F447388

General Info

Members Datasets Scaffolds Average Seq Length
454 269 904 342

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10016717|Ga0157379_100167175
Length 417
Sequence LQCIDDMARIIGSRPPRGQTHTTLRKRSKMNRLGRRHRRVASATSRPRRLATMRACRTHRWRPDVPTTLATNHQIRLAARPIGLPKATDWQATSEPVAEPAGGVLVKVLTLSLDPAMRGWMNEGRSYIKPVEIGEVMRAGGVGRVIASQHPAFAVGDAVAGTFGVQEYWSVDGEQVPKSGLHKIDLRLGTPTQWLNVLGMPGMTAYFGLLDVGQPTPGDTVVVSGAAGAVGQTVGQLAKIKGCRAVGIAGGPAKCEWVVKELGFDACIDYKAAAPAGATRWDAVREGLKAHCPDGVNVYFDNVGGDILDTVLARLARKARIVICGAISQYNSSAGMAGPKNYMSLLVNRARMEGMVVFDYADRYPQAVAELAGYLKEGRIKSKEDVVPGGVQAFPSTLLKLFSGENFGKLVLRVADE

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
185 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
266 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
267 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
268 2738543013 Variovorax sp. BT01 Isolate Unclassified
269 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.22
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0
Rhizoplane 6.83
Rhizosphere 83.48
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10016717 3300014968 Bacteria 6455
2 JGI25153J46596_10022725 3300003215 Bacteria 2303
3 Ga0006777J48905_1074619 3300003308 Bacteria 1769
4 rootH1_10075912 3300003316 Bacteria 2862
5 rootH1_10026350 3300003323 Bacteria 3770
6 Ga0065715_10111173 3300005293 Bacteria 2584
7 Ga0065707_10085596 3300005295 Bacteria 6029
8 Ga0070658_10087224 3300005327 Bacteria 2568
9 Ga0070676_10037404 3300005328 Bacteria 2799
10 Ga0070676_10174804 3300005328 Bacteria 1392
11 Ga0070690_100004787 3300005330 Bacteria 7551
12 Ga0070670_100082725 3300005331 Bacteria 2759
13 Ga0070677_10041536 3300005333 Bacteria 1816
14 Ga0068869_100150988 3300005334 Bacteria 1802
15 Ga0070666_10007288 3300005335 Bacteria 6814
16 Ga0070666_10015495 3300005335 Bacteria 4864
17 Ga0070680_100070053 3300005336 Bacteria 2880
18 Ga0068868_100037895 3300005338 Bacteria 3740
19 Ga0068868_100281853 3300005338 Bacteria 1407
20 Ga0070689_100018027 3300005340 Bacteria 5194
21 Ga0070691_10045933 3300005341 Bacteria 2073
22 Ga0070669_100068310 3300005353 Bacteria 2623
23 Ga0070675_100000815 3300005354 Bacteria 21956
24 Ga0070675_100057540 3300005354 Bacteria 3206
25 Ga0070675_100187531 3300005354 Bacteria 1791
26 Ga0070671_100006184 3300005355 Bacteria 9539
27 Ga0070671_100080554 3300005355 Bacteria 2723
28 Ga0070673_100004579 3300005364 Bacteria 8764
29 Ga0070688_100010320 3300005365 Bacteria 5147
30 Ga0070667_100029822 3300005367 Bacteria 4547
31 Ga0070667_100219299 3300005367 Bacteria 1693
32 Ga0070710_10177799 3300005437 Unclassified 1330
33 Ga0070711_100018428 3300005439 Bacteria 4457
34 Ga0070711_100074073 3300005439 Bacteria 2407
35 Ga0070694_100018647 3300005444 Bacteria 4405
36 Ga0070694_100113719 3300005444 Bacteria 1932
37 Ga0070694_100180031 3300005444 Bacteria 1563
38 Ga0070708_100005777 3300005445 Bacteria 9819
39 Ga0070708_100021826 3300005445 Bacteria 5421
40 Ga0070663_100025508 3300005455 Unclassified 3992
41 Ga0070663_100056280 3300005455 Bacteria 2817
42 Ga0070678_100000154 3300005456 Bacteria 28751
43 Ga0070681_10040119 3300005458 Bacteria 4694
44 Ga0068867_100002451 3300005459 Bacteria 13039
45 Ga0068867_100004397 3300005459 Bacteria 9917
46 Ga0068867_100204743 3300005459 Bacteria 1581
47 Ga0070706_100001589 3300005467 Bacteria 23687
48 Ga0070706_100003296 3300005467 Bacteria 15967
49 Ga0070707_100010617 3300005468 Bacteria 8578
50 Ga0070707_100253472 3300005468 Bacteria 1713
51 Ga0070698_100000318 3300005471 Bacteria 49028
52 Ga0070698_100012262 3300005471 Bacteria 9076
53 Ga0070698_100015682 3300005471 Bacteria 8003
54 Ga0070698_100313393 3300005471 Bacteria 1500
55 Ga0070697_100034035 3300005536 Bacteria 4106
56 Ga0070672_100008043 3300005543 Bacteria 7204
57 Ga0070672_100046915 3300005543 Bacteria 3350
58 Ga0070686_100004034 3300005544 Bacteria 8072
59 Ga0070695_100111903 3300005545 Bacteria 1854
60 Ga0070665_100041952 3300005548 Bacteria 4599
61 Ga0070665_100062096 3300005548 Bacteria 3746
62 Ga0070665_100104271 3300005548 Unclassified 2838
63 Ga0070665_100335366 3300005548 Bacteria 1517
64 Ga0070704_100011353 3300005549 Bacteria 5457
65 Ga0068857_100273557 3300005577 Bacteria 1552
66 Ga0068854_100010997 3300005578 Bacteria 5873
67 Ga0068856_100185230 3300005614 Bacteria 2095
68 Ga0068856_100240010 3300005614 Bacteria 1828
69 Ga0068852_100206785 3300005616 Bacteria 1860
70 Ga0068859_100000631 3300005617 Bacteria 35209
71 Ga0068859_100002404 3300005617 Bacteria 19061
72 Ga0068859_100046727 3300005617 Bacteria 4347
73 Ga0068864_100000672 3300005618 Bacteria 28562
74 Ga0068861_100005602 3300005719 Bacteria 8512
75 Ga0068861_100079632 3300005719 Bacteria 2562
76 Ga0068861_100106171 3300005719 Unclassified 2243
77 Ga0068851_10124504 3300005834 Bacteria 1388
78 Ga0068870_10091469 3300005840 Bacteria 1702
79 Ga0068863_100038655 3300005841 Bacteria 4539
80 Ga0068863_100039940 3300005841 Bacteria 4462
81 Ga0068863_100063310 3300005841 Bacteria 3498
82 Ga0068863_100079046 3300005841 Bacteria 3115
83 Ga0068863_100124912 3300005841 Bacteria 2455
84 Ga0068858_100001003 3300005842 Bacteria 29188
85 Ga0068858_100001563 3300005842 Bacteria 23466
86 Ga0068858_100017497 3300005842 Bacteria 6724
87 Ga0068860_100000823 3300005843 Bacteria 34706
88 Ga0068860_100001971 3300005843 Bacteria 21702
89 Ga0068860_100034860 3300005843 Bacteria 4828
90 Ga0068860_100149822 3300005843 Bacteria 2246
91 Ga0068862_100008650 3300005844 Bacteria 8420
92 Ga0068862_100205458 3300005844 Bacteria 1778
93 Ga0068862_100282969 3300005844 Bacteria 1520
94 Ga0081455_10000162 3300005937 Bacteria 82078
95 Ga0081540_1000684 3300005983 Bacteria 31605
96 Ga0081539_10065764 3300005985 Bacteria 1968
97 Ga0075363_100020180 3300006048 Bacteria 3341
98 Ga0070716_100042948 3300006173 Bacteria 2525
99 Ga0070712_100056874 3300006175 Bacteria 2745
100 Ga0075366_10000230 3300006195 Bacteria 24874
101 Ga0075366_10032172 3300006195 Bacteria 3088
102 Ga0075366_10149433 3300006195 Bacteria 1414
103 Ga0075370_10006621 3300006353 Bacteria 5840
104 Ga0075370_10033977 3300006353 Bacteria 2857
105 Ga0068871_100015192 3300006358 Bacteria 5757
106 Ga0068871_100241114 3300006358 Bacteria 1572
107 Ga0075428_100116163 3300006844 Bacteria 2915
108 Ga0075428_100394561 3300006844 Bacteria 1483
109 Ga0075431_100015013 3300006847 Bacteria 7842
110 Ga0075431_100084769 3300006847 Bacteria 3271
111 Ga0075431_100338135 3300006847 Unclassified 1515
112 Ga0075433_10014567 3300006852 Bacteria 6429
113 Ga0075433_10017647 3300006852 Bacteria 5918
114 Ga0075433_10059440 3300006852 Bacteria 3344
115 Ga0075434_100010533 3300006871 Bacteria 8673
116 Ga0075434_100051407 3300006871 Bacteria 4096
117 Ga0075429_100000194 3300006880 Bacteria 40201
118 Ga0068865_100008602 3300006881 Bacteria 6312
119 Ga0068865_100049329 3300006881 Bacteria 2901
120 Ga0068865_100064214 3300006881 Bacteria 2583
121 Ga0097620_100000631 3300006931 Bacteria 35209
122 Ga0097620_100002404 3300006931 Bacteria 19061
123 Ga0097620_100046730 3300006931 Bacteria 4347
124 Ga0075435_100054838 3300007076 Bacteria 3218
125 Ga0099794_10004254 3300007265 Bacteria 5593
126 Ga0099795_10003036 3300007788 Bacteria 4090
127 Ga0099795_10015664 3300007788 Unclassified 2381
128 Ga0099795_10041916 3300007788 Bacteria 1632
129 Ga0105240_10005279 3300009093 Bacteria 19287
130 Ga0105240_10006857 3300009093 Bacteria 16650
131 Ga0105240_10048763 3300009093 Bacteria 5350
132 Ga0105240_10080064 3300009093 Bacteria 4018
133 Ga0111539_10103640 3300009094 Bacteria 3338
134 Ga0111539_10219514 3300009094 Bacteria 2214
135 Ga0111539_10493597 3300009094 Bacteria 1426
136 Ga0105247_10017172 3300009101 Bacteria 4344
137 Ga0105247_10031586 3300009101 Bacteria 3215
138 Ga0105247_10031817 3300009101 Bacteria 3203
139 Ga0105247_10081903 3300009101 Bacteria 2036
140 Ga0105247_10227013 3300009101 Bacteria 1266
141 Ga0114129_10012265 3300009147 Bacteria 12194
142 Ga0114129_10016215 3300009147 Bacteria 10603
143 Ga0105243_10004576 3300009148 Bacteria 10914
144 Ga0105243_10079560 3300009148 Bacteria 2672
145 Ga0105242_10240742 3300009176 Bacteria 1626
146 Ga0105248_10036352 3300009177 Bacteria 5507
147 Ga0105248_10042159 3300009177 Bacteria 5118
148 Ga0105248_10397850 3300009177 Bacteria 1551
149 Ga0105237_10000784 3300009545 Bacteria 43457
150 Ga0105237_10136661 3300009545 Bacteria 2446
151 Ga0105237_10196305 3300009545 Bacteria 2018
152 Ga0105238_10021093 3300009551 Bacteria 6639
153 Ga0105238_10035848 3300009551 Bacteria 5042
154 Ga0105238_10138115 3300009551 Bacteria 2415
155 Ga0105249_10061626 3300009553 Bacteria 3443
156 Ga0105249_10088620 3300009553 Bacteria 2890
157 Ga0105249_10305015 3300009553 Bacteria 1598
158 Ga0099796_10003762 3300010159 Bacteria 3573
159 Ga0099796_10034606 3300010159 Bacteria 1670
160 Ga0099796_10037056 3300010159 Bacteria 1628
161 Ga0105239_10031589 3300010375 Bacteria 5822
162 Ga0105239_10206602 3300010375 Bacteria 2201
163 Ga0105239_10538443 3300010375 Bacteria 1329
164 Ga0157369_10004416 3300013105 Bacteria 16597
165 Ga0157378_10062460 3300013297 Bacteria 3326
166 Ga0157378_10136603 3300013297 Bacteria 2274
167 Ga0163162_10002252 3300013306 Bacteria 18114
168 Ga0163162_10013972 3300013306 Bacteria 7847
169 Ga0163162_10058654 3300013306 Bacteria 3879
170 Ga0163163_10000998 3300014325 Bacteria 23964
171 Ga0163163_10003887 3300014325 Bacteria 12731
172 Ga0163163_10012180 3300014325 Bacteria 7828
173 Ga0163163_10124898 3300014325 Bacteria 2610
174 Ga0163163_10181150 3300014325 Bacteria 2154
175 Ga0182008_10031370 3300014497 Bacteria 2676
176 Ga0157377_10000014 3300014745 Bacteria 213961
177 Ga0157379_10004202 3300014968 Bacteria 12295
178 Ga0157379_10034644 3300014968 Bacteria 4502
179 Ga0157379_10123512 3300014968 Bacteria 2330
180 Ga0182006_1059093 3300015261 Bacteria 1452
181 Ga0163161_10014666 3300017792 Bacteria 5457
182 Ga0163161_10092245 3300017792 Bacteria 2242
183 Ga0163161_10152545 3300017792 Bacteria 1757
184 Ga0213876_10084768 3300021384 Bacteria 1676
185 Ga0213875_10092730 3300021388 Bacteria 1408
186 Ga0213871_10001126 3300021441 Bacteria 4254
187 Ga0224572_1019568 3300024225 Bacteria 1301
188 Ga0228598_1004831 3300024227 Bacteria 2845
189 Ga0209673_1029631 3300025273 Bacteria 1739
190 Ga0209130_1002013 3300025284 Bacteria 11077
191 Ga0209675_1001066 3300025291 Bacteria 16979
192 Ga0209676_1004627 3300025292 Bacteria 7575
193 Ga0209051_1007446 3300025303 Bacteria 5978
194 Ga0209257_1020862 3300025304 Bacteria 2403
195 Ga0209257_1023594 3300025304 Bacteria 2157
196 Ga0207682_10023191 3300025893 Bacteria 2450
197 Ga0207682_10035484 3300025893 Bacteria 2014
198 Ga0207710_10001038 3300025900 Bacteria 14368
199 Ga0207680_10001176 3300025903 Bacteria 12349
200 Ga0207680_10007239 3300025903 Bacteria 5396
201 Ga0207645_10033535 3300025907 Bacteria 3300
202 Ga0207645_10081810 3300025907 Bacteria 2070
203 Ga0207684_10004536 3300025910 Bacteria 13053
204 Ga0207707_10276711 3300025912 Bacteria 1454
205 Ga0207695_10006338 3300025913 Bacteria 15393
206 Ga0207695_10015682 3300025913 Bacteria 8913
207 Ga0207671_10177165 3300025914 Bacteria 1658
208 Ga0207693_10039111 3300025915 Bacteria 3735
209 Ga0207693_10056352 3300025915 Bacteria 3082
210 Ga0207660_10016656 3300025917 Bacteria 4870
211 Ga0207649_10116763 3300025920 Bacteria 1793
212 Ga0207652_10108099 3300025921 Bacteria 2464
213 Ga0207646_10002200 3300025922 Bacteria 23223
214 Ga0207646_10182270 3300025922 Bacteria 1897
215 Ga0207694_10098623 3300025924 Bacteria 2313
216 Ga0207694_10350254 3300025924 Unclassified 1222
217 Ga0207650_10016898 3300025925 Bacteria 5103
218 Ga0207659_10000929 3300025926 Bacteria 17469
219 Ga0207664_10109116 3300025929 Bacteria 2299
220 Ga0207644_10004256 3300025931 Bacteria 9290
221 Ga0207690_10260020 3300025932 Bacteria 1344
222 Ga0207706_10114559 3300025933 Bacteria 2371
223 Ga0207706_10159708 3300025933 Bacteria 1981
224 Ga0207709_10004122 3300025935 Bacteria 8466
225 Ga0207709_10045659 3300025935 Bacteria 2654
226 Ga0207670_10005768 3300025936 Bacteria 6833
227 Ga0207669_10200366 3300025937 Bacteria 1448
228 Ga0207704_10003333 3300025938 Bacteria 7287
229 Ga0207665_10002514 3300025939 Bacteria 12330
230 Ga0207665_10099292 3300025939 Bacteria 2030
231 Ga0207691_10028023 3300025940 Bacteria 5278
232 Ga0207711_10124253 3300025941 Unclassified 2307
233 Ga0207711_10227603 3300025941 Bacteria 1707
234 Ga0207689_10152905 3300025942 Bacteria 1902
235 Ga0207667_10127772 3300025949 Bacteria 2618
236 Ga0207667_10426126 3300025949 Bacteria 1350
237 Ga0207651_10002121 3300025960 Bacteria 9363
238 Ga0207712_10105263 3300025961 Bacteria 2105
239 Ga0207668_10327412 3300025972 Bacteria 1273
240 Ga0207640_10016315 3300025981 Bacteria 4318
241 Ga0207658_10005299 3300025986 Bacteria 8868
242 Ga0207658_10006349 3300025986 Bacteria 8071
243 Ga0207658_10006397 3300025986 Bacteria 8043
244 Ga0207703_10000281 3300026035 Bacteria 56555
245 Ga0207703_10000668 3300026035 Bacteria 34245
246 Ga0207703_10016275 3300026035 Bacteria 5796
247 Ga0207678_10041366 3300026067 Unclassified 3996
248 Ga0207678_10052714 3300026067 Bacteria 3508
249 Ga0207678_10073048 3300026067 Bacteria 2940
250 Ga0207708_10021407 3300026075 Bacteria 4877
251 Ga0207708_10240436 3300026075 Bacteria 1456
252 Ga0207702_10228873 3300026078 Bacteria 1736
253 Ga0207641_10000373 3300026088 Bacteria 53247
254 Ga0207641_10023485 3300026088 Bacteria 5079
255 Ga0207641_10030959 3300026088 Bacteria 4435
256 Ga0207648_10000062 3300026089 Bacteria 99889
257 Ga0207648_10016948 3300026089 Bacteria 6638
258 Ga0207648_10100875 3300026089 Bacteria 2529
259 Ga0207676_10000460 3300026095 Bacteria 34103
260 Ga0207675_100005391 3300026118 Bacteria 12258
261 Ga0207675_100129114 3300026118 Bacteria 2396
262 Ga0207675_100153414 3300026118 Bacteria 2194
263 Ga0207675_100181600 3300026118 Bacteria 2015
264 Ga0207675_100292479 3300026118 Bacteria 1585
265 Ga0207683_10017410 3300026121 Bacteria 6125
266 Ga0207683_10091876 3300026121 Bacteria 2704
267 Ga0207698_10096561 3300026142 Bacteria 2436
268 Ga0209974_10002848 3300027876 Bacteria 6273
269 Ga0207428_10055770 3300027907 Bacteria 3140
270 Ga0268266_10047248 3300028379 Bacteria 3687
271 Ga0268266_10161066 3300028379 Bacteria 2030
272 Ga0268266_10279016 3300028379 Bacteria 1553
273 Ga0268266_10378351 3300028379 Bacteria 1335
274 Ga0268265_10005592 3300028380 Bacteria 8582
275 Ga0268265_10021172 3300028380 Bacteria 4550
276 Ga0268264_10000044 3300028381 Bacteria 368079
277 Ga0268264_10000613 3300028381 Bacteria 42687
278 Ga0268264_10028153 3300028381 Bacteria 4595
279 Ga0268264_10062308 3300028381 Unclassified 3131
280 Ga0307517_10000173 3300028786 Bacteria 105751
281 Ga0307517_10114317 3300028786 Bacteria 2032
282 Ga0307517_10151940 3300028786 Bacteria 1585
283 Ga0307515_10000011 3300028794 Bacteria 633903
284 Ga0307515_10000861 3300028794 Bacteria 69808
285 Ga0265338_10007060 3300028800 Bacteria 14083
286 Ga0265332_10000035 3300031238 Bacteria 139554
287 Ga0265327_10004412 3300031251 Bacteria 12477
288 Ga0265327_10010338 3300031251 Bacteria 6578
289 Ga0307509_10000004 3300031507 Bacteria 535507
290 Ga0307509_10005866 3300031507 Bacteria 16842
291 Ga0307408_100012333 3300031548 Bacteria 5660
292 Ga0307408_100033107 3300031548 Bacteria 3608
293 Ga0307516_10073347 3300031730 Bacteria 3280
294 Ga0307405_10157114 3300031731 Bacteria 1606
295 Ga0307410_10010373 3300031852 Bacteria 5273
296 Ga0307412_10006215 3300031911 Bacteria 6737
297 Ga0307409_100185196 3300031995 Bacteria 1847
298 Ga0307416_100184663 3300032002 Bacteria 1958
299 Ga0307414_10145171 3300032004 Bacteria 1863
300 Ga0373953_0031928 3300035117 Bacteria 2051
301 Ga0373960_0004546 3300035121 Unclassified 3186
302 Ga0373955_0142423 3300035172 Bacteria 1407
303 Ga0373931_0000481 3300035691 Bacteria 16271
304 Ga0373931_0014488 3300035691 Bacteria 3855
305 Ga0373927_0014677 3300035695 Bacteria 5180
306 Ga0373925_0004069 3300037068 Bacteria 11107
307 Ga0373925_0011709 3300037068 Bacteria 6343
308 Ga0395900_0130945 3300037418 Bacteria 2571
309 Ga0395900_0239963 3300037418 Bacteria 1819
310 Ga0395905_0008466 3300037471 Bacteria 10142
311 Ga0436364_0717801 3300037853 Bacteria 2526
312 Ga0436364_1260410 3300037853 Bacteria 3037
313 Ga0395901_0294910 3300038443 Bacteria 1682
314 Ga0237819_00287 3300038705 Bacteria 18599
315 Ga0436360_0026574 3300039438 Unclassified 1211
316 Ga0436360_1311663 3300039438 Bacteria 24668
317 Ga0436363_0208762 3300039450 Bacteria 1712
318 Ga0436362_0841539 3300039453 Bacteria 1040
319 Ga0439466_0016866 3300041411 Bacteria 2635
320 Ga0439441_000663 3300042001 Bacteria 3944
321 Ga0450911_000053 3300042115 Bacteria 47364
322 Ga0450919_001033 3300042121 Bacteria 3599
323 Ga0450923_006173 3300042125 Bacteria 1973
324 Ga0439464_0002912 3300042439 Bacteria 4262
325 Ga0450918_000003 3300042531 Bacteria 58967
326 Ga0466966_0006078 3300044684 Bacteria 7975
327 Ga0453684_0041544 3300044712 Bacteria 6217
328 Ga0451576_0027918 3300045051 Bacteria 6054
329 Ga0466958_0059518 3300045836 Bacteria 2324
330 Ga0495651_0077795 3300046462 Bacteria 2510
331 Ga0495639_0016327 3300046475 Bacteria 3222
332 Ga0495662_0009879 3300046476 Bacteria 4687
333 Ga0495664_0000038 3300046477 Bacteria 69074
334 Ga0495664_0000918 3300046477 Bacteria 15166
335 Ga0495608_0167568 3300046511 Bacteria 1394
336 Ga0495620_0028489 3300046515 Bacteria 2597
337 Ga0495642_0035266 3300046528 Bacteria 2018
338 Ga0495652_0039362 3300046529 Bacteria 4088
339 Ga0495652_0079259 3300046529 Bacteria 2716
340 Ga0495654_0007956 3300046530 Bacteria 5888
341 Ga0495640_0010973 3300046533 Bacteria 6980
342 Ga0495586_0020856 3300046535 Bacteria 3491
343 Ga0495586_0090181 3300046535 Bacteria 1693
344 Ga0495587_0040563 3300046536 Bacteria 2782
345 Ga0495597_0018798 3300046542 Bacteria 3239
346 Ga0495645_0003802 3300046543 Bacteria 10263
347 Ga0495645_0015548 3300046543 Bacteria 5413
348 Ga0495645_0120003 3300046543 Bacteria 1852
349 Ga0495656_0000645 3300046615 Bacteria 11174
350 Ga0495668_0084162 3300046616 Bacteria 1744
351 Ga0495634_0038587 3300046642 Bacteria 3256
352 Ga0495625_0332873 3300046660 Unclassified 964
353 Ga0495635_0010096 3300046663 Bacteria 6602
354 Ga0495661_0006334 3300046665 Bacteria 8322
355 Ga0495588_0026689 3300046674 Bacteria 2885
356 Ga0495599_0121652 3300046678 Bacteria 1622
357 Ga0495646_0040955 3300046680 Bacteria 2849
358 Ga0495647_0010629 3300046681 Bacteria 3138
359 Ga0495613_0085111 3300046689 Bacteria 2295
360 Ga0495670_0040772 3300046691 Bacteria 2316
361 Ga0495600_0027323 3300046809 Bacteria 3687
362 Ga0495604_0003505 3300047317 Bacteria 12504
363 Ga0495687_009231 3300047443 Bacteria 5541
364 Ga0495687_076157 3300047443 Unclassified 1329
365 Ga0495675_0019202 3300047444 Bacteria 4342
366 Ga0495675_0082069 3300047444 Bacteria 2030
367 Ga0495686_0001552 3300047472 Bacteria 24520
368 Ga0495615_0013267 3300048090 Bacteria 1718
369 Ga0496100_0095775 3300048903 Bacteria 2035
370 Ga0496101_0009622 3300048904 Bacteria 6359
371 Ga0496101_0243430 3300048904 Bacteria 1400
372 Ga0496102_0000019 3300048905 Bacteria 264583
373 Ga0496102_0060007 3300048905 Bacteria 3479
374 Ga0496102_0120511 3300048905 Bacteria 2450
375 Ga0496102_0130667 3300048905 Bacteria 2350
376 Ga0496102_0217888 3300048905 Bacteria 1799
377 Ga0496103_0000059 3300048906 Bacteria 139196
378 Ga0496103_0006024 3300048906 Bacteria 7247
379 Ga0496104_0000033 3300048907 Bacteria 189758
380 Ga0496104_0005540 3300048907 Bacteria 11059
381 Ga0496104_0028158 3300048907 Bacteria 5207
382 Ga0496105_0006878 3300048908 Bacteria 8755
383 Ga0496105_0096685 3300048908 Bacteria 2439
384 Ga0496105_0198231 3300048908 Bacteria 1639
385 Ga0496106_0009992 3300048909 Bacteria 7008
386 Ga0496106_0015787 3300048909 Bacteria 5585
387 Ga0496107_0118137 3300048910 Bacteria 1953
388 Ga0496108_0020000 3300048911 Bacteria 5501
389 Ga0496108_0029705 3300048911 Bacteria 4529
390 Ga0496108_0127342 3300048911 Bacteria 2187
391 Ga0496109_0041128 3300048912 Bacteria 4188
392 Ga0496109_0076093 3300048912 Bacteria 3087
393 Ga0496110_0008577 3300048913 Bacteria 8230
394 Ga0496110_0040138 3300048913 Bacteria 4079
395 Ga0496111_0003349 3300048914 Bacteria 9911
396 Ga0496111_0106602 3300048914 Bacteria 2063
397 Ga0496112_0300277 3300048915 Bacteria 1551
398 Ga0496113_0281270 3300048916 Bacteria 1330
399 Ga0496115_0077892 3300048918 Bacteria 2696
400 Ga0496121_0000970 3300048924 Bacteria 51488
401 Ga0496124_0080064 3300048927 Bacteria 2689
402 Ga0496125_0000312 3300048928 Bacteria 95519
403 Ga0496125_0029542 3300048928 Bacteria 4924
404 Ga0496125_0079047 3300048928 Bacteria 2525
405 Ga0496125_0146063 3300048928 Bacteria 1634
406 Ga0501298_017447 3300049521 Bacteria 1310
407 Ga0501034_0390650 3300049571 Bacteria 1315
408 Ga0501043_0000075 3300049579 Bacteria 86156
409 Ga0501046_0000195 3300049580 Bacteria 62300
410 Ga0501046_0001329 3300049580 Bacteria 23959
411 Ga0501047_0000145 3300049581 Bacteria 86319
412 Ga0501048_0000839 3300049582 Bacteria 22628
413 Ga0501048_0001016 3300049582 Bacteria 20962
414 Ga0501252_002853 3300049682 Bacteria 1746
415 Ga0501257_000013 3300049686 Bacteria 50789
416 Ga0501045_0002788 3300049824 Bacteria 11945
417 Ga0501045_0010119 3300049824 Bacteria 6599
418 nmdc:mga0k408_2366_c1 3300050493 Bacteria 10027
419 nmdc:mga0k408_267_c1 3300050493 Bacteria 28555
420 nmdc:mga07m45_2631_c1 3300050496 Bacteria 8451
421 nmdc:mga07m45_54134_c1 3300050496 Bacteria 2268
422 nmdc:mga05p37_22366_c1 3300050507 Bacteria 7670
423 nmdc:mga05p37_58370_c1 3300050507 Bacteria 4753
424 nmdc:mga05p37_7110_c1 3300050507 Bacteria 13192
425 nmdc:mga09592_1081_c1 3300050508 Bacteria 21649
426 nmdc:mga09592_11884_c1 3300050508 Bacteria 7083
427 nmdc:mga09592_397881_c1 3300050508 Bacteria 1191
428 nmdc:mga0qj67_41449_c1 3300050509 Bacteria 3622
429 nmdc:mga06r32_38442_c1 3300050510 Bacteria 4534
430 nmdc:mga06r32_53910_c1 3300050510 Bacteria 3855
431 nmdc:mga06r32_69308_c1 3300050510 Bacteria 3408
432 nmdc:mga06r32_72861_c1 3300050510 Bacteria 3326
433 nmdc:mga06r32_9532_c1 3300050510 Bacteria 8767
434 nmdc:mga08y16_105278_c1 3300050511 Bacteria 2937
435 nmdc:mga08y16_168218_c1 3300050511 Bacteria 2278
436 nmdc:mga08y16_310006_c1 3300050511 Bacteria 1625
437 nmdc:mga08y16_643997_c1 3300050511 Bacteria 1065
438 nmdc:mga0n895_47928_c1 3300050512 Bacteria 4180
439 nmdc:mga0n895_56809_c1 3300050512 Bacteria 3857
440 nmdc:mga0rr50_52560_c1 3300050513 Bacteria 3028
441 nmdc:mga08x19_98224_c1 3300050514 Bacteria 1939
442 nmdc:mga0a205_159174_c1 3300050515 Bacteria 2155
443 nmdc:mga0a205_168970_c1 3300050515 Bacteria 2082
444 nmdc:mga0a205_246512_c1 3300050515 Bacteria 1667
445 nmdc:mga0a205_46248_c1 3300050515 Bacteria 4197
446 Ga0495601_0006656 3300053077 Bacteria 6763
447 Ga0495595_0109777 3300053084 Bacteria 1336
448 Ga0500590_001170 3300053148 Bacteria 10379
449 2644027656 2643221603 Bacteria 6147767
450 2644243248 2643221644 Bacteria 6865017
451 2739250976 2738543013 Bacteria 5618633
452 2928120477 2928115317 Bacteria 6477646
453 Ga0157379_10016717
454 JGI25153J46596_10022725
455 Ga0006777J48905_1074619
456 rootH1_10075912
457 rootH1_10026350
458 Ga0065715_10111173
459 Ga0065707_10085596
460 Ga0070658_10087224
461 Ga0070676_10037404
462 Ga0070676_10174804
463 Ga0070690_100004787
464 Ga0070670_100082725
465 Ga0070677_10041536
466 Ga0068869_100150988
467 Ga0070666_10007288
468 Ga0070666_10015495
469 Ga0070680_100070053
470 Ga0068868_100037895
471 Ga0068868_100281853
472 Ga0070689_100018027
473 Ga0070691_10045933
474 Ga0070669_100068310
475 Ga0070675_100000815
476 Ga0070675_100057540
477 Ga0070675_100187531
478 Ga0070671_100006184
479 Ga0070671_100080554
480 Ga0070673_100004579
481 Ga0070688_100010320
482 Ga0070667_100029822
483 Ga0070667_100219299
484 Ga0070710_10177799
485 Ga0070711_100018428
486 Ga0070711_100074073
487 Ga0070694_100018647
488 Ga0070694_100113719
489 Ga0070694_100180031
490 Ga0070708_100005777
491 Ga0070708_100021826
492 Ga0070663_100025508
493 Ga0070663_100056280
494 Ga0070678_100000154
495 Ga0070681_10040119
496 Ga0068867_100002451
497 Ga0068867_100004397
498 Ga0068867_100204743
499 Ga0070706_100001589
500 Ga0070706_100003296
501 Ga0070707_100010617
502 Ga0070707_100253472
503 Ga0070698_100000318
504 Ga0070698_100012262
505 Ga0070698_100015682
506 Ga0070698_100313393
507 Ga0070697_100034035
508 Ga0070672_100008043
509 Ga0070672_100046915
510 Ga0070686_100004034
511 Ga0070695_100111903
512 Ga0070665_100041952
513 Ga0070665_100062096
514 Ga0070665_100104271
515 Ga0070665_100335366
516 Ga0070704_100011353
517 Ga0068857_100273557
518 Ga0068854_100010997
519 Ga0068856_100185230
520 Ga0068856_100240010
521 Ga0068852_100206785
522 Ga0068859_100000631
523 Ga0068859_100002404
524 Ga0068859_100046727
525 Ga0068864_100000672
526 Ga0068861_100005602
527 Ga0068861_100079632
528 Ga0068861_100106171
529 Ga0068851_10124504
530 Ga0068870_10091469
531 Ga0068863_100038655
532 Ga0068863_100039940
533 Ga0068863_100063310
534 Ga0068863_100079046
535 Ga0068863_100124912
536 Ga0068858_100001003
537 Ga0068858_100001563
538 Ga0068858_100017497
539 Ga0068860_100000823
540 Ga0068860_100001971
541 Ga0068860_100034860
542 Ga0068860_100149822
543 Ga0068862_100008650
544 Ga0068862_100205458
545 Ga0068862_100282969
546 Ga0081455_10000162
547 Ga0081540_1000684
548 Ga0081539_10065764
549 Ga0075363_100020180
550 Ga0070716_100042948
551 Ga0070712_100056874
552 Ga0075366_10000230
553 Ga0075366_10032172
554 Ga0075366_10149433
555 Ga0075370_10006621
556 Ga0075370_10033977
557 Ga0068871_100015192
558 Ga0068871_100241114
559 Ga0075428_100116163
560 Ga0075428_100394561
561 Ga0075431_100015013
562 Ga0075431_100084769
563 Ga0075431_100338135
564 Ga0075433_10014567
565 Ga0075433_10017647
566 Ga0075433_10059440
567 Ga0075434_100010533
568 Ga0075434_100051407
569 Ga0075429_100000194
570 Ga0068865_100008602
571 Ga0068865_100049329
572 Ga0068865_100064214
573 Ga0097620_100000631
574 Ga0097620_100002404
575 Ga0097620_100046730
576 Ga0075435_100054838
577 Ga0099794_10004254
578 Ga0099795_10003036
579 Ga0099795_10015664
580 Ga0099795_10041916
581 Ga0105240_10005279
582 Ga0105240_10006857
583 Ga0105240_10048763
584 Ga0105240_10080064
585 Ga0111539_10103640
586 Ga0111539_10219514
587 Ga0111539_10493597
588 Ga0105247_10017172
589 Ga0105247_10031586
590 Ga0105247_10031817
591 Ga0105247_10081903
592 Ga0105247_10227013
593 Ga0114129_10012265
594 Ga0114129_10016215
595 Ga0105243_10004576
596 Ga0105243_10079560
597 Ga0105242_10240742
598 Ga0105248_10036352
599 Ga0105248_10042159
600 Ga0105248_10397850
601 Ga0105237_10000784
602 Ga0105237_10136661
603 Ga0105237_10196305
604 Ga0105238_10021093
605 Ga0105238_10035848
606 Ga0105238_10138115
607 Ga0105249_10061626
608 Ga0105249_10088620
609 Ga0105249_10305015
610 Ga0099796_10003762
611 Ga0099796_10034606
612 Ga0099796_10037056
613 Ga0105239_10031589
614 Ga0105239_10206602
615 Ga0105239_10538443
616 Ga0157369_10004416
617 Ga0157378_10062460
618 Ga0157378_10136603
619 Ga0163162_10002252
620 Ga0163162_10013972
621 Ga0163162_10058654
622 Ga0163163_10000998
623 Ga0163163_10003887
624 Ga0163163_10012180
625 Ga0163163_10124898
626 Ga0163163_10181150
627 Ga0182008_10031370
628 Ga0157377_10000014
629 Ga0157379_10004202
630 Ga0157379_10034644
631 Ga0157379_10123512
632 Ga0182006_1059093
633 Ga0163161_10014666
634 Ga0163161_10092245
635 Ga0163161_10152545
636 Ga0213876_10084768
637 Ga0213875_10092730
638 Ga0213871_10001126
639 Ga0224572_1019568
640 Ga0228598_1004831
641 Ga0209673_1029631
642 Ga0209130_1002013
643 Ga0209675_1001066
644 Ga0209676_1004627
645 Ga0209051_1007446
646 Ga0209257_1020862
647 Ga0209257_1023594
648 Ga0207682_10023191
649 Ga0207682_10035484
650 Ga0207710_10001038
651 Ga0207680_10001176
652 Ga0207680_10007239
653 Ga0207645_10033535
654 Ga0207645_10081810
655 Ga0207684_10004536
656 Ga0207707_10276711
657 Ga0207695_10006338
658 Ga0207695_10015682
659 Ga0207671_10177165
660 Ga0207693_10039111
661 Ga0207693_10056352
662 Ga0207660_10016656
663 Ga0207649_10116763
664 Ga0207652_10108099
665 Ga0207646_10002200
666 Ga0207646_10182270
667 Ga0207694_10098623
668 Ga0207694_10350254
669 Ga0207650_10016898
670 Ga0207659_10000929
671 Ga0207664_10109116
672 Ga0207644_10004256
673 Ga0207690_10260020
674 Ga0207706_10114559
675 Ga0207706_10159708
676 Ga0207709_10004122
677 Ga0207709_10045659
678 Ga0207670_10005768
679 Ga0207669_10200366
680 Ga0207704_10003333
681 Ga0207665_10002514
682 Ga0207665_10099292
683 Ga0207691_10028023
684 Ga0207711_10124253
685 Ga0207711_10227603
686 Ga0207689_10152905
687 Ga0207667_10127772
688 Ga0207667_10426126
689 Ga0207651_10002121
690 Ga0207712_10105263
691 Ga0207668_10327412
692 Ga0207640_10016315
693 Ga0207658_10005299
694 Ga0207658_10006349
695 Ga0207658_10006397
696 Ga0207703_10000281
697 Ga0207703_10000668
698 Ga0207703_10016275
699 Ga0207678_10041366
700 Ga0207678_10052714
701 Ga0207678_10073048
702 Ga0207708_10021407
703 Ga0207708_10240436
704 Ga0207702_10228873
705 Ga0207641_10000373
706 Ga0207641_10023485
707 Ga0207641_10030959
708 Ga0207648_10000062
709 Ga0207648_10016948
710 Ga0207648_10100875
711 Ga0207676_10000460
712 Ga0207675_100005391
713 Ga0207675_100129114
714 Ga0207675_100153414
715 Ga0207675_100181600
716 Ga0207675_100292479
717 Ga0207683_10017410
718 Ga0207683_10091876
719 Ga0207698_10096561
720 Ga0209974_10002848
721 Ga0207428_10055770
722 Ga0268266_10047248
723 Ga0268266_10161066
724 Ga0268266_10279016
725 Ga0268266_10378351
726 Ga0268265_10005592
727 Ga0268265_10021172
728 Ga0268264_10000044
729 Ga0268264_10000613
730 Ga0268264_10028153
731 Ga0268264_10062308
732 Ga0307517_10000173
733 Ga0307517_10114317
734 Ga0307517_10151940
735 Ga0307515_10000011
736 Ga0307515_10000861
737 Ga0265338_10007060
738 Ga0265332_10000035
739 Ga0265327_10004412
740 Ga0265327_10010338
741 Ga0307509_10000004
742 Ga0307509_10005866
743 Ga0307408_100012333
744 Ga0307408_100033107
745 Ga0307516_10073347
746 Ga0307405_10157114
747 Ga0307410_10010373
748 Ga0307412_10006215
749 Ga0307409_100185196
750 Ga0307416_100184663
751 Ga0307414_10145171
752 Ga0373953_0031928
753 Ga0373960_0004546
754 Ga0373955_0142423
755 Ga0373931_0000481
756 Ga0373931_0014488
757 Ga0373927_0014677
758 Ga0373925_0004069
759 Ga0373925_0011709
760 Ga0395900_0130945
761 Ga0395900_0239963
762 Ga0395905_0008466
763 Ga0436364_0717801
764 Ga0436364_1260410
765 Ga0395901_0294910
766 Ga0237819_00287
767 Ga0436360_0026574
768 Ga0436360_1311663
769 Ga0436363_0208762
770 Ga0436362_0841539
771 Ga0439466_0016866
772 Ga0439441_000663
773 Ga0450911_000053
774 Ga0450919_001033
775 Ga0450923_006173
776 Ga0439464_0002912
777 Ga0450918_000003
778 Ga0466966_0006078
779 Ga0453684_0041544
780 Ga0451576_0027918
781 Ga0466958_0059518
782 Ga0495651_0077795
783 Ga0495639_0016327
784 Ga0495662_0009879
785 Ga0495664_0000038
786 Ga0495664_0000918
787 Ga0495608_0167568
788 Ga0495620_0028489
789 Ga0495642_0035266
790 Ga0495652_0039362
791 Ga0495652_0079259
792 Ga0495654_0007956
793 Ga0495640_0010973
794 Ga0495586_0020856
795 Ga0495586_0090181
796 Ga0495587_0040563
797 Ga0495597_0018798
798 Ga0495645_0003802
799 Ga0495645_0015548
800 Ga0495645_0120003
801 Ga0495656_0000645
802 Ga0495668_0084162
803 Ga0495634_0038587
804 Ga0495625_0332873
805 Ga0495635_0010096
806 Ga0495661_0006334
807 Ga0495588_0026689
808 Ga0495599_0121652
809 Ga0495646_0040955
810 Ga0495647_0010629
811 Ga0495613_0085111
812 Ga0495670_0040772
813 Ga0495600_0027323
814 Ga0495604_0003505
815 Ga0495687_009231
816 Ga0495687_076157
817 Ga0495675_0019202
818 Ga0495675_0082069
819 Ga0495686_0001552
820 Ga0495615_0013267
821 Ga0496100_0095775
822 Ga0496101_0009622
823 Ga0496101_0243430
824 Ga0496102_0000019
825 Ga0496102_0060007
826 Ga0496102_0120511
827 Ga0496102_0130667
828 Ga0496102_0217888
829 Ga0496103_0000059
830 Ga0496103_0006024
831 Ga0496104_0000033
832 Ga0496104_0005540
833 Ga0496104_0028158
834 Ga0496105_0006878
835 Ga0496105_0096685
836 Ga0496105_0198231
837 Ga0496106_0009992
838 Ga0496106_0015787
839 Ga0496107_0118137
840 Ga0496108_0020000
841 Ga0496108_0029705
842 Ga0496108_0127342
843 Ga0496109_0041128
844 Ga0496109_0076093
845 Ga0496110_0008577
846 Ga0496110_0040138
847 Ga0496111_0003349
848 Ga0496111_0106602
849 Ga0496112_0300277
850 Ga0496113_0281270
851 Ga0496115_0077892
852 Ga0496121_0000970
853 Ga0496124_0080064
854 Ga0496125_0000312
855 Ga0496125_0029542
856 Ga0496125_0079047
857 Ga0496125_0146063
858 Ga0501298_017447
859 Ga0501034_0390650
860 Ga0501043_0000075
861 Ga0501046_0000195
862 Ga0501046_0001329
863 Ga0501047_0000145
864 Ga0501048_0000839
865 Ga0501048_0001016
866 Ga0501252_002853
867 Ga0501257_000013
868 Ga0501045_0002788
869 Ga0501045_0010119
870 nmdc:mga0k408_2366_c1
871 nmdc:mga0k408_267_c1
872 nmdc:mga07m45_2631_c1
873 nmdc:mga07m45_54134_c1
874 nmdc:mga05p37_22366_c1
875 nmdc:mga05p37_58370_c1
876 nmdc:mga05p37_7110_c1
877 nmdc:mga09592_1081_c1
878 nmdc:mga09592_11884_c1
879 nmdc:mga09592_397881_c1
880 nmdc:mga0qj67_41449_c1
881 nmdc:mga06r32_38442_c1
882 nmdc:mga06r32_53910_c1
883 nmdc:mga06r32_69308_c1
884 nmdc:mga06r32_72861_c1
885 nmdc:mga06r32_9532_c1
886 nmdc:mga08y16_105278_c1
887 nmdc:mga08y16_168218_c1
888 nmdc:mga08y16_310006_c1
889 nmdc:mga08y16_643997_c1
890 nmdc:mga0n895_47928_c1
891 nmdc:mga0n895_56809_c1
892 nmdc:mga0rr50_52560_c1
893 nmdc:mga08x19_98224_c1
894 nmdc:mga0a205_159174_c1
895 nmdc:mga0a205_168970_c1
896 nmdc:mga0a205_246512_c1
897 nmdc:mga0a205_46248_c1
898 Ga0495601_0006656
899 Ga0495595_0109777
900 Ga0500590_001170
901 2644027656
902 2644243248
903 2739250976
904 2928120477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

73

179

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

229

373

0.87

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

262

412

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9666 114 334
4b7x-assembly5.cif.gz_J crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9655 6 338
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9624 3 338
4b7x-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9608 5 338
6eow-assembly2.cif.gz_C structure of raspberry ketone synthase with hydroxybenzalacetone 0.9608 4 338
ID Description Score Start End Superfamily
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9694 9 238 3.40.50.2300
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9672 5 128 3.90.180.10
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9652 9 238 3.40.50.2300
af_Q2G2D7_8_231_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9597 11 238 3.90.180.10
af_K7LAX2_10_225_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9584 117 338 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A6N0ZHK2-F1-model_v4 NADP-dependent oxidoreductase 0.9829 173 339 GO:0016628
AF-A0A2E9Y0W9-F1-model_v4 NADP-dependent oxidoreductase 0.9765 1 339 GO:0016628
AF-A0A2D7F5W5-F1-model_v4 NADP-dependent oxidoreductase 0.9757 3 339 GO:0016628
AF-A0A3D2GQ20-F1-model_v4 NADP-dependent oxidoreductase 0.9755 40 339 GO:0016628
AF-A0A2P5KA35-F1-model_v4 Zinc-binding dehydrogenase 0.9751 170 339 GO:0016628

Map