439434_0142621_315_545 | 76 |
| 326 | 3300042436 | Ga0439435_0054405 | Ga0439435_0054405_713_943 | 76 |
| 327 | 3300042439 | Ga0439464_0032748 | Ga0439464_0032748_246_476 | 76 |
| 328 | 3300042531 | Ga0450918_016821 | Ga0450918_016821_137_367 | 76 |
| 329 | 3300042532 | Ga0450893_0003000 | Ga0450893_0003000_1499_1729 | 76 |
| 330 | 3300042532 | Ga0450893_0009885 | Ga0450893_0009885_1048_1278 | 76 |
| 331 | 3300042532 | Ga0450893_0011595 | Ga0450893_0011595_1015_1245 | 76 |
| 332 | 3300042993 | Ga0439440_0291816 | Ga0439440_0291816_31_261 | 76 |
| 333 | 3300044656 | Ga0466969_0040069 | Ga0466969_0040069_73_303 | 76 |
| 334 | 3300044656 | Ga0466969_0058586 | Ga0466969_0058586_352_582 | 76 |
| 335 | 3300044658 | Ga0466972_0090436 | Ga0466972_0090436_726_956 | 76 |
| 336 | 3300044658 | Ga0466972_0421699 | Ga0466972_0421699_259_489 | 76 |
| 337 | 3300044673 | Ga0453683_0945142 | Ga0453683_0945142_34_264 | 76 |
| 338 | 3300044683 | Ga0466965_0013067 | Ga0466965_0013067_1666_1896 | 76 |
| 339 | 3300044684 | Ga0466966_0000033 | Ga0466966_0000033_46913_47143 | 76 |
| 340 | 3300044684 | Ga0466966_0031451 | Ga0466966_0031451_1411_1641 | 76 |
| 341 | 3300044693 | Ga0466961_0000428 | Ga0466961_0000428_4064_4294 | 76 |
| 342 | 3300044693 | Ga0466961_0404245 | Ga0466961_0404245_52_282 | 76 |
| 343 | 3300044694 | Ga0466963_0028390 | Ga0466963_0028390_236_466 | 76 |
| 344 | 3300044694 | Ga0466963_0302621 | Ga0466963_0302621_18_248 | 76 |
| 345 | 3300044706 | Ga0466964_0035925 | Ga0466964_0035925_1403_1633 | 76 |
| 346 | 3300044712 | Ga0453684_0026763 | Ga0453684_0026763_1452_1694 | 76 |
| 347 | 3300044719 | Ga0466971_0052112 | Ga0466971_0052112_454_684 | 76 |
| 348 | 3300044765 | Ga0466970_0048027 | Ga0466970_0048027_1667_1897 | 76 |
| 349 | 3300044842 | Ga0466957_0035050 | Ga0466957_0035050_1651_1881 | 76 |
| 350 | 3300045049 | Ga0466959_0079309 | Ga0466959_0079309_1512_1742 | 76 |
| 351 | 3300045049 | Ga0466959_0141535 | Ga0466959_0141535_854_1084 | 76 |
| 352 | 3300045051 | Ga0451576_0043364 | Ga0451576_0043364_3854_4096 | 76 |
| 353 | 3300045051 | Ga0451576_0809330 | Ga0451576_0809330_478_708 | 76 |
| 354 | 3300045836 | Ga0466958_0008900 | Ga0466958_0008900_3414_3644 | 76 |
| 355 | 3300045836 | Ga0466958_0023611 | Ga0466958_0023611_2930_3160 | 76 |
| 356 | 3300046457 | Ga0495590_0171019 | Ga0495590_0171019_139_369 | 76 |
| 357 | 3300046459 | Ga0495629_0525373 | Ga0495629_0525373_377_607 | 76 |
| 358 | 3300046460 | Ga0495638_0006821 | Ga0495638_0006821_143_373 | 76 |
| 359 | 3300046460 | Ga0495638_0062041 | Ga0495638_0062041_2042_2272 | 76 |
| 360 | 3300046460 | Ga0495638_0064465 | Ga0495638_0064465_1416_1646 | 76 |
| 361 | 3300046462 | Ga0495651_0626667 | Ga0495651_0626667_219_449 | 76 |
| 362 | 3300046463 | Ga0495653_0751366 | Ga0495653_0751366_104_334 | 76 |
| 363 | 3300046472 | Ga0495580_0001122 | Ga0495580_0001122_7298_7528 | 76 |
| 364 | 3300046473 | Ga0495582_0274297 | Ga0495582_0274297_343_573 | 76 |
| 365 | 3300046475 | Ga0495639_0003142 | Ga0495639_0003142_2150_2380 | 76 |
| 366 | 3300046475 | Ga0495639_0158934 | Ga0495639_0158934_77_307 | 76 |
| 367 | 3300046499 | Ga0495594_0076217 | Ga0495594_0076217_747_995 | 76 |
| 368 | 3300046499 | Ga0495594_0387631 | Ga0495594_0387631_353_583 | 76 |
| 369 | 3300046500 | Ga0495596_0001198 | Ga0495596_0001198_4789_5019 | 76 |
| 370 | 3300046511 | Ga0495608_0236354 | Ga0495608_0236354_727_957 | 76 |
| 371 | 3300046516 | Ga0495628_0054173 | Ga0495628_0054173_1988_2218 | 76 |
| 372 | 3300046517 | Ga0495630_0111477 | Ga0495630_0111477_773_1003 | 76 |
| 373 | 3300046517 | Ga0495630_0810414 | Ga0495630_0810414_346_576 | 76 |
| 374 | 3300046519 | Ga0495632_0111875 | Ga0495632_0111875_207_437 | 76 |
| 375 | 3300046520 | Ga0495637_0013567 | Ga0495637_0013567_1046_1276 | 76 |
| 376 | 3300046524 | Ga0495648_0000094 | Ga0495648_0000094_57001_57249 | 76 |
| 377 | 3300046526 | Ga0495666_0100230 | Ga0495666_0100230_327_557 | 76 |
| 378 | 3300046529 | Ga0495652_0226834 | Ga0495652_0226834_539_769 | 76 |
| 379 | 3300046538 | Ga0495609_0010585 | Ga0495609_0010585_2345_2593 | 76 |
| 380 | 3300046542 | Ga0495597_0004722 | Ga0495597_0004722_1448_1678 | 76 |
| 381 | 3300046557 | Ga0495622_0000390 | Ga0495622_0000390_17910_18158 | 76 |
| 382 | 3300046557 | Ga0495622_0004352 | Ga0495622_0004352_1443_1691 | 76 |
| 383 | 3300046557 | Ga0495622_0209687 | Ga0495622_0209687_241_471 | 76 |
| 384 | 3300046616 | Ga0495668_0605343 | Ga0495668_0605343_294_524 | 76 |
| 385 | 3300046660 | Ga0495625_0009562 | Ga0495625_0009562_2092_2322 | 76 |
| 386 | 3300046660 | Ga0495625_0146014 | Ga0495625_0146014_947_1177 | 76 |
| 387 | 3300046689 | Ga0495613_0449317 | Ga0495613_0449317_438_668 | 76 |
| 388 | 3300046690 | Ga0495624_0014801 | Ga0495624_0014801_528_758 | 76 |
| 389 | 3300046691 | Ga0495670_0747572 | Ga0495670_0747572_272_520 | 76 |
| 390 | 3300046692 | Ga0495671_0476301 | Ga0495671_0476301_112_342 | 76 |
| 391 | 3300046694 | Ga0495649_0567594 | Ga0495649_0567594_244_474 | 76 |
| 392 | 3300047317 | Ga0495604_0355752 | Ga0495604_0355752_83_313 | 76 |
| 393 | 3300047319 | Ga0495674_0201291 | Ga0495674_0201291_199_429 | 76 |
| 394 | 3300047319 | Ga0495674_1242239 | Ga0495674_1242239_89_319 | 76 |
| 395 | 3300047320 | Ga0495672_0000299 | Ga0495672_0000299_47231_47479 | 76 |
| 396 | 3300047321 | Ga0495676_0006620 | Ga0495676_0006620_8520_8750 | 76 |
| 397 | 3300047321 | Ga0495676_0354545 | Ga0495676_0354545_412_642 | 76 |
| 398 | 3300047443 | Ga0495687_000094 | Ga0495687_000094_64655_64885 | 76 |
| 399 | 3300047443 | Ga0495687_058195 | Ga0495687_058195_991_1221 | 76 |
| 400 | 3300047469 | Ga0495673_0000205 | Ga0495673_0000205_8896_9126 | 76 |
| 401 | 3300047673 | Ga0495593_0004146 | Ga0495593_0004146_4095_4325 | 76 |
| 402 | 3300048091 | Ga0495626_0102114 | Ga0495626_0102114_1005_1235 | 76 |
| 403 | 3300048906 | Ga0496103_0332183 | Ga0496103_0332183_666_896 | 76 |
| 404 | 3300048908 | Ga0496105_0325057 | Ga0496105_0325057_622_852 | 76 |
| 405 | 3300048909 | Ga0496106_0486997 | Ga0496106_0486997_213_443 | 76 |
| 406 | 3300048916 | Ga0496113_0645763 | Ga0496113_0645763_348_578 | 76 |
| 407 | 3300048920 | Ga0496117_0393945 | Ga0496117_0393945_363_593 | 76 |
| 408 | 3300048921 | Ga0496118_0174823 | Ga0496118_0174823_893_1123 | 76 |
| 409 | 3300048924 | Ga0496121_0003811 | Ga0496121_0003811_763_993 | 76 |
| 410 | 3300048924 | Ga0496121_0004609 | Ga0496121_0004609_9123_9353 | 76 |
| 411 | 3300048927 | Ga0496124_0313501 | Ga0496124_0313501_846_1076 | 76 |
| 412 | 3300048928 | Ga0496125_0416422 | Ga0496125_0416422_207_437 | 76 |
| 413 | 3300048929 | Ga0496126_0954827 | Ga0496126_0954827_110_340 | 76 |
| 414 | 3300049460 | Ga0495682_0126409 | Ga0495682_0126409_439_669 | 76 |
| 415 | 3300049569 | Ga0501032_0654877 | Ga0501032_0654877_349_579 | 76 |
| 416 | 3300049570 | Ga0501033_0030073 | Ga0501033_0030073_3648_3878 | 76 |
| 417 | 3300049572 | Ga0501036_0162210 | Ga0501036_0162210_79_309 | 76 |
| 418 | 3300049578 | Ga0501042_0193390 | Ga0501042_0193390_19_249 | 76 |
| 419 | 3300049580 | Ga0501046_0785763 | Ga0501046_0785763_209_439 | 76 |
| 420 | 3300049581 | Ga0501047_0078379 | Ga0501047_0078379_2736_2966 | 76 |
| 421 | 3300049581 | Ga0501047_0355521 | Ga0501047_0355521_1038_1268 | 76 |
| 422 | 3300049590 | Ga0501074_0391397 | Ga0501074_0391397_48_278 | 76 |
| 423 | 3300049741 | Ga0501079_0221936 | Ga0501079_0221936_508_738 | 76 |
| 424 | 3300049742 | Ga0501080_0006813 | Ga0501080_0006813_5807_6037 | 76 |
| 425 | 3300049822 | Ga0501035_0151432 | Ga0501035_0151432_853_1083 | 76 |
| 426 | 3300049822 | Ga0501035_0440001 | Ga0501035_0440001_113_343 | 76 |
| 427 | 3300049823 | Ga0501044_0007080 | Ga0501044_0007080_2758_2988 | 76 |
| 428 | 3300049823 | Ga0501044_0958576 | Ga0501044_0958576_302_532 | 76 |
| 429 | 3300050489 | nmdc:mga03683_2078_c1 | nmdc:mga03683_2078_c1_4880_5110 | 76 |
| 430 | 3300050489 | nmdc:mga03683_97576_c1 | nmdc:mga03683_97576_c1_110_379 | 76 |
| 431 | 3300050490 | nmdc:mga03n38_662324_c1 | nmdc:mga03n38_662324_c1_284_514 | 76 |
| 432 | 3300050491 | nmdc:mga00v17_902221_c1 | nmdc:mga00v17_902221_c1_160_429 | 76 |
| 433 | 3300050493 | nmdc:mga0k408_48633_c1 | nmdc:mga0k408_48633_c1_2147_2416 | 76 |
| 434 | 3300050493 | nmdc:mga0k408_613930_c1 | nmdc:mga0k408_613930_c1_35_265 | 76 |
| 435 | 3300050493 | nmdc:mga0k408_73674_c1 | nmdc:mga0k408_73674_c1_503_733 | 76 |
| 436 | 3300050494 | nmdc:mga06z11_201356_c1 | nmdc:mga06z11_201356_c1_528_797 | 76 |
| 437 | 3300050495 | nmdc:mga04h51_103439_c1 | nmdc:mga04h51_103439_c1_383_652 | 76 |
| 438 | 3300050496 | nmdc:mga07m45_59505_c1 | nmdc:mga07m45_59505_c1_1600_1830 | 76 |
| 439 | 3300050496 | nmdc:mga07m45_6148_c1 | nmdc:mga07m45_6148_c1_3357_3587 | 76 |
| 440 | 3300050516 | nmdc:mga0sz30_347528_c1 | nmdc:mga0sz30_347528_c1_332_601 | 76 |
| 441 | 3300053092 | Ga0500583_0324742 | Ga0500583_0324742_272_502 | 76 |
| 442 | 3300053108 | Ga0500562_007353 | Ga0500562_007353_1609_1839 | 76 |
| 443 | 3300053111 | Ga0500572_171102 | Ga0500572_171102_449_679 | 76 |
| 444 | 3300053121 | Ga0500607_105091 | Ga0500607_105091_397_627 | 76 |
| 445 | 3300053136 | Ga0500559_0130306 | Ga0500559_0130306_493_723 | 76 |
| 446 | 3300053142 | Ga0500577_0239267 | Ga0500577_0239267_379_609 | 76 |
| 447 | 3300053156 | Ga0500622_0004035 | Ga0500622_0004035_7449_7679 | 76 |
| 448 | 3300053161 | Ga0500634_0282062 | Ga0500634_0282062_159_389 | 76 |
| 449 | 3300053177 | Ga0500636_0000085 | Ga0500636_0000085_9928_10158 | 76 |
| 450 | 3300053178 | Ga0500637_0044967 | Ga0500637_0044967_822_1052 | 76 |
| 451 | 3300053178 | Ga0500637_0171801 | Ga0500637_0171801_357_587 | 76 |
| 452 | 3300053727 | Ga0500611_001360 | Ga0500611_001360_2027_2257 | 76 |
| 453 | 3300053729 | Ga0500625_001201 | Ga0500625_001201_6471_6701 | 76 |
| 454 | 3300059423 | Ga0590074_037345 | Ga0590074_037345_40_270 | 76 |
| 455 | 3300059424 | Ga0590075_024696 | Ga0590075_024696_876_1106 | 76 |
| 456 | 3300061719 | Ga0466962_0046390 | Ga0466962_0046390_1152_1382 | 76 |
| 457 | 3300061719 | Ga0466962_0273457 | Ga0466962_0273457_512_742 | 76 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5csa-assembly1.cif.gz_A | crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase | 0.9467 | 3 | 76 |
| 3crk-assembly1.cif.gz_C | crystal structure of the pdhk2-l2 complex. | 0.941 | 2 | 75 |
| 5csl-assembly1.cif.gz_A | crystal structure of the 500 kd yeast acetyl-coa carboxylase holoenzyme dimer | 0.9395 | 3 | 76 |
| 1y8p-assembly1.cif.gz_B | crystal structure of the pdk3-l2 complex | 0.9354 | 1 | 76 |
| 6g2i-assembly1.cif.gz_R | filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution | 0.9276 | 4 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6KPB2_40_143_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9597 | 2 | 75 | 2.40.50.100 |
| af_P9WIS7_123_196_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9562 | 5 | 76 | 2.40.50.100 |
| af_Q4DYI5_10_111_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9485 | 1 | 76 | 2.40.50.100 |
| af_A4I7A2_659_729_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9476 | 3 | 76 | 2.40.50.100 |
| af_Q2G2A4_2_90_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9432 | 3 | 76 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I2L2S9-F1-model_v4 | Dihydrolipoamide acyltransferase | 0.9803 | 1 | 75 |
GO:0005737
GO:0016407 GO:0031405 |
| AF-A0A1B3N9J5-F1-model_v4 | Biotin-requiring enzyme family protein | 0.9798 | 1 | 76 |
GO:0006086
GO:0045254 |
| AF-A0A031K6L3-F1-model_v4 | Biotin/lipoyl attachment domain-containing protein | 0.9791 | 1 | 76 |
GO:0005737
GO:0016407 GO:0031405 |
| AF-A0A2E7TBW6-F1-model_v4 | Lipoyl-binding domain-containing protein | 0.9783 | 1 | 76 |
GO:0006086
GO:0045254 |
| AF-A0A0M2NMX0-F1-model_v4 | Dihydrolipoyl dehydrogenase (EC 1.8.1.4) | 0.9781 | 1 | 75 |
GO:0004148
GO:0006090 GO:0006103 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar