F447981

General Info

Members Datasets Scaffolds Average Seq Length
457 289 457 76

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10254114|Ga0099796_102541142
Length 76
Sequence MAHEVVLPQLGFSMTDGSLVEWLVKDGDNIQAGAAIFSLETDKSVQEIESPAAGKIRILKAAGQTYAVGEILAVIE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
148 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
163 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
166 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
167 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
168 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
169 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
170 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
171 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
172 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
173 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
174 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
177 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
186 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
286 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
287 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.1
Nodule 0
Rhizoplane 2.19
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000005 3300001979 Bacteria 87250
2 JGI24737J22298_10000035 3300001990 Bacteria 39357
3 JGI24751J29686_10013487 3300002459 Bacteria 1687
4 Ga0065714_10261868 3300005288 Bacteria 755
5 Ga0065704_10206420 3300005289 Unclassified 1111
6 Ga0065704_10312160 3300005289 Unclassified 866
7 Ga0065707_10000650 3300005295 Bacteria 17766
8 Ga0065707_10329442 3300005295 Bacteria 946
9 Ga0065707_10475088 3300005295 Bacteria 772
10 Ga0070658_10006589 3300005327 Bacteria 9413
11 Ga0070658_10010567 3300005327 Bacteria 7398
12 Ga0070683_100640773 3300005329 Bacteria 1017
13 Ga0068869_100087752 3300005334 Bacteria 2334
14 Ga0068869_100211419 3300005334 Bacteria 1534
15 Ga0068868_100008430 3300005338 Bacteria 7380
16 Ga0068868_100117825 3300005338 Bacteria 2164
17 Ga0070660_100313746 3300005339 Bacteria 1287
18 Ga0070660_100645285 3300005339 Bacteria 886
19 Ga0070661_100000015 3300005344 Bacteria 156690
20 Ga0070661_100000903 3300005344 Bacteria 21290
21 Ga0070669_101023640 3300005353 Bacteria 709
22 Ga0070671_101276421 3300005355 Bacteria 647
23 Ga0070673_100601228 3300005364 Bacteria 1003
24 Ga0070673_101728157 3300005364 Bacteria 592
25 Ga0070688_100573678 3300005365 Bacteria 860
26 Ga0070659_100012886 3300005366 Bacteria 6214
27 Ga0070659_100262835 3300005366 Bacteria 1432
28 Ga0070659_101249452 3300005366 Bacteria 658
29 Ga0070667_100000694 3300005367 Bacteria 32459
30 Ga0070667_100162817 3300005367 Bacteria 1966
31 Ga0070708_100368142 3300005445 Bacteria 1355
32 Ga0070663_100021576 3300005455 Bacteria 4287
33 Ga0070663_100022834 3300005455 Bacteria 4186
34 Ga0070663_100902843 3300005455 Bacteria 763
35 Ga0070678_100067935 3300005456 Bacteria 2655
36 Ga0070662_100036764 3300005457 Bacteria 3467
37 Ga0068867_100112098 3300005459 Bacteria 2097
38 Ga0068867_100347907 3300005459 Bacteria 1236
39 Ga0070685_11519875 3300005466 Unclassified 516
40 Ga0070707_100153523 3300005468 Bacteria 2242
41 Ga0070699_100125407 3300005518 Bacteria 2260
42 Ga0070684_100013015 3300005535 Bacteria 6694
43 Ga0068853_100031044 3300005539 Bacteria 4517
44 Ga0068853_100111825 3300005539 Bacteria 2427
45 Ga0068853_100686125 3300005539 Bacteria 976
46 Ga0068853_101804121 3300005539 Bacteria 593
47 Ga0070665_100405739 3300005548 Bacteria 1371
48 Ga0070665_100538950 3300005548 Bacteria 1179
49 Ga0070665_100681383 3300005548 Bacteria 1041
50 Ga0068855_100081673 3300005563 Bacteria 3746
51 Ga0068855_100514985 3300005563 Bacteria 1299
52 Ga0070664_100000015 3300005564 Bacteria 128718
53 Ga0070664_100007168 3300005564 Bacteria 8986
54 Ga0068857_100087366 3300005577 Bacteria 2789
55 Ga0068857_100110858 3300005577 Bacteria 2466
56 Ga0068857_100140614 3300005577 Bacteria 2182
57 Ga0068854_100021361 3300005578 Bacteria 4392
58 Ga0068854_100037838 3300005578 Bacteria 3389
59 Ga0068854_101047946 3300005578 Bacteria 724
60 Ga0068856_100074577 3300005614 Bacteria 3359
61 Ga0068852_100033145 3300005616 Bacteria 4286
62 Ga0068852_100098202 3300005616 Bacteria 2637
63 Ga0068852_100136609 3300005616 Bacteria 2264
64 Ga0068852_100385202 3300005616 Bacteria 1376
65 Ga0068852_100744232 3300005616 Bacteria 992
66 Ga0068859_100192286 3300005617 Bacteria 2125
67 Ga0068859_100827115 3300005617 Bacteria 1013
68 Ga0068864_100336482 3300005618 Bacteria 1421
69 Ga0068866_10739982 3300005718 Bacteria 678
70 Ga0068861_100003019 3300005719 Bacteria 11113
71 Ga0068851_10003361 3300005834 Bacteria 7117
72 Ga0068870_10318765 3300005840 Bacteria 987
73 Ga0068863_100151482 3300005841 Bacteria 2219
74 Ga0068863_101952233 3300005841 Bacteria 597
75 Ga0068860_100016210 3300005843 Bacteria 7268
76 Ga0068860_100051362 3300005843 Bacteria 3923
77 Ga0068860_100969107 3300005843 Bacteria 868
78 Ga0068860_101182539 3300005843 Bacteria 785
79 Ga0075362_10017470 3300006177 Bacteria 2955
80 Ga0075362_10113942 3300006177 Bacteria 1275
81 Ga0075362_10409571 3300006177 Bacteria 685
82 Ga0075367_10030769 3300006178 Bacteria 3079
83 Ga0075366_10017075 3300006195 Bacteria 4173
84 Ga0075366_10086544 3300006195 Bacteria 1875
85 Ga0075366_10335277 3300006195 Bacteria 927
86 Ga0075370_10013122 3300006353 Bacteria 4396
87 Ga0075370_10419328 3300006353 Bacteria 804
88 Ga0068871_101023479 3300006358 Bacteria 770
89 Ga0068865_100067885 3300006881 Bacteria 2520
90 Ga0097620_100192295 3300006931 Bacteria 2125
91 Ga0097620_100827116 3300006931 Bacteria 1013
92 Ga0105250_10083437 3300009092 Bacteria 1297
93 Ga0105240_10008102 3300009093 Bacteria 15088
94 Ga0105240_10015784 3300009093 Bacteria 10249
95 Ga0105240_10270998 3300009093 Bacteria 1954
96 Ga0105240_12216359 3300009093 Bacteria 569
97 Ga0105245_10121818 3300009098 Bacteria 2438
98 Ga0105245_10678099 3300009098 Bacteria 1063
99 Ga0105247_10017410 3300009101 Bacteria 4314
100 Ga0105247_10749752 3300009101 Unclassified 740
101 Ga0105247_11049843 3300009101 Bacteria 640
102 Ga0105243_10077425 3300009148 Bacteria 2705
103 Ga0105241_10013755 3300009174 Bacteria 5928
104 Ga0105241_10087732 3300009174 Bacteria 2449
105 Ga0105241_11050887 3300009174 Bacteria 764
106 Ga0105242_10095776 3300009176 Bacteria 2506
107 Ga0105248_10071390 3300009177 Unclassified 3901
108 Ga0105237_10000736 3300009545 Bacteria 45152
109 Ga0105237_10040247 3300009545 Bacteria 4714
110 Ga0105237_10561871 3300009545 Bacteria 1148
111 Ga0105237_10937157 3300009545 Bacteria 873
112 Ga0105238_10000822 3300009551 Bacteria 32108
113 Ga0105238_11148837 3300009551 Bacteria 800
114 Ga0099796_10254114 3300010159 Bacteria 731
115 Ga0105239_10001794 3300010375 Bacteria 28177
116 Ga0105239_10002743 3300010375 Bacteria 22119
117 Ga0105239_10605889 3300010375 Bacteria 1249
118 Ga0105246_10040038 3300011119 Bacteria 3161
119 Ga0157373_10012249 3300013100 Bacteria 6305
120 Ga0157371_10000111 3300013102 Bacteria 123977
121 Ga0157371_10173484 3300013102 Bacteria 1541
122 Ga0157370_10022785 3300013104 Bacteria 6230
123 Ga0157370_10100194 3300013104 Bacteria 2714
124 Ga0157370_10247139 3300013104 Bacteria 1650
125 Ga0157369_10000126 3300013105 Bacteria 109644
126 Ga0157369_10007456 3300013105 Bacteria 12599
127 Ga0157369_10092229 3300013105 Bacteria 3232
128 Ga0157374_10590382 3300013296 Bacteria 1120
129 Ga0157374_11802204 3300013296 Bacteria 637
130 Ga0163162_10138600 3300013306 Bacteria 2544
131 Ga0163162_10641242 3300013306 Bacteria 1186
132 Ga0163162_11735630 3300013306 Unclassified 713
133 Ga0157372_10248725 3300013307 Bacteria 2063
134 Ga0157375_10031824 3300013308 Bacteria 4995
135 Ga0157375_11637002 3300013308 Bacteria 761
136 Ga0163163_10041826 3300014325 Bacteria 4484
137 Ga0157380_10001410 3300014326 Bacteria 15719
138 Ga0157377_11038578 3300014745 Bacteria 623
139 Ga0157379_10153130 3300014968 Unclassified 2080
140 Ga0157379_10950362 3300014968 Unclassified 817
141 Ga0182007_10157521 3300015262 Bacteria 775
142 Ga0213872_10184468 3300021361 Bacteria 900
143 Ga0213875_10001099 3300021388 Bacteria 18747
144 Ga0209233_1017417 3300025261 Bacteria 1958
145 Ga0207656_10043473 3300025321 Bacteria 1916
146 Ga0207655_1009463 3300025728 Bacteria 6041
147 Ga0207710_10525527 3300025900 Bacteria 615
148 Ga0207647_10180294 3300025904 Bacteria 1227
149 Ga0207647_10403092 3300025904 Bacteria 770
150 Ga0207645_10117326 3300025907 Bacteria 1726
151 Ga0207705_10000273 3300025909 Bacteria 49361
152 Ga0207705_10016908 3300025909 Bacteria 5225
153 Ga0207705_11258022 3300025909 Bacteria 566
154 Ga0207654_10000157 3300025911 Bacteria 43470
155 Ga0207654_10172250 3300025911 Bacteria 1406
156 Ga0207654_10645027 3300025911 Bacteria 758
157 Ga0207695_10001225 3300025913 Bacteria 43972
158 Ga0207695_10037983 3300025913 Bacteria 5191
159 Ga0207695_10250448 3300025913 Bacteria 1671
160 Ga0207671_10000018 3300025914 Bacteria 318130
161 Ga0207671_10000676 3300025914 Bacteria 44438
162 Ga0207671_10002655 3300025914 Bacteria 18788
163 Ga0207671_10266173 3300025914 Bacteria 1350
164 Ga0207657_10000074 3300025919 Bacteria 93185
165 Ga0207657_10032080 3300025919 Bacteria 4750
166 Ga0207657_11139472 3300025919 Bacteria 595
167 Ga0207649_10000008 3300025920 Bacteria 315683
168 Ga0207649_10001814 3300025920 Bacteria 12190
169 Ga0207646_10195448 3300025922 Bacteria 1827
170 Ga0207694_10012995 3300025924 Bacteria 6269
171 Ga0207694_10162123 3300025924 Bacteria 1806
172 Ga0207694_10969312 3300025924 Bacteria 719
173 Ga0207687_10190966 3300025927 Bacteria 1594
174 Ga0207687_10193273 3300025927 Bacteria 1585
175 Ga0207687_10367327 3300025927 Bacteria 1176
176 Ga0207644_10114328 3300025931 Bacteria 2045
177 Ga0207644_10598077 3300025931 Bacteria 916
178 Ga0207690_10001426 3300025932 Bacteria 14972
179 Ga0207706_10020821 3300025933 Bacteria 5891
180 Ga0207706_10574565 3300025933 Bacteria 969
181 Ga0207706_11428109 3300025933 Bacteria 567
182 Ga0207686_10000455 3300025934 Bacteria 27218
183 Ga0207704_10051827 3300025938 Bacteria 2484
184 Ga0207691_10112597 3300025940 Bacteria 2418
185 Ga0207689_10162425 3300025942 Bacteria 1840
186 Ga0207689_10285123 3300025942 Bacteria 1368
187 Ga0207661_10571687 3300025944 Bacteria 1036
188 Ga0207679_10000008 3300025945 Bacteria 412057
189 Ga0207679_10039310 3300025945 Bacteria 3377
190 Ga0207679_11700277 3300025945 Bacteria 577
191 Ga0207667_10000004 3300025949 Bacteria 737718
192 Ga0207667_10000422 3300025949 Bacteria 57069
193 Ga0207667_10468724 3300025949 Bacteria 1279
194 Ga0207651_10689308 3300025960 Bacteria 899
195 Ga0207651_10728962 3300025960 Bacteria 875
196 Ga0207640_10417363 3300025981 Bacteria 1097
197 Ga0207640_10872490 3300025981 Bacteria 784
198 Ga0207658_10007422 3300025986 Bacteria 7477
199 Ga0207658_11328139 3300025986 Bacteria 658
200 Ga0207677_10021742 3300026023 Bacteria 3927
201 Ga0207677_10199980 3300026023 Bacteria 1587
202 Ga0207703_10954245 3300026035 Bacteria 822
203 Ga0207703_11004712 3300026035 Bacteria 800
204 Ga0207639_10001113 3300026041 Bacteria 18264
205 Ga0207639_10271050 3300026041 Bacteria 1489
206 Ga0207639_10464329 3300026041 Bacteria 1151
207 Ga0207639_10681621 3300026041 Bacteria 953
208 Ga0207678_10000056 3300026067 Bacteria 86903
209 Ga0207678_10038439 3300026067 Bacteria 4158
210 Ga0207702_10000087 3300026078 Bacteria 105856
211 Ga0207641_11682743 3300026088 Bacteria 636
212 Ga0207641_11771736 3300026088 Bacteria 619
213 Ga0207648_10937594 3300026089 Bacteria 810
214 Ga0207676_10454428 3300026095 Unclassified 1208
215 Ga0207674_10000121 3300026116 Bacteria 90479
216 Ga0207674_10008453 3300026116 Bacteria 11889
217 Ga0207674_10260657 3300026116 Bacteria 1681
218 Ga0207674_10535894 3300026116 Bacteria 1131
219 Ga0207675_100004458 3300026118 Bacteria 13529
220 Ga0207683_10167803 3300026121 Bacteria 1987
221 Ga0207698_10007449 3300026142 Bacteria 6853
222 Ga0207698_10007557 3300026142 Bacteria 6814
223 Ga0207698_10022572 3300026142 Bacteria 4377
224 Ga0207698_10036664 3300026142 Bacteria 3602
225 Ga0207698_11093971 3300026142 Bacteria 810
226 Ga0209813_10112395 3300027866 Bacteria 940
227 Ga0268266_10349086 3300028379 Bacteria 1390
228 Ga0268264_10003717 3300028381 Bacteria 13111
229 Ga0268264_10061599 3300028381 Bacteria 3148
230 Ga0268264_10070808 3300028381 Bacteria 2953
231 Ga0268264_11112681 3300028381 Bacteria 798
232 Ga0265338_10224982 3300028800 Unclassified 1399
233 Ga0307511_10000656 3300030521 Bacteria 36892
234 Ga0307511_10101474 3300030521 Bacteria 1886
235 Ga0307513_10485254 3300031456 Bacteria 955
236 Ga0307408_100128977 3300031548 Bacteria 1970
237 Ga0307408_101191501 3300031548 Bacteria 710
238 Ga0307508_10467092 3300031616 Bacteria 855
239 Ga0307516_10000363 3300031730 Bacteria 59029
240 Ga0307516_10000935 3300031730 Bacteria 40230
241 Ga0307405_10250099 3300031731 Bacteria 1318
242 Ga0307407_11656427 3300031903 Bacteria 509
243 Ga0307416_100125751 3300032002 Bacteria 2296
244 Ga0307414_10380890 3300032004 Bacteria 1220
245 Ga0307411_10129770 3300032005 Bacteria 1840
246 Ga0373946_0651066 3300035171 Bacteria 549
247 Ga0316574_0157195 3300035398 Unclassified 1465
248 Ga0373927_0296103 3300035695 Unclassified 1065
249 Ga0316584_0145185 3300036712 Bacteria 1768
250 Ga0373925_0243698 3300037068 Bacteria 1440
251 Ga0395899_0000005 3300037312 Bacteria 772966
252 Ga0395900_0000090 3300037418 Bacteria 169213
253 Ga0395898_0000003 3300037466 Bacteria 772986
254 Ga0395905_0035294 3300037471 Bacteria 4695
255 Ga0395905_0052766 3300037471 Bacteria 3806
256 Ga0395905_0113931 3300037471 Bacteria 2541
257 Ga0395905_1087877 3300037471 Bacteria 703
258 Ga0395905_1553125 3300037471 Bacteria 566
259 Ga0436364_0206190 3300037853 Bacteria 18748
260 Ga0395901_0000096 3300038443 Bacteria 118723
261 Ga0436361_0462301 3300039447 Bacteria 1995
262 Ga0439436_0004367 3300041404 Bacteria 4330
263 Ga0439438_018409 3300041405 Bacteria 1991
264 Ga0439447_003200 3300041407 Bacteria 5831
265 Ga0439447_003283 3300041407 Bacteria 5753
266 Ga0439447_021042 3300041407 Bacteria 1722
267 Ga0439447_033135 3300041407 Bacteria 1289
268 Ga0439453_0074224 3300041408 Bacteria 724
269 Ga0439466_0001270 3300041411 Bacteria 9813
270 Ga0439466_0013928 3300041411 Bacteria 2937
271 Ga0439466_0086609 3300041411 Bacteria 984
272 Ga0451800_0537557 3300041459 Bacteria 652
273 Ga0451833_0464823 3300041491 Bacteria 695
274 Ga0451841_1339644 3300041498 Bacteria 663
275 Ga0451851_1363885 3300041507 Bacteria 731
276 Ga0451853_1179022 3300041512 Bacteria 593
277 Ga0439431_0099577 3300041997 Bacteria 798
278 Ga0439437_059059 3300042000 Bacteria 518
279 Ga0439442_003490 3300042002 Bacteria 3107
280 Ga0439445_0077812 3300042004 Bacteria 924
281 Ga0439448_0111614 3300042005 Bacteria 934
282 Ga0439432_055267 3300042006 Bacteria 1232
283 Ga0439449_0000685 3300042007 Bacteria 12906
284 Ga0439451_115054 3300042009 Bacteria 546
285 Ga0439452_000097 3300042010 Bacteria 74034
286 Ga0439452_033569 3300042010 Bacteria 1245
287 Ga0439457_121492 3300042014 Bacteria 617
288 Ga0439462_0124477 3300042015 Bacteria 718
289 Ga0439462_0179527 3300042015 Bacteria 600
290 Ga0450911_020428 3300042115 Bacteria 865
291 Ga0450917_016777 3300042120 Bacteria 628
292 Ga0450919_045427 3300042121 Bacteria 513
293 Ga0450922_015240 3300042124 Bacteria 763
294 Ga0450888_013259 3300042126 Bacteria 985
295 Ga0450890_009979 3300042127 Bacteria 1220
296 Ga0450890_040655 3300042127 Bacteria 687
297 Ga0450892_007982 3300042130 Bacteria 900
298 Ga0450894_008540 3300042131 Bacteria 1326
299 Ga0450894_029467 3300042131 Bacteria 762
300 Ga0450896_016615 3300042133 Bacteria 1058
301 Ga0450898_023474 3300042134 Bacteria 1097
302 Ga0450898_033780 3300042134 Bacteria 948
303 Ga0450902_000036 3300042137 Bacteria 11633
304 Ga0450902_104775 3300042137 Bacteria 505
305 Ga0450904_017801 3300042139 Bacteria 714
306 Ga0450889_016098 3300042144 Bacteria 806
307 Ga0450906_003443 3300042145 Bacteria 3404
308 Ga0450910_024342 3300042147 Unclassified 929
309 Ga0450909_033110 3300042185 Bacteria 786
310 Ga0450909_057128 3300042185 Bacteria 613
311 Ga0439434_0003238 3300042435 Bacteria 4781
312 Ga0439434_0142621 3300042435 Bacteria 790
313 Ga0439435_0054405 3300042436 Bacteria 1152
314 Ga0439464_0032748 3300042439 Bacteria 1461
315 Ga0450918_016821 3300042531 Bacteria 1272
316 Ga0450893_0003000 3300042532 Bacteria 2656
317 Ga0450893_0009885 3300042532 Bacteria 1561
318 Ga0450893_0011595 3300042532 Bacteria 1458
319 Ga0439440_0291816 3300042993 Bacteria 506
320 Ga0466969_0040069 3300044656 Bacteria 2349
321 Ga0466969_0058586 3300044656 Bacteria 1874
322 Ga0466972_0090436 3300044658 Bacteria 1452
323 Ga0466972_0421699 3300044658 Unclassified 626
324 Ga0453683_0945142 3300044673 Bacteria 571
325 Ga0466965_0013067 3300044683 Bacteria 3913
326 Ga0466966_0000033 3300044684 Bacteria 101862
327 Ga0466966_0031451 3300044684 Bacteria 3441
328 Ga0466961_0000428 3300044693 Bacteria 26796
329 Ga0466961_0404245 3300044693 Bacteria 828
330 Ga0466963_0028390 3300044694 Bacteria 3592
331 Ga0466963_0302621 3300044694 Bacteria 1125
332 Ga0466964_0035925 3300044706 Bacteria 1984
333 Ga0453684_0026763 3300044712 Bacteria 8311
334 Ga0466971_0052112 3300044719 Bacteria 1843
335 Ga0466970_0048027 3300044765 Bacteria 2275
336 Ga0466957_0035050 3300044842 Bacteria 3011
337 Ga0466959_0079309 3300045049 Bacteria 2367
338 Ga0466959_0141535 3300045049 Bacteria 1699
339 Ga0451576_0043364 3300045051 Bacteria 4747
340 Ga0451576_0809330 3300045051 Bacteria 984
341 Ga0466958_0008900 3300045836 Bacteria 5576
342 Ga0466958_0023611 3300045836 Bacteria 3612
343 Ga0495590_0171019 3300046457 Bacteria 792
344 Ga0495629_0525373 3300046459 Bacteria 796
345 Ga0495638_0006821 3300046460 Bacteria 8244
346 Ga0495638_0062041 3300046460 Bacteria 2308
347 Ga0495638_0064465 3300046460 Bacteria 2257
348 Ga0495651_0626667 3300046462 Bacteria 676
349 Ga0495653_0751366 3300046463 Bacteria 589
350 Ga0495580_0001122 3300046472 Bacteria 23573
351 Ga0495582_0274297 3300046473 Bacteria 968
352 Ga0495639_0003142 3300046475 Bacteria 7173
353 Ga0495639_0158934 3300046475 Bacteria 1093
354 Ga0495594_0076217 3300046499 Bacteria 1870
355 Ga0495594_0387631 3300046499 Bacteria 795
356 Ga0495596_0001198 3300046500 Bacteria 15142
357 Ga0495608_0236354 3300046511 Bacteria 1143
358 Ga0495628_0054173 3300046516 Bacteria 3163
359 Ga0495630_0111477 3300046517 Bacteria 2072
360 Ga0495630_0810414 3300046517 Bacteria 715
361 Ga0495632_0111875 3300046519 Bacteria 1282
362 Ga0495637_0013567 3300046520 Bacteria 3864
363 Ga0495648_0000094 3300046524 Bacteria 110608
364 Ga0495666_0100230 3300046526 Bacteria 1365
365 Ga0495652_0226834 3300046529 Bacteria 1400
366 Ga0495609_0010585 3300046538 Bacteria 4419
367 Ga0495597_0004722 3300046542 Bacteria 7385
368 Ga0495622_0000390 3300046557 Bacteria 29815
369 Ga0495622_0004352 3300046557 Bacteria 6591
370 Ga0495622_0209687 3300046557 Bacteria 866
371 Ga0495668_0605343 3300046616 Bacteria 605
372 Ga0495625_0009562 3300046660 Bacteria 8100
373 Ga0495625_0146014 3300046660 Bacteria 1593
374 Ga0495613_0449317 3300046689 Bacteria 873
375 Ga0495624_0014801 3300046690 Bacteria 5283
376 Ga0495670_0747572 3300046691 Bacteria 533
377 Ga0495671_0476301 3300046692 Bacteria 596
378 Ga0495649_0567594 3300046694 Unclassified 561
379 Ga0495604_0355752 3300047317 Bacteria 972
380 Ga0495674_0201291 3300047319 Bacteria 1652
381 Ga0495674_1242239 3300047319 Unclassified 561
382 Ga0495672_0000299 3300047320 Bacteria 67952
383 Ga0495676_0006620 3300047321 Bacteria 10683
384 Ga0495676_0354545 3300047321 Unclassified 980
385 Ga0495687_000094 3300047443 Bacteria 136181
386 Ga0495687_058195 3300047443 Bacteria 1604
387 Ga0495673_0000205 3300047469 Bacteria 89721
388 Ga0495593_0004146 3300047673 Bacteria 8623
389 Ga0495626_0102114 3300048091 Bacteria 1249
390 Ga0496101_0409704 3300048904 Bacteria 1068
391 Ga0496102_0082074 3300048905 Unclassified 2973
392 Ga0496103_0132005 3300048906 Unclassified 1595
393 Ga0496103_0332183 3300048906 Bacteria 978
394 Ga0496105_0325057 3300048908 Bacteria 1232
395 Ga0496106_0486997 3300048909 Bacteria 991
396 Ga0496106_1017110 3300048909 Bacteria 651
397 Ga0496107_0089012 3300048910 Bacteria 2254
398 Ga0496113_0645763 3300048916 Bacteria 846
399 Ga0496116_0270024 3300048919 Bacteria 832
400 Ga0496117_0150032 3300048920 Unclassified 1381
401 Ga0496117_0393945 3300048920 Bacteria 701
402 Ga0496118_0004258 3300048921 Bacteria 17116
403 Ga0496118_0174823 3300048921 Bacteria 1306
404 Ga0496119_0036641 3300048922 Unclassified 3199
405 Ga0496121_0000563 3300048924 Bacteria 69884
406 Ga0496121_0003811 3300048924 Bacteria 21015
407 Ga0496121_0004609 3300048924 Bacteria 18364
408 Ga0496121_0043638 3300048924 Unclassified 3880
409 Ga0496124_0313501 3300048927 Bacteria 1127
410 Ga0496125_0416422 3300048928 Bacteria 780
411 Ga0496126_0457946 3300048929 Unclassified 1026
412 Ga0496126_0954827 3300048929 Bacteria 646
413 Ga0495682_0126409 3300049460 Unclassified 915
414 Ga0501032_0654877 3300049569 Bacteria 667
415 Ga0501033_0030073 3300049570 Bacteria 4081
416 Ga0501036_0162210 3300049572 Bacteria 1884
417 Ga0501042_0193390 3300049578 Bacteria 1467
418 Ga0501046_0785763 3300049580 Unclassified 668
419 Ga0501047_0078379 3300049581 Bacteria 3177
420 Ga0501047_0355521 3300049581 Bacteria 1301
421 Ga0501074_0391397 3300049590 Bacteria 986
422 Ga0501079_0221936 3300049741 Bacteria 1477
423 Ga0501080_0006813 3300049742 Bacteria 10302
424 Ga0501035_0151432 3300049822 Bacteria 2012
425 Ga0501035_0440001 3300049822 Bacteria 1080
426 Ga0501044_0007080 3300049823 Bacteria 12344
427 Ga0501044_0958576 3300049823 Unclassified 728
428 nmdc:mga03683_2078_c1 3300050489 Bacteria 6145
429 nmdc:mga03683_97576_c1 3300050489 Bacteria 1288
430 nmdc:mga03n38_662324_c1 3300050490 Unclassified 599
431 nmdc:mga00v17_902221_c1 3300050491 Bacteria 559
432 nmdc:mga0k408_48633_c1 3300050493 Bacteria 2454
433 nmdc:mga0k408_613930_c1 3300050493 Bacteria 641
434 nmdc:mga0k408_73674_c1 3300050493 Bacteria 926
435 nmdc:mga06z11_201356_c1 3300050494 Bacteria 1157
436 nmdc:mga04h51_103439_c1 3300050495 Bacteria 1041
437 nmdc:mga07m45_59505_c1 3300050496 Bacteria 2161
438 nmdc:mga07m45_6148_c1 3300050496 Bacteria 6054
439 nmdc:mga0sz30_347528_c1 3300050516 Bacteria 663
440 Ga0500643_186921 3300053087 Bacteria 555
441 Ga0500583_0324742 3300053092 Bacteria 750
442 Ga0500562_007353 3300053108 Bacteria 2778
443 Ga0500572_171102 3300053111 Unclassified 711
444 Ga0500607_105091 3300053121 Bacteria 1395
445 Ga0500559_0130306 3300053136 Bacteria 1175
446 Ga0500577_0239267 3300053142 Bacteria 788
447 Ga0500622_0004035 3300053156 Bacteria 9448
448 Ga0500634_0282062 3300053161 Bacteria 670
449 Ga0500636_0000085 3300053177 Bacteria 46234
450 Ga0500637_0044967 3300053178 Bacteria 2503
451 Ga0500637_0171801 3300053178 Unclassified 1245
452 Ga0500611_001360 3300053727 Bacteria 2667
453 Ga0500625_001201 3300053729 Bacteria 8559
454 Ga0590074_037345 3300059423 Bacteria 869
455 Ga0590075_024696 3300059424 Bacteria 1509
456 Ga0466962_0046390 3300061719 Bacteria 2076
457 Ga0466962_0273457 3300061719 Bacteria 833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002459 JGI24751J29686_10013487 JGI24751J29686_100134872 65
2 3300009092 Ga0105250_10083437 Ga0105250_100834371 65
3 3300009101 Ga0105247_10017410 Ga0105247_100174102 65
4 3300009177 Ga0105248_10071390 Ga0105248_100713903 65
5 3300013306 Ga0163162_11735630 Ga0163162_117356301 65
6 3300014325 Ga0163163_10041826 Ga0163163_100418263 65
7 3300014968 Ga0157379_10950362 Ga0157379_109503622 65
8 3300035398 Ga0316574_0157195 Ga0316574_0157195_299_496 65
9 3300036712 Ga0316584_0145185 Ga0316584_0145185_1305_1502 65
10 3300048904 Ga0496101_0409704 Ga0496101_0409704_30_227 65
11 3300048905 Ga0496102_0082074 Ga0496102_0082074_482_679 65
12 3300048906 Ga0496103_0132005 Ga0496103_0132005_31_228 65
13 3300048909 Ga0496106_1017110 Ga0496106_1017110_377_574 65
14 3300048910 Ga0496107_0089012 Ga0496107_0089012_1873_2070 65
15 3300048919 Ga0496116_0270024 Ga0496116_0270024_606_803 65
16 3300048920 Ga0496117_0150032 Ga0496117_0150032_1123_1320 65
17 3300048921 Ga0496118_0004258 Ga0496118_0004258_11894_12091 65
18 3300048922 Ga0496119_0036641 Ga0496119_0036641_577_774 65
19 3300048924 Ga0496121_0000563 Ga0496121_0000563_58650_58847 65
20 3300048924 Ga0496121_0043638 Ga0496121_0043638_375_572 65
21 3300005289 Ga0065704_10312160 Ga0065704_103121602 75
22 3300005295 Ga0065707_10329442 Ga0065707_103294421 75
23 3300005295 Ga0065707_10475088 Ga0065707_104750882 75
24 3300005468 Ga0070707_100153523 Ga0070707_1001535231 75
25 3300005617 Ga0068859_100192286 Ga0068859_1001922862 75
26 3300005618 Ga0068864_100336482 Ga0068864_1003364823 75
27 3300005841 Ga0068863_100151482 Ga0068863_1001514823 75
28 3300005843 Ga0068860_100016210 Ga0068860_1000162102 75
29 3300006931 Ga0097620_100192295 Ga0097620_1001922953 75
30 3300025922 Ga0207646_10195448 Ga0207646_101954481 75
31 3300026088 Ga0207641_11682743 Ga0207641_116827432 75
32 3300026095 Ga0207676_10454428 Ga0207676_104544282 75
33 3300028381 Ga0268264_10003717 Ga0268264_100037176 75
34 3300048929 Ga0496126_0457946 Ga0496126_0457946_504_731 75
35 3300053087 Ga0500643_186921 Ga0500643_186921_296_523 75
36 3300001979 JGI24740J21852_10000005 JGI24740J21852_1000000544 76
37 3300001990 JGI24737J22298_10000035 JGI24737J22298_1000003535 76
38 3300005288 Ga0065714_10261868 Ga0065714_102618681 76
39 3300005289 Ga0065704_10206420 Ga0065704_102064201 76
40 3300005295 Ga0065707_10000650 Ga0065707_1000065015 76
41 3300005327 Ga0070658_10006589 Ga0070658_100065893 76
42 3300005327 Ga0070658_10010567 Ga0070658_100105678 76
43 3300005329 Ga0070683_100640773 Ga0070683_1006407732 76
44 3300005334 Ga0068869_100087752 Ga0068869_1000877522 76
45 3300005334 Ga0068869_100211419 Ga0068869_1002114192 76
46 3300005338 Ga0068868_100008430 Ga0068868_1000084304 76
47 3300005338 Ga0068868_100117825 Ga0068868_1001178252 76
48 3300005339 Ga0070660_100313746 Ga0070660_1003137462 76
49 3300005339 Ga0070660_100645285 Ga0070660_1006452852 76
50 3300005344 Ga0070661_100000015 Ga0070661_10000001510 76
51 3300005344 Ga0070661_100000903 Ga0070661_10000090317 76
52 3300005353 Ga0070669_101023640 Ga0070669_1010236402 76
53 3300005355 Ga0070671_101276421 Ga0070671_1012764211 76
54 3300005364 Ga0070673_100601228 Ga0070673_1006012282 76
55 3300005364 Ga0070673_101728157 Ga0070673_1017281572 76
56 3300005365 Ga0070688_100573678 Ga0070688_1005736782 76
57 3300005366 Ga0070659_100012886 Ga0070659_1000128863 76
58 3300005366 Ga0070659_100262835 Ga0070659_1002628352 76
59 3300005366 Ga0070659_101249452 Ga0070659_1012494521 76
60 3300005367 Ga0070667_100000694 Ga0070667_1000006942 76
61 3300005367 Ga0070667_100162817 Ga0070667_1001628172 76
62 3300005445 Ga0070708_100368142 Ga0070708_1003681422 76
63 3300005455 Ga0070663_100021576 Ga0070663_1000215764 76
64 3300005455 Ga0070663_100022834 Ga0070663_1000228345 76
65 3300005455 Ga0070663_100902843 Ga0070663_1009028432 76
66 3300005456 Ga0070678_100067935 Ga0070678_1000679353 76
67 3300005457 Ga0070662_100036764 Ga0070662_1000367642 76
68 3300005459 Ga0068867_100112098 Ga0068867_1001120982 76
69 3300005459 Ga0068867_100347907 Ga0068867_1003479072 76
70 3300005466 Ga0070685_11519875 Ga0070685_115198752 76
71 3300005518 Ga0070699_100125407 Ga0070699_1001254073 76
72 3300005535 Ga0070684_100013015 Ga0070684_1000130153 76
73 3300005539 Ga0068853_100031044 Ga0068853_1000310443 76
74 3300005539 Ga0068853_100111825 Ga0068853_1001118253 76
75 3300005539 Ga0068853_100686125 Ga0068853_1006861251 76
76 3300005539 Ga0068853_101804121 Ga0068853_1018041212 76
77 3300005548 Ga0070665_100405739 Ga0070665_1004057392 76
78 3300005548 Ga0070665_100538950 Ga0070665_1005389502 76
79 3300005548 Ga0070665_100681383 Ga0070665_1006813832 76
80 3300005563 Ga0068855_100081673 Ga0068855_1000816734 76
81 3300005563 Ga0068855_100514985 Ga0068855_1005149852 76
82 3300005564 Ga0070664_100000015 Ga0070664_10000001595 76
83 3300005564 Ga0070664_100007168 Ga0070664_1000071689 76
84 3300005577 Ga0068857_100087366 Ga0068857_1000873663 76
85 3300005577 Ga0068857_100110858 Ga0068857_1001108583 76
86 3300005577 Ga0068857_100140614 Ga0068857_1001406143 76
87 3300005578 Ga0068854_100021361 Ga0068854_1000213615 76
88 3300005578 Ga0068854_100037838 Ga0068854_1000378384 76
89 3300005578 Ga0068854_101047946 Ga0068854_1010479462 76
90 3300005614 Ga0068856_100074577 Ga0068856_1000745772 76
91 3300005616 Ga0068852_100033145 Ga0068852_1000331453 76
92 3300005616 Ga0068852_100098202 Ga0068852_1000982022 76
93 3300005616 Ga0068852_100136609 Ga0068852_1001366093 76
94 3300005616 Ga0068852_100385202 Ga0068852_1003852023 76
95 3300005616 Ga0068852_100744232 Ga0068852_1007442322 76
96 3300005617 Ga0068859_100827115 Ga0068859_1008271152 76
97 3300005718 Ga0068866_10739982 Ga0068866_107399822 76
98 3300005719 Ga0068861_100003019 Ga0068861_1000030193 76
99 3300005834 Ga0068851_10003361 Ga0068851_100033616 76
100 3300005840 Ga0068870_10318765 Ga0068870_103187652 76
101 3300005841 Ga0068863_101952233 Ga0068863_1019522332 76
102 3300005843 Ga0068860_100051362 Ga0068860_1000513625 76
103 3300005843 Ga0068860_100969107 Ga0068860_1009691072 76
104 3300005843 Ga0068860_101182539 Ga0068860_1011825392 76
105 3300006177 Ga0075362_10017470 Ga0075362_100174703 76
106 3300006177 Ga0075362_10113942 Ga0075362_101139422 76
107 3300006177 Ga0075362_10409571 Ga0075362_104095712 76
108 3300006178 Ga0075367_10030769 Ga0075367_100307692 76
109 3300006195 Ga0075366_10017075 Ga0075366_100170754 76
110 3300006195 Ga0075366_10086544 Ga0075366_100865443 76
111 3300006195 Ga0075366_10335277 Ga0075366_103352772 76
112 3300006353 Ga0075370_10013122 Ga0075370_100131223 76
113 3300006353 Ga0075370_10419328 Ga0075370_104193282 76
114 3300006358 Ga0068871_101023479 Ga0068871_1010234792 76
115 3300006881 Ga0068865_100067885 Ga0068865_1000678853 76
116 3300006931 Ga0097620_100827116 Ga0097620_1008271162 76
117 3300009093 Ga0105240_10008102 Ga0105240_1000810210 76
118 3300009093 Ga0105240_10015784 Ga0105240_100157845 76
119 3300009093 Ga0105240_10270998 Ga0105240_102709982 76
120 3300009093 Ga0105240_12216359 Ga0105240_122163592 76
121 3300009098 Ga0105245_10121818 Ga0105245_101218183 76
122 3300009098 Ga0105245_10678099 Ga0105245_106780992 76
123 3300009101 Ga0105247_10749752 Ga0105247_107497521 76
124 3300009101 Ga0105247_11049843 Ga0105247_110498432 76
125 3300009148 Ga0105243_10077425 Ga0105243_100774252 76
126 3300009174 Ga0105241_10013755 Ga0105241_100137557 76
127 3300009174 Ga0105241_10087732 Ga0105241_100877322 76
128 3300009174 Ga0105241_11050887 Ga0105241_110508871 76
129 3300009176 Ga0105242_10095776 Ga0105242_100957763 76
130 3300009545 Ga0105237_10000736 Ga0105237_1000073620 76
131 3300009545 Ga0105237_10040247 Ga0105237_100402474 76
132 3300009545 Ga0105237_10561871 Ga0105237_105618712 76
133 3300009545 Ga0105237_10937157 Ga0105237_109371572 76
134 3300009551 Ga0105238_10000822 Ga0105238_1000082217 76
135 3300009551 Ga0105238_11148837 Ga0105238_111488372 76
136 3300010159 Ga0099796_10254114 Ga0099796_102541142 76
137 3300010375 Ga0105239_10001794 Ga0105239_1000179411 76
138 3300010375 Ga0105239_10002743 Ga0105239_100027434 76
139 3300010375 Ga0105239_10605889 Ga0105239_106058892 76
140 3300011119 Ga0105246_10040038 Ga0105246_100400386 76
141 3300013100 Ga0157373_10012249 Ga0157373_100122496 76
142 3300013102 Ga0157371_10000111 Ga0157371_1000011192 76
143 3300013102 Ga0157371_10173484 Ga0157371_101734842 76
144 3300013104 Ga0157370_10022785 Ga0157370_100227853 76
145 3300013104 Ga0157370_10100194 Ga0157370_101001943 76
146 3300013104 Ga0157370_10247139 Ga0157370_102471392 76
147 3300013105 Ga0157369_10000126 Ga0157369_1000012621 76
148 3300013105 Ga0157369_10007456 Ga0157369_100074568 76
149 3300013105 Ga0157369_10092229 Ga0157369_100922292 76
150 3300013296 Ga0157374_10590382 Ga0157374_105903822 76
151 3300013296 Ga0157374_11802204 Ga0157374_118022042 76
152 3300013306 Ga0163162_10138600 Ga0163162_101386003 76
153 3300013306 Ga0163162_10641242 Ga0163162_106412422 76
154 3300013307 Ga0157372_10248725 Ga0157372_102487252 76
155 3300013308 Ga0157375_10031824 Ga0157375_100318243 76
156 3300013308 Ga0157375_11637002 Ga0157375_116370022 76
157 3300014326 Ga0157380_10001410 Ga0157380_100014103 76
158 3300014745 Ga0157377_11038578 Ga0157377_110385782 76
159 3300014968 Ga0157379_10153130 Ga0157379_101531301 76
160 3300015262 Ga0182007_10157521 Ga0182007_101575212 76
161 3300021361 Ga0213872_10184468 Ga0213872_101844682 76
162 3300021388 Ga0213875_10001099 Ga0213875_1000109916 76
163 3300025261 Ga0209233_1017417 Ga0209233_10174173 76
164 3300025321 Ga0207656_10043473 Ga0207656_100434732 76
165 3300025728 Ga0207655_1009463 Ga0207655_10094635 76
166 3300025900 Ga0207710_10525527 Ga0207710_105255272 76
167 3300025904 Ga0207647_10180294 Ga0207647_101802943 76
168 3300025904 Ga0207647_10403092 Ga0207647_104030922 76
169 3300025907 Ga0207645_10117326 Ga0207645_101173263 76
170 3300025909 Ga0207705_10000273 Ga0207705_1000027319 76
171 3300025909 Ga0207705_10016908 Ga0207705_100169083 76
172 3300025909 Ga0207705_11258022 Ga0207705_112580222 76
173 3300025911 Ga0207654_10000157 Ga0207654_1000015730 76
174 3300025911 Ga0207654_10172250 Ga0207654_101722502 76
175 3300025911 Ga0207654_10645027 Ga0207654_106450272 76
176 3300025913 Ga0207695_10001225 Ga0207695_1000122514 76
177 3300025913 Ga0207695_10037983 Ga0207695_100379832 76
178 3300025913 Ga0207695_10250448 Ga0207695_102504482 76
179 3300025914 Ga0207671_10000018 Ga0207671_1000001894 76
180 3300025914 Ga0207671_10000676 Ga0207671_1000067618 76
181 3300025914 Ga0207671_10002655 Ga0207671_1000265517 76
182 3300025914 Ga0207671_10266173 Ga0207671_102661731 76
183 3300025919 Ga0207657_10000074 Ga0207657_1000007442 76
184 3300025919 Ga0207657_10032080 Ga0207657_100320803 76
185 3300025919 Ga0207657_11139472 Ga0207657_111394722 76
186 3300025920 Ga0207649_10000008 Ga0207649_1000000887 76
187 3300025920 Ga0207649_10001814 Ga0207649_1000181412 76
188 3300025924 Ga0207694_10012995 Ga0207694_100129954 76
189 3300025924 Ga0207694_10162123 Ga0207694_101621232 76
190 3300025924 Ga0207694_10969312 Ga0207694_109693122 76
191 3300025927 Ga0207687_10190966 Ga0207687_101909662 76
192 3300025927 Ga0207687_10193273 Ga0207687_101932732 76
193 3300025927 Ga0207687_10367327 Ga0207687_103673272 76
194 3300025931 Ga0207644_10114328 Ga0207644_101143283 76
195 3300025931 Ga0207644_10598077 Ga0207644_105980772 76
196 3300025932 Ga0207690_10001426 Ga0207690_100014266 76
197 3300025933 Ga0207706_10020821 Ga0207706_100208212 76
198 3300025933 Ga0207706_10574565 Ga0207706_105745652 76
199 3300025933 Ga0207706_11428109 Ga0207706_114281092 76
200 3300025934 Ga0207686_10000455 Ga0207686_100004557 76
201 3300025938 Ga0207704_10051827 Ga0207704_100518272 76
202 3300025940 Ga0207691_10112597 Ga0207691_101125972 76
203 3300025942 Ga0207689_10162425 Ga0207689_101624252 76
204 3300025942 Ga0207689_10285123 Ga0207689_102851232 76
205 3300025944 Ga0207661_10571687 Ga0207661_105716872 76
206 3300025945 Ga0207679_10000008 Ga0207679_10000008302 76
207 3300025945 Ga0207679_10039310 Ga0207679_100393104 76
208 3300025945 Ga0207679_11700277 Ga0207679_117002771 76
209 3300025949 Ga0207667_10000004 Ga0207667_10000004547 76
210 3300025949 Ga0207667_10000422 Ga0207667_1000042251 76
211 3300025949 Ga0207667_10468724 Ga0207667_104687242 76
212 3300025960 Ga0207651_10689308 Ga0207651_106893082 76
213 3300025960 Ga0207651_10728962 Ga0207651_107289622 76
214 3300025981 Ga0207640_10417363 Ga0207640_104173633 76
215 3300025981 Ga0207640_10872490 Ga0207640_108724902 76
216 3300025986 Ga0207658_10007422 Ga0207658_100074224 76
217 3300025986 Ga0207658_11328139 Ga0207658_113281392 76
218 3300026023 Ga0207677_10021742 Ga0207677_100217422 76
219 3300026023 Ga0207677_10199980 Ga0207677_101999802 76
220 3300026035 Ga0207703_10954245 Ga0207703_109542452 76
221 3300026035 Ga0207703_11004712 Ga0207703_110047121 76
222 3300026041 Ga0207639_10001113 Ga0207639_100011133 76
223 3300026041 Ga0207639_10271050 Ga0207639_102710502 76
224 3300026041 Ga0207639_10464329 Ga0207639_104643292 76
225 3300026041 Ga0207639_10681621 Ga0207639_106816212 76
226 3300026067 Ga0207678_10000056 Ga0207678_1000005643 76
227 3300026067 Ga0207678_10038439 Ga0207678_100384394 76
228 3300026078 Ga0207702_10000087 Ga0207702_1000008763 76
229 3300026088 Ga0207641_11771736 Ga0207641_117717362 76
230 3300026089 Ga0207648_10937594 Ga0207648_109375942 76
231 3300026116 Ga0207674_10000121 Ga0207674_1000012142 76
232 3300026116 Ga0207674_10008453 Ga0207674_100084534 76
233 3300026116 Ga0207674_10260657 Ga0207674_102606572 76
234 3300026116 Ga0207674_10535894 Ga0207674_105358942 76
235 3300026118 Ga0207675_100004458 Ga0207675_1000044583 76
236 3300026121 Ga0207683_10167803 Ga0207683_101678032 76
237 3300026142 Ga0207698_10007449 Ga0207698_100074493 76
238 3300026142 Ga0207698_10007557 Ga0207698_100075572 76
239 3300026142 Ga0207698_10022572 Ga0207698_100225723 76
240 3300026142 Ga0207698_10036664 Ga0207698_100366643 76
241 3300026142 Ga0207698_11093971 Ga0207698_110939712 76
242 3300027866 Ga0209813_10112395 Ga0209813_101123952 76
243 3300028379 Ga0268266_10349086 Ga0268266_103490862 76
244 3300028381 Ga0268264_10061599 Ga0268264_100615992 76
245 3300028381 Ga0268264_10070808 Ga0268264_100708082 76
246 3300028381 Ga0268264_11112681 Ga0268264_111126812 76
247 3300028800 Ga0265338_10224982 Ga0265338_102249822 76
248 3300030521 Ga0307511_10000656 Ga0307511_1000065624 76
249 3300030521 Ga0307511_10101474 Ga0307511_101014744 76
250 3300031456 Ga0307513_10485254 Ga0307513_104852542 76
251 3300031548 Ga0307408_100128977 Ga0307408_1001289773 76
252 3300031548 Ga0307408_101191501 Ga0307408_1011915012 76
253 3300031616 Ga0307508_10467092 Ga0307508_104670922 76
254 3300031730 Ga0307516_10000363 Ga0307516_1000036332 76
255 3300031730 Ga0307516_10000935 Ga0307516_1000093513 76
256 3300031731 Ga0307405_10250099 Ga0307405_102500993 76
257 3300031903 Ga0307407_11656427 Ga0307407_116564271 76
258 3300032002 Ga0307416_100125751 Ga0307416_1001257512 76
259 3300032004 Ga0307414_10380890 Ga0307414_103808902 76
260 3300032005 Ga0307411_10129770 Ga0307411_101297702 76
261 3300035171 Ga0373946_0651066 Ga0373946_0651066_231_461 76
262 3300035695 Ga0373927_0296103 Ga0373927_0296103_430_660 76
263 3300037068 Ga0373925_0243698 Ga0373925_0243698_803_1033 76
264 3300037312 Ga0395899_0000005 Ga0395899_0000005_49571_49801 76
265 3300037418 Ga0395900_0000090 Ga0395900_0000090_119413_119643 76
266 3300037466 Ga0395898_0000003 Ga0395898_0000003_49571_49801 76
267 3300037471 Ga0395905_0035294 Ga0395905_0035294_3398_3628 76
268 3300037471 Ga0395905_0052766 Ga0395905_0052766_2308_2538 76
269 3300037471 Ga0395905_0113931 Ga0395905_0113931_1958_2188 76
270 3300037471 Ga0395905_1087877 Ga0395905_1087877_300_530 76
271 3300037471 Ga0395905_1553125 Ga0395905_1553125_67_297 76
272 3300037853 Ga0436364_0206190 Ga0436364_0206190_8706_8936 76
273 3300038443 Ga0395901_0000096 Ga0395901_0000096_45210_45440 76
274 3300039447 Ga0436361_0462301 Ga0436361_0462301_405_635 76
275 3300041404 Ga0439436_0004367 Ga0439436_0004367_959_1189 76
276 3300041405 Ga0439438_018409 Ga0439438_018409_1375_1605 76
277 3300041407 Ga0439447_003200 Ga0439447_003200_3765_3995 76
278 3300041407 Ga0439447_003283 Ga0439447_003283_1760_1990 76
279 3300041407 Ga0439447_021042 Ga0439447_021042_457_687 76
280 3300041407 Ga0439447_033135 Ga0439447_033135_160_390 76
281 3300041408 Ga0439453_0074224 Ga0439453_0074224_415_645 76
282 3300041411 Ga0439466_0001270 Ga0439466_0001270_1673_1903 76
283 3300041411 Ga0439466_0013928 Ga0439466_0013928_1406_1636 76
284 3300041411 Ga0439466_0086609 Ga0439466_0086609_26_256 76
285 3300041459 Ga0451800_0537557 Ga0451800_0537557_235_465 76
286 3300041491 Ga0451833_0464823 Ga0451833_0464823_274_504 76
287 3300041498 Ga0451841_1339644 Ga0451841_1339644_360_590 76
288 3300041507 Ga0451851_1363885 Ga0451851_1363885_439_669 76
289 3300041512 Ga0451853_1179022 Ga0451853_1179022_59_289 76
290 3300041997 Ga0439431_0099577 Ga0439431_0099577_175_405 76
291 3300042000 Ga0439437_059059 Ga0439437_059059_163_393 76
292 3300042002 Ga0439442_003490 Ga0439442_003490_2844_3074 76
293 3300042004 Ga0439445_0077812 Ga0439445_0077812_267_497 76
294 3300042005 Ga0439448_0111614 Ga0439448_0111614_515_745 76
295 3300042006 Ga0439432_055267 Ga0439432_055267_350_580 76
296 3300042007 Ga0439449_0000685 Ga0439449_0000685_1365_1595 76
297 3300042009 Ga0439451_115054 Ga0439451_115054_135_365 76
298 3300042010 Ga0439452_000097 Ga0439452_000097_56181_56411 76
299 3300042010 Ga0439452_033569 Ga0439452_033569_161_391 76
300 3300042014 Ga0439457_121492 Ga0439457_121492_217_447 76
301 3300042015 Ga0439462_0124477 Ga0439462_0124477_428_658 76
302 3300042015 Ga0439462_0179527 Ga0439462_0179527_343_573 76
303 3300042115 Ga0450911_020428 Ga0450911_020428_228_458 76
304 3300042120 Ga0450917_016777 Ga0450917_016777_170_400 76
305 3300042121 Ga0450919_045427 Ga0450919_045427_241_471 76
306 3300042124 Ga0450922_015240 Ga0450922_015240_220_450 76
307 3300042126 Ga0450888_013259 Ga0450888_013259_170_400 76
308 3300042127 Ga0450890_009979 Ga0450890_009979_804_1034 76
309 3300042127 Ga0450890_040655 Ga0450890_040655_38_268 76
310 3300042130 Ga0450892_007982 Ga0450892_007982_384_614 76
311 3300042131 Ga0450894_008540 Ga0450894_008540_813_1043 76
312 3300042131 Ga0450894_029467 Ga0450894_029467_395_625 76
313 3300042133 Ga0450896_016615 Ga0450896_016615_114_344 76
314 3300042134 Ga0450898_023474 Ga0450898_023474_823_1053 76
315 3300042134 Ga0450898_033780 Ga0450898_033780_203_433 76
316 3300042137 Ga0450902_000036 Ga0450902_000036_1836_2066 76
317 3300042137 Ga0450902_104775 Ga0450902_104775_183_413 76
318 3300042139 Ga0450904_017801 Ga0450904_017801_207_437 76
319 3300042144 Ga0450889_016098 Ga0450889_016098_445_675 76
320 3300042145 Ga0450906_003443 Ga0450906_003443_3080_3310 76
321 3300042147 Ga0450910_024342 Ga0450910_024342_489_719 76
322 3300042185 Ga0450909_033110 Ga0450909_033110_402_632 76
323 3300042185 Ga0450909_057128 Ga0450909_057128_212_442 76
324 3300042435 Ga0439434_0003238 Ga0439434_0003238_575_805 76
325 3300042435 Ga0439434_0142621 Ga0439434_0142621_315_545 76
326 3300042436 Ga0439435_0054405 Ga0439435_0054405_713_943 76
327 3300042439 Ga0439464_0032748 Ga0439464_0032748_246_476 76
328 3300042531 Ga0450918_016821 Ga0450918_016821_137_367 76
329 3300042532 Ga0450893_0003000 Ga0450893_0003000_1499_1729 76
330 3300042532 Ga0450893_0009885 Ga0450893_0009885_1048_1278 76
331 3300042532 Ga0450893_0011595 Ga0450893_0011595_1015_1245 76
332 3300042993 Ga0439440_0291816 Ga0439440_0291816_31_261 76
333 3300044656 Ga0466969_0040069 Ga0466969_0040069_73_303 76
334 3300044656 Ga0466969_0058586 Ga0466969_0058586_352_582 76
335 3300044658 Ga0466972_0090436 Ga0466972_0090436_726_956 76
336 3300044658 Ga0466972_0421699 Ga0466972_0421699_259_489 76
337 3300044673 Ga0453683_0945142 Ga0453683_0945142_34_264 76
338 3300044683 Ga0466965_0013067 Ga0466965_0013067_1666_1896 76
339 3300044684 Ga0466966_0000033 Ga0466966_0000033_46913_47143 76
340 3300044684 Ga0466966_0031451 Ga0466966_0031451_1411_1641 76
341 3300044693 Ga0466961_0000428 Ga0466961_0000428_4064_4294 76
342 3300044693 Ga0466961_0404245 Ga0466961_0404245_52_282 76
343 3300044694 Ga0466963_0028390 Ga0466963_0028390_236_466 76
344 3300044694 Ga0466963_0302621 Ga0466963_0302621_18_248 76
345 3300044706 Ga0466964_0035925 Ga0466964_0035925_1403_1633 76
346 3300044712 Ga0453684_0026763 Ga0453684_0026763_1452_1694 76
347 3300044719 Ga0466971_0052112 Ga0466971_0052112_454_684 76
348 3300044765 Ga0466970_0048027 Ga0466970_0048027_1667_1897 76
349 3300044842 Ga0466957_0035050 Ga0466957_0035050_1651_1881 76
350 3300045049 Ga0466959_0079309 Ga0466959_0079309_1512_1742 76
351 3300045049 Ga0466959_0141535 Ga0466959_0141535_854_1084 76
352 3300045051 Ga0451576_0043364 Ga0451576_0043364_3854_4096 76
353 3300045051 Ga0451576_0809330 Ga0451576_0809330_478_708 76
354 3300045836 Ga0466958_0008900 Ga0466958_0008900_3414_3644 76
355 3300045836 Ga0466958_0023611 Ga0466958_0023611_2930_3160 76
356 3300046457 Ga0495590_0171019 Ga0495590_0171019_139_369 76
357 3300046459 Ga0495629_0525373 Ga0495629_0525373_377_607 76
358 3300046460 Ga0495638_0006821 Ga0495638_0006821_143_373 76
359 3300046460 Ga0495638_0062041 Ga0495638_0062041_2042_2272 76
360 3300046460 Ga0495638_0064465 Ga0495638_0064465_1416_1646 76
361 3300046462 Ga0495651_0626667 Ga0495651_0626667_219_449 76
362 3300046463 Ga0495653_0751366 Ga0495653_0751366_104_334 76
363 3300046472 Ga0495580_0001122 Ga0495580_0001122_7298_7528 76
364 3300046473 Ga0495582_0274297 Ga0495582_0274297_343_573 76
365 3300046475 Ga0495639_0003142 Ga0495639_0003142_2150_2380 76
366 3300046475 Ga0495639_0158934 Ga0495639_0158934_77_307 76
367 3300046499 Ga0495594_0076217 Ga0495594_0076217_747_995 76
368 3300046499 Ga0495594_0387631 Ga0495594_0387631_353_583 76
369 3300046500 Ga0495596_0001198 Ga0495596_0001198_4789_5019 76
370 3300046511 Ga0495608_0236354 Ga0495608_0236354_727_957 76
371 3300046516 Ga0495628_0054173 Ga0495628_0054173_1988_2218 76
372 3300046517 Ga0495630_0111477 Ga0495630_0111477_773_1003 76
373 3300046517 Ga0495630_0810414 Ga0495630_0810414_346_576 76
374 3300046519 Ga0495632_0111875 Ga0495632_0111875_207_437 76
375 3300046520 Ga0495637_0013567 Ga0495637_0013567_1046_1276 76
376 3300046524 Ga0495648_0000094 Ga0495648_0000094_57001_57249 76
377 3300046526 Ga0495666_0100230 Ga0495666_0100230_327_557 76
378 3300046529 Ga0495652_0226834 Ga0495652_0226834_539_769 76
379 3300046538 Ga0495609_0010585 Ga0495609_0010585_2345_2593 76
380 3300046542 Ga0495597_0004722 Ga0495597_0004722_1448_1678 76
381 3300046557 Ga0495622_0000390 Ga0495622_0000390_17910_18158 76
382 3300046557 Ga0495622_0004352 Ga0495622_0004352_1443_1691 76
383 3300046557 Ga0495622_0209687 Ga0495622_0209687_241_471 76
384 3300046616 Ga0495668_0605343 Ga0495668_0605343_294_524 76
385 3300046660 Ga0495625_0009562 Ga0495625_0009562_2092_2322 76
386 3300046660 Ga0495625_0146014 Ga0495625_0146014_947_1177 76
387 3300046689 Ga0495613_0449317 Ga0495613_0449317_438_668 76
388 3300046690 Ga0495624_0014801 Ga0495624_0014801_528_758 76
389 3300046691 Ga0495670_0747572 Ga0495670_0747572_272_520 76
390 3300046692 Ga0495671_0476301 Ga0495671_0476301_112_342 76
391 3300046694 Ga0495649_0567594 Ga0495649_0567594_244_474 76
392 3300047317 Ga0495604_0355752 Ga0495604_0355752_83_313 76
393 3300047319 Ga0495674_0201291 Ga0495674_0201291_199_429 76
394 3300047319 Ga0495674_1242239 Ga0495674_1242239_89_319 76
395 3300047320 Ga0495672_0000299 Ga0495672_0000299_47231_47479 76
396 3300047321 Ga0495676_0006620 Ga0495676_0006620_8520_8750 76
397 3300047321 Ga0495676_0354545 Ga0495676_0354545_412_642 76
398 3300047443 Ga0495687_000094 Ga0495687_000094_64655_64885 76
399 3300047443 Ga0495687_058195 Ga0495687_058195_991_1221 76
400 3300047469 Ga0495673_0000205 Ga0495673_0000205_8896_9126 76
401 3300047673 Ga0495593_0004146 Ga0495593_0004146_4095_4325 76
402 3300048091 Ga0495626_0102114 Ga0495626_0102114_1005_1235 76
403 3300048906 Ga0496103_0332183 Ga0496103_0332183_666_896 76
404 3300048908 Ga0496105_0325057 Ga0496105_0325057_622_852 76
405 3300048909 Ga0496106_0486997 Ga0496106_0486997_213_443 76
406 3300048916 Ga0496113_0645763 Ga0496113_0645763_348_578 76
407 3300048920 Ga0496117_0393945 Ga0496117_0393945_363_593 76
408 3300048921 Ga0496118_0174823 Ga0496118_0174823_893_1123 76
409 3300048924 Ga0496121_0003811 Ga0496121_0003811_763_993 76
410 3300048924 Ga0496121_0004609 Ga0496121_0004609_9123_9353 76
411 3300048927 Ga0496124_0313501 Ga0496124_0313501_846_1076 76
412 3300048928 Ga0496125_0416422 Ga0496125_0416422_207_437 76
413 3300048929 Ga0496126_0954827 Ga0496126_0954827_110_340 76
414 3300049460 Ga0495682_0126409 Ga0495682_0126409_439_669 76
415 3300049569 Ga0501032_0654877 Ga0501032_0654877_349_579 76
416 3300049570 Ga0501033_0030073 Ga0501033_0030073_3648_3878 76
417 3300049572 Ga0501036_0162210 Ga0501036_0162210_79_309 76
418 3300049578 Ga0501042_0193390 Ga0501042_0193390_19_249 76
419 3300049580 Ga0501046_0785763 Ga0501046_0785763_209_439 76
420 3300049581 Ga0501047_0078379 Ga0501047_0078379_2736_2966 76
421 3300049581 Ga0501047_0355521 Ga0501047_0355521_1038_1268 76
422 3300049590 Ga0501074_0391397 Ga0501074_0391397_48_278 76
423 3300049741 Ga0501079_0221936 Ga0501079_0221936_508_738 76
424 3300049742 Ga0501080_0006813 Ga0501080_0006813_5807_6037 76
425 3300049822 Ga0501035_0151432 Ga0501035_0151432_853_1083 76
426 3300049822 Ga0501035_0440001 Ga0501035_0440001_113_343 76
427 3300049823 Ga0501044_0007080 Ga0501044_0007080_2758_2988 76
428 3300049823 Ga0501044_0958576 Ga0501044_0958576_302_532 76
429 3300050489 nmdc:mga03683_2078_c1 nmdc:mga03683_2078_c1_4880_5110 76
430 3300050489 nmdc:mga03683_97576_c1 nmdc:mga03683_97576_c1_110_379 76
431 3300050490 nmdc:mga03n38_662324_c1 nmdc:mga03n38_662324_c1_284_514 76
432 3300050491 nmdc:mga00v17_902221_c1 nmdc:mga00v17_902221_c1_160_429 76
433 3300050493 nmdc:mga0k408_48633_c1 nmdc:mga0k408_48633_c1_2147_2416 76
434 3300050493 nmdc:mga0k408_613930_c1 nmdc:mga0k408_613930_c1_35_265 76
435 3300050493 nmdc:mga0k408_73674_c1 nmdc:mga0k408_73674_c1_503_733 76
436 3300050494 nmdc:mga06z11_201356_c1 nmdc:mga06z11_201356_c1_528_797 76
437 3300050495 nmdc:mga04h51_103439_c1 nmdc:mga04h51_103439_c1_383_652 76
438 3300050496 nmdc:mga07m45_59505_c1 nmdc:mga07m45_59505_c1_1600_1830 76
439 3300050496 nmdc:mga07m45_6148_c1 nmdc:mga07m45_6148_c1_3357_3587 76
440 3300050516 nmdc:mga0sz30_347528_c1 nmdc:mga0sz30_347528_c1_332_601 76
441 3300053092 Ga0500583_0324742 Ga0500583_0324742_272_502 76
442 3300053108 Ga0500562_007353 Ga0500562_007353_1609_1839 76
443 3300053111 Ga0500572_171102 Ga0500572_171102_449_679 76
444 3300053121 Ga0500607_105091 Ga0500607_105091_397_627 76
445 3300053136 Ga0500559_0130306 Ga0500559_0130306_493_723 76
446 3300053142 Ga0500577_0239267 Ga0500577_0239267_379_609 76
447 3300053156 Ga0500622_0004035 Ga0500622_0004035_7449_7679 76
448 3300053161 Ga0500634_0282062 Ga0500634_0282062_159_389 76
449 3300053177 Ga0500636_0000085 Ga0500636_0000085_9928_10158 76
450 3300053178 Ga0500637_0044967 Ga0500637_0044967_822_1052 76
451 3300053178 Ga0500637_0171801 Ga0500637_0171801_357_587 76
452 3300053727 Ga0500611_001360 Ga0500611_001360_2027_2257 76
453 3300053729 Ga0500625_001201 Ga0500625_001201_6471_6701 76
454 3300059423 Ga0590074_037345 Ga0590074_037345_40_270 76
455 3300059424 Ga0590075_024696 Ga0590075_024696_876_1106 76
456 3300061719 Ga0466962_0046390 Ga0466962_0046390_1152_1382 76
457 3300061719 Ga0466962_0273457 Ga0466962_0273457_512_742 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

3

75

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5csa-assembly1.cif.gz_A crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.9467 3 76
3crk-assembly1.cif.gz_C crystal structure of the pdhk2-l2 complex. 0.941 2 75
5csl-assembly1.cif.gz_A crystal structure of the 500 kd yeast acetyl-coa carboxylase holoenzyme dimer 0.9395 3 76
1y8p-assembly1.cif.gz_B crystal structure of the pdk3-l2 complex 0.9354 1 76
6g2i-assembly1.cif.gz_R filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution 0.9276 4 76
ID Description Score Start End Superfamily
af_A0A1D6KPB2_40_143_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9597 2 75 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9562 5 76 2.40.50.100
af_Q4DYI5_10_111_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9485 1 76 2.40.50.100
af_A4I7A2_659_729_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9476 3 76 2.40.50.100
af_Q2G2A4_2_90_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9432 3 76 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2I2L2S9-F1-model_v4 Dihydrolipoamide acyltransferase 0.9803 1 75 GO:0005737
GO:0016407
GO:0031405
AF-A0A1B3N9J5-F1-model_v4 Biotin-requiring enzyme family protein 0.9798 1 76 GO:0006086
GO:0045254
AF-A0A031K6L3-F1-model_v4 Biotin/lipoyl attachment domain-containing protein 0.9791 1 76 GO:0005737
GO:0016407
GO:0031405
AF-A0A2E7TBW6-F1-model_v4 Lipoyl-binding domain-containing protein 0.9783 1 76 GO:0006086
GO:0045254
AF-A0A0M2NMX0-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.9781 1 75 GO:0004148
GO:0006090
GO:0006103
GO:0050660

Feature Viewer

pLDDT pTM Quality
94.23 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map