F447021

General Info

Members Datasets Scaffolds Average Seq Length
452 253 904 217

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0348397|Ga0373937_0348397_530_1249
Length 239
Sequence MSDHLSKKGVWIMALRLGDTAPDFTAETTEGPINFHEWLGDSWGILFSHPKDFTPVCTTELGYVAGMKPEFDNRNVKVIGLSVDPVDNHARWASDIKDATGHAPNYPMIGDTDLKVAKLYDMLPASTSGTSEGRTAADNLTVRNVFVIGPDKKIKLMIVYPMATGRNFHEILRVIDSIQLTANYSVATPANWNDGDDVIIVPALNDEAAREKFPDGWKTVKPYLRIVPQPNKQTKAEGA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
104 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.66
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 0.88
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0348397 3300036401 Bacteria 1403
2 JGI24034J14986_100326 3300001432 Bacteria 2675
3 JGI24740J21852_10037898 3300001979 Unclassified 1484
4 JGI24748J21848_1000035 3300002074 Bacteria 73922
5 JGI24034J26672_10000039 3300002239 Bacteria 73907
6 Ga0006759J45824_1032755 3300003163 Bacteria 778
7 rootH1_10047457 3300003323 Bacteria 4433
8 JGI26129J50193_1002624 3300003349 Bacteria 1262
9 Ga0058859_10000079 3300004798 Bacteria 1424
10 Ga0058862_12796641 3300004803 Unclassified 668
11 Ga0065714_10192988 3300005288 Bacteria 921
12 Ga0065714_10206617 3300005288 Bacteria 879
13 Ga0065712_10001725 3300005290 Bacteria 5366
14 Ga0065712_10044009 3300005290 Bacteria 815
15 Ga0065707_10037936 3300005295 Bacteria 964
16 Ga0070676_10114178 3300005328 Bacteria 1686
17 Ga0070683_100402211 3300005329 Bacteria 1306
18 Ga0070690_100024438 3300005330 Bacteria 3714
19 Ga0070690_100088022 3300005330 Bacteria 2041
20 Ga0070690_100220767 3300005330 Bacteria 1328
21 Ga0070670_100054848 3300005331 Bacteria 3422
22 Ga0070670_100149092 3300005331 Bacteria 2024
23 Ga0070677_10011310 3300005333 Bacteria 3074
24 Ga0068869_100075322 3300005334 Bacteria 2507
25 Ga0068869_100129462 3300005334 Bacteria 1938
26 Ga0070666_10088929 3300005335 Bacteria 2119
27 Ga0070680_100009389 3300005336 Bacteria 7514
28 Ga0070680_100048737 3300005336 Bacteria 3453
29 Ga0070680_100074030 3300005336 Bacteria 2802
30 Ga0068868_100021761 3300005338 Bacteria 4832
31 Ga0068868_100064457 3300005338 Bacteria 2908
32 Ga0070660_100179152 3300005339 Bacteria 1715
33 Ga0070660_100383310 3300005339 Bacteria 1161
34 Ga0070687_100087668 3300005343 Bacteria 1714
35 Ga0070661_100158508 3300005344 Bacteria 1713
36 Ga0070671_100029957 3300005355 Bacteria 4490
37 Ga0070671_100388041 3300005355 Bacteria 1194
38 Ga0070674_100300272 3300005356 Bacteria 1280
39 Ga0070674_100662853 3300005356 Bacteria 888
40 Ga0070673_100051773 3300005364 Bacteria 3218
41 Ga0070673_100280272 3300005364 Bacteria 1462
42 Ga0070673_100794957 3300005364 Bacteria 873
43 Ga0070659_100349865 3300005366 Bacteria 1239
44 Ga0070667_100049006 3300005367 Bacteria 3557
45 Ga0070705_100451453 3300005440 Bacteria 964
46 Ga0070694_100000075 3300005444 Bacteria 47763
47 Ga0070694_100007837 3300005444 Bacteria 6519
48 Ga0070694_100014630 3300005444 Bacteria 4914
49 Ga0070694_100039677 3300005444 Bacteria 3136
50 Ga0070678_100026498 3300005456 Bacteria 3921
51 Ga0070662_100033287 3300005457 Bacteria 3627
52 Ga0068867_100153432 3300005459 Bacteria 1811
53 Ga0070685_10036793 3300005466 Bacteria 2768
54 Ga0070706_100005622 3300005467 Bacteria 11930
55 Ga0070706_100762223 3300005467 Bacteria 896
56 Ga0070706_100812036 3300005467 Bacteria 866
57 Ga0070707_100027380 3300005468 Bacteria 5424
58 Ga0070707_100052862 3300005468 Bacteria 3895
59 Ga0070698_100775214 3300005471 Bacteria 902
60 Ga0070699_100003813 3300005518 Bacteria 13321
61 Ga0070699_100035652 3300005518 Bacteria 4300
62 Ga0070699_100174328 3300005518 Bacteria 1906
63 Ga0070699_100632225 3300005518 Bacteria 977
64 Ga0070679_100046970 3300005530 Bacteria 4304
65 Ga0070684_100243878 3300005535 Bacteria 1642
66 Ga0070697_100013250 3300005536 Bacteria 6465
67 Ga0070697_100021221 3300005536 Bacteria 5145
68 Ga0070697_100326875 3300005536 Bacteria 1321
69 Ga0068853_100169618 3300005539 Bacteria 1974
70 Ga0068853_100297563 3300005539 Unclassified 1491
71 Ga0068853_100403125 3300005539 Bacteria 1280
72 Ga0070686_100010312 3300005544 Bacteria 5264
73 Ga0070695_100000723 3300005545 Bacteria 17621
74 Ga0070695_100007894 3300005545 Bacteria 6300
75 Ga0070695_100011995 3300005545 Bacteria 5190
76 Ga0070695_100504094 3300005545 Bacteria 937
77 Ga0070696_100014990 3300005546 Bacteria 5204
78 Ga0070696_100430858 3300005546 Bacteria 1037
79 Ga0070693_100082665 3300005547 Bacteria 1918
80 Ga0070693_100156792 3300005547 Bacteria 1446
81 Ga0070665_100475949 3300005548 Bacteria 1260
82 Ga0070704_100000972 3300005549 Bacteria 14558
83 Ga0070704_100208583 3300005549 Bacteria 1582
84 Ga0068855_100021872 3300005563 Bacteria 7667
85 Ga0070664_100021165 3300005564 Bacteria 5357
86 Ga0070664_100356155 3300005564 Bacteria 1332
87 Ga0068857_100076801 3300005577 Bacteria 2979
88 Ga0068857_100084171 3300005577 Bacteria 2842
89 Ga0068857_100665172 3300005577 Bacteria 988
90 Ga0070702_100849648 3300005615 Bacteria 710
91 Ga0068852_100405924 3300005616 Bacteria 1341
92 Ga0068859_100270615 3300005617 Bacteria 1791
93 Ga0068859_100896333 3300005617 Bacteria 972
94 Ga0068864_100556047 3300005618 Bacteria 1110
95 Ga0068866_10008102 3300005718 Bacteria 4416
96 Ga0068866_10112566 3300005718 Bacteria 1521
97 Ga0068861_100027459 3300005719 Bacteria 4145
98 Ga0068861_101185469 3300005719 Eukaryota 738
99 Ga0068863_100023715 3300005841 Bacteria 5855
100 Ga0068858_100000053 3300005842 Bacteria 119869
101 Ga0068860_100007163 3300005843 Bacteria 11157
102 Ga0068860_100040226 3300005843 Bacteria 4470
103 Ga0068862_101043797 3300005844 Bacteria 810
104 Ga0081455_10000749 3300005937 Bacteria 42221
105 Ga0081539_10082356 3300005985 Bacteria 1687
106 Ga0081539_10178395 3300005985 Bacteria 998
107 Ga0075368_10012109 3300006042 Bacteria 3150
108 Ga0075363_100153151 3300006048 Bacteria 1302
109 Ga0075366_10029235 3300006195 Bacteria 3237
110 Ga0075366_10438119 3300006195 Bacteria 806
111 Ga0075370_10025873 3300006353 Bacteria 3248
112 Ga0068871_100059391 3300006358 Bacteria 3115
113 Ga0068871_100140535 3300006358 Bacteria 2053
114 Ga0075428_100000407 3300006844 Bacteria 42753
115 Ga0075428_100009016 3300006844 Bacteria 11067
116 Ga0075428_100229857 3300006844 Bacteria 2001
117 Ga0075430_100002966 3300006846 Bacteria 14210
118 Ga0075431_100001970 3300006847 Bacteria 19585
119 Ga0075433_10000423 3300006852 Bacteria 27086
120 Ga0075433_10025403 3300006852 Bacteria 5007
121 Ga0075433_10091613 3300006852 Bacteria 2688
122 Ga0075433_10193519 3300006852 Bacteria 1809
123 Ga0075433_10460408 3300006852 Bacteria 1121
124 Ga0075434_100030812 3300006871 Bacteria 5285
125 Ga0075434_100050870 3300006871 Bacteria 4116
126 Ga0075434_100058718 3300006871 Bacteria 3823
127 Ga0075434_100214288 3300006871 Bacteria 1946
128 Ga0075434_100600278 3300006871 Bacteria 1120
129 Ga0075429_100009181 3300006880 Bacteria 8587
130 Ga0068865_100073323 3300006881 Bacteria 2434
131 Ga0068865_100360902 3300006881 Bacteria 1180
132 Ga0075436_100015836 3300006914 Bacteria 5163
133 Ga0097620_100270600 3300006931 Bacteria 1791
134 Ga0097620_100896400 3300006931 Bacteria 972
135 Ga0099794_10005607 3300007265 Bacteria 5048
136 Ga0099794_10009540 3300007265 Bacteria 4087
137 Ga0099794_10200846 3300007265 Bacteria 1021
138 Ga0105240_10000702 3300009093 Bacteria 61289
139 Ga0105240_10001692 3300009093 Bacteria 37346
140 Ga0105240_10596294 3300009093 Bacteria 1217
141 Ga0111539_10126875 3300009094 Bacteria 2989
142 Ga0111539_10709295 3300009094 Bacteria 1171
143 Ga0105245_10404612 3300009098 Bacteria 1365
144 Ga0105247_10000052 3300009101 Bacteria 141465
145 Ga0114129_10050731 3300009147 Bacteria 5827
146 Ga0114129_10114558 3300009147 Bacteria 3717
147 Ga0114129_10199830 3300009147 Bacteria 2708
148 Ga0114129_10365037 3300009147 Bacteria 1910
149 Ga0114129_10915585 3300009147 Bacteria 1110
150 Ga0105242_10002174 3300009176 Bacteria 15464
151 Ga0105242_10908490 3300009176 Bacteria 881
152 Ga0105248_10158768 3300009177 Bacteria 2551
153 Ga0105237_10000895 3300009545 Bacteria 40186
154 Ga0105237_10171962 3300009545 Unclassified 2167
155 Ga0105237_10291583 3300009545 Bacteria 1634
156 Ga0105249_10020145 3300009553 Bacteria 5959
157 Ga0105249_10207046 3300009553 Bacteria 1922
158 Ga0105249_11234774 3300009553 Bacteria 819
159 Ga0105239_10003849 3300010375 Bacteria 18217
160 Ga0105239_10006980 3300010375 Bacteria 13012
161 Ga0105239_10016176 3300010375 Bacteria 8254
162 Ga0105239_10026474 3300010375 Bacteria 6382
163 Ga0105246_10078561 3300011119 Bacteria 2344
164 Ga0157373_10025387 3300013100 Bacteria 4286
165 Ga0157373_10050869 3300013100 Bacteria 2950
166 Ga0157373_10106525 3300013100 Bacteria 1971
167 Ga0157371_10145879 3300013102 Bacteria 1686
168 Ga0157371_10213311 3300013102 Bacteria 1386
169 Ga0157370_10163542 3300013104 Unclassified 2070
170 Ga0157378_10021173 3300013297 Bacteria 5719
171 Ga0157378_10025930 3300013297 Bacteria 5165
172 Ga0157378_10047230 3300013297 Bacteria 3827
173 Ga0163162_10017085 3300013306 Bacteria 7099
174 Ga0163162_10099475 3300013306 Bacteria 2999
175 Ga0157372_10097986 3300013307 Bacteria 3345
176 Ga0157372_10135323 3300013307 Bacteria 2837
177 Ga0157372_10396858 3300013307 Bacteria 1607
178 Ga0157372_10704232 3300013307 Bacteria 1175
179 Ga0157375_10426087 3300013308 Bacteria 1493
180 Ga0157380_10245520 3300014326 Bacteria 1617
181 Ga0157377_10060005 3300014745 Bacteria 2170
182 Ga0182005_1078175 3300015265 Bacteria 912
183 Ga0163161_10002796 3300017792 Bacteria 12374
184 Ga0163161_10151335 3300017792 Bacteria 1764
185 Ga0213871_10005575 3300021441 Bacteria 2606
186 Ga0213871_10037837 3300021441 Bacteria 1286
187 Ga0207672_1000462 3300025223 Bacteria 5137
188 Ga0207697_10002636 3300025315 Bacteria 9202
189 Ga0207682_10000307 3300025893 Bacteria 22105
190 Ga0207642_10005460 3300025899 Bacteria 4153
191 Ga0207642_10049220 3300025899 Bacteria 1893
192 Ga0207642_10093438 3300025899 Bacteria 1492
193 Ga0207710_10000004 3300025900 Bacteria 846540
194 Ga0207684_10009924 3300025910 Bacteria 8394
195 Ga0207684_10364111 3300025910 Bacteria 1244
196 Ga0207707_10691197 3300025912 Bacteria 857
197 Ga0207695_10094646 3300025913 Bacteria 2994
198 Ga0207671_10028618 3300025914 Bacteria 4162
199 Ga0207671_10101971 3300025914 Bacteria 2175
200 Ga0207671_10177719 3300025914 Bacteria 1655
201 Ga0207660_10009565 3300025917 Bacteria 6273
202 Ga0207660_10313063 3300025917 Bacteria 1252
203 Ga0207662_10000169 3300025918 Bacteria 31168
204 Ga0207662_10025473 3300025918 Bacteria 3407
205 Ga0207662_10156049 3300025918 Unclassified 1455
206 Ga0207649_10107680 3300025920 Bacteria 1856
207 Ga0207649_10407659 3300025920 Bacteria 1018
208 Ga0207652_10028085 3300025921 Bacteria 4692
209 Ga0207646_10004996 3300025922 Bacteria 14145
210 Ga0207646_10017773 3300025922 Bacteria 6644
211 Ga0207646_10043718 3300025922 Bacteria 4022
212 Ga0207681_10076485 3300025923 Bacteria 2351
213 Ga0207650_10174740 3300025925 Bacteria 1709
214 Ga0207659_10006446 3300025926 Bacteria 7189
215 Ga0207687_10151494 3300025927 Bacteria 1770
216 Ga0207700_10036999 3300025928 Bacteria 3530
217 Ga0207700_10444765 3300025928 Bacteria 1141
218 Ga0207644_10000267 3300025931 Bacteria 35078
219 Ga0207644_10021051 3300025931 Bacteria 4440
220 Ga0207644_10343214 3300025931 Bacteria 1211
221 Ga0207690_10013159 3300025932 Bacteria 4966
222 Ga0207690_10146478 3300025932 Bacteria 1746
223 Ga0207706_10002103 3300025933 Bacteria 19496
224 Ga0207686_10008626 3300025934 Bacteria 5503
225 Ga0207709_10189157 3300025935 Bacteria 1461
226 Ga0207691_10074372 3300025940 Bacteria 3065
227 Ga0207689_10006436 3300025942 Bacteria 10385
228 Ga0207689_10021058 3300025942 Bacteria 5481
229 Ga0207689_10665200 3300025942 Bacteria 878
230 Ga0207679_10011923 3300025945 Bacteria 5648
231 Ga0207667_10000356 3300025949 Bacteria 62183
232 Ga0207651_10098621 3300025960 Bacteria 2161
233 Ga0207651_10166974 3300025960 Bacteria 1731
234 Ga0207651_10216881 3300025960 Bacteria 1544
235 Ga0207712_10064013 3300025961 Bacteria 2620
236 Ga0207640_10059742 3300025981 Bacteria 2517
237 Ga0207677_10052035 3300026023 Bacteria 2780
238 Ga0207677_10184936 3300026023 Bacteria 1642
239 Ga0207677_10273472 3300026023 Bacteria 1383
240 Ga0207703_10000093 3300026035 Bacteria 104313
241 Ga0207703_10049076 3300026035 Bacteria 3411
242 Ga0207703_10290649 3300026035 Bacteria 1487
243 Ga0207639_10186965 3300026041 Bacteria 1767
244 Ga0207648_10164977 3300026089 Bacteria 1957
245 Ga0207676_10317301 3300026095 Bacteria 1429
246 Ga0207676_10368208 3300026095 Bacteria 1334
247 Ga0207676_10368650 3300026095 Bacteria 1333
248 Ga0207676_10471848 3300026095 Bacteria 1187
249 Ga0207674_10161807 3300026116 Bacteria 2192
250 Ga0207674_10216692 3300026116 Bacteria 1863
251 Ga0207674_10272873 3300026116 Bacteria 1639
252 Ga0207675_100002639 3300026118 Bacteria 17699
253 Ga0207675_100912452 3300026118 Bacteria 895
254 Ga0207683_10010220 3300026121 Bacteria 8005
255 Ga0207683_10137957 3300026121 Bacteria 2196
256 Ga0207698_10246218 3300026142 Bacteria 1633
257 Ga0209967_1001146 3300027364 Bacteria 3378
258 Ga0209984_1003092 3300027424 Bacteria 1886
259 Ga0209970_1001825 3300027614 Bacteria 3687
260 Ga0209983_1000210 3300027665 Bacteria 11597
261 Ga0209588_1009530 3300027671 Bacteria 2905
262 Ga0209588_1017664 3300027671 Bacteria 2213
263 Ga0209971_1000016 3300027682 Bacteria 65564
264 Ga0209966_1000083 3300027695 Bacteria 41039
265 Ga0209998_10000121 3300027717 Bacteria 30879
266 Ga0209974_10007302 3300027876 Bacteria 3810
267 Ga0207428_10014860 3300027907 Bacteria 6743
268 Ga0207428_10088539 3300027907 Bacteria 2408
269 Ga0268266_10004629 3300028379 Bacteria 13117
270 Ga0268266_10041271 3300028379 Bacteria 3937
271 Ga0268265_10006866 3300028380 Bacteria 7703
272 Ga0268264_10243254 3300028381 Bacteria 1667
273 Ga0268264_10370656 3300028381 Bacteria 1368
274 Ga0316182_1291712 3300030745 Bacteria 1019
275 Ga0265329_10099086 3300031242 Bacteria 927
276 Ga0265316_10061011 3300031344 Bacteria 2930
277 Ga0307413_10081854 3300031824 Bacteria 2071
278 Ga0307410_10198709 3300031852 Bacteria 1529
279 Ga0307407_10146777 3300031903 Bacteria 1528
280 Ga0307412_10151641 3300031911 Bacteria 1711
281 Ga0307409_100106706 3300031995 Bacteria 2338
282 Ga0307409_100153431 3300031995 Bacteria 2003
283 Ga0307409_100658851 3300031995 Bacteria 1042
284 Ga0307416_100412726 3300032002 Bacteria 1392
285 Ga0307411_10036654 3300032005 Bacteria 3075
286 Ga0307415_100392579 3300032126 Bacteria 1182
287 Ga0373932_0109914 3300035112 Bacteria 907
288 Ga0373954_0022108 3300035118 Bacteria 2883
289 Ga0373937_0009920 3300036401 Bacteria 8304
290 Ga0373937_0245951 3300036401 Bacteria 1686
291 Ga0395905_0521082 3300037471 Bacteria 1089
292 Ga0436360_0293882 3300039438 Bacteria 1804
293 Ga0436360_1359430 3300039438 Bacteria 7366
294 Ga0436363_0929017 3300039450 Bacteria 1698
295 Ga0436362_0134369 3300039453 Bacteria 11627
296 Ga0439436_0132456 3300041404 Bacteria 699
297 Ga0439448_0007334 3300042005 Bacteria 3193
298 Ga0439455_0109227 3300042012 Bacteria 768
299 Ga0439464_0002077 3300042439 Bacteria 4879
300 Ga0439460_0002857 3300042461 Bacteria 4162
301 Ga0451577_0082260 3300042876 Bacteria 2872
302 Ga0453683_0029450 3300044673 Bacteria 3471
303 Ga0453683_0044769 3300044673 Bacteria 2775
304 Ga0453683_0074076 3300044673 Bacteria 2131
305 Ga0453684_0109518 3300044712 Bacteria 3359
306 Ga0453684_0251547 3300044712 Bacteria 2029
307 Ga0453684_0725519 3300044712 Bacteria 1078
308 Ga0451576_0040232 3300045051 Bacteria 4949
309 Ga0451576_0148535 3300045051 Bacteria 2444
310 Ga0495638_0186964 3300046460 Bacteria 1178
311 Ga0495639_0147387 3300046475 Bacteria 1134
312 Ga0495664_0083578 3300046477 Bacteria 1916
313 Ga0495606_0000100 3300046507 Bacteria 147592
314 Ga0495616_0017915 3300046513 Bacteria 3902
315 Ga0495644_0099207 3300046523 Bacteria 1101
316 Ga0495663_0011750 3300046525 Bacteria 2438
317 Ga0495654_0000348 3300046530 Bacteria 39921
318 Ga0495668_0003907 3300046616 Bacteria 10887
319 Ga0495625_0000036 3300046660 Bacteria 221680
320 Ga0495659_0103779 3300046664 Bacteria 1104
321 Ga0495613_0290832 3300046689 Bacteria 1133
322 Ga0495649_0000017 3300046694 Bacteria 221685
323 Ga0495600_0212264 3300046809 Bacteria 1240
324 Ga0495677_0071760 3300047445 Bacteria 1291
325 Ga0496102_0002029 3300048905 Bacteria 17499
326 Ga0496103_0472868 3300048906 Bacteria 803
327 Ga0496110_0689003 3300048913 Bacteria 923
328 Ga0496112_0693266 3300048915 Bacteria 947
329 Ga0496119_0001340 3300048922 Bacteria 30138
330 Ga0496120_0000226 3300048923 Bacteria 96713
331 Ga0496126_0002000 3300048929 Bacteria 28832
332 Ga0501031_0011016 3300049568 Bacteria 5893
333 Ga0501032_0074190 3300049569 Bacteria 2267
334 Ga0501033_0411738 3300049570 Bacteria 942
335 Ga0501034_0669537 3300049571 Bacteria 938
336 Ga0501036_0004113 3300049572 Bacteria 11713
337 Ga0501036_0136799 3300049572 Bacteria 2068
338 Ga0501036_0273652 3300049572 Bacteria 1413
339 Ga0501036_0348699 3300049572 Bacteria 1236
340 Ga0501037_0197556 3300049573 Bacteria 1422
341 Ga0501038_0189094 3300049574 Bacteria 1657
342 Ga0501039_0001935 3300049575 Bacteria 15343
343 Ga0501039_0016997 3300049575 Bacteria 5577
344 Ga0501039_0273372 3300049575 Bacteria 1328
345 Ga0501040_0007051 3300049576 Bacteria 7282
346 Ga0501040_0053277 3300049576 Bacteria 2771
347 Ga0501040_0336578 3300049576 Bacteria 1080
348 Ga0501041_0018266 3300049577 Bacteria 4177
349 Ga0501041_0026462 3300049577 Bacteria 3490
350 Ga0501042_0000141 3300049578 Bacteria 31706
351 Ga0501042_0000478 3300049578 Bacteria 20717
352 Ga0501042_0152284 3300049578 Bacteria 1667
353 Ga0501042_0277767 3300049578 Bacteria 1210
354 Ga0501043_0025686 3300049579 Bacteria 4622
355 Ga0501046_0000115 3300049580 Bacteria 84375
356 Ga0501046_0029320 3300049580 Bacteria 4474
357 Ga0501046_0121741 3300049580 Bacteria 1984
358 Ga0501048_0009721 3300049582 Bacteria 7212
359 Ga0501048_0023470 3300049582 Bacteria 4506
360 Ga0501048_0152165 3300049582 Bacteria 1637
361 Ga0501048_0164535 3300049582 Bacteria 1570
362 Ga0501068_0021551 3300049584 Bacteria 3763
363 Ga0501070_0026349 3300049586 Bacteria 4879
364 Ga0501071_0036355 3300049587 Bacteria 3512
365 Ga0501071_0038156 3300049587 Bacteria 3432
366 Ga0501071_0180835 3300049587 Bacteria 1580
367 Ga0501072_0000069 3300049588 Bacteria 74196
368 Ga0501072_0003083 3300049588 Bacteria 12564
369 Ga0501072_0030060 3300049588 Bacteria 4246
370 Ga0501072_0111973 3300049588 Bacteria 2173
371 Ga0501072_0317954 3300049588 Bacteria 1237
372 Ga0501074_0001999 3300049590 Bacteria 14039
373 Ga0501074_0081395 3300049590 Bacteria 2322
374 Ga0501074_0150100 3300049590 Bacteria 1666
375 Ga0501075_0005281 3300049591 Bacteria 8827
376 Ga0501075_0011921 3300049591 Bacteria 6166
377 Ga0501075_0016573 3300049591 Bacteria 5311
378 Ga0501075_0057229 3300049591 Bacteria 2935
379 Ga0501076_0000140 3300049592 Bacteria 41122
380 Ga0501076_0009599 3300049592 Bacteria 7146
381 Ga0501076_0083442 3300049592 Bacteria 2566
382 Ga0501076_0255220 3300049592 Bacteria 1435
383 Ga0501077_0004545 3300049593 Bacteria 8438
384 Ga0501077_0015917 3300049593 Bacteria 4738
385 Ga0501077_0039959 3300049593 Bacteria 2989
386 Ga0501079_0000060 3300049741 Bacteria 49239
387 Ga0501079_0002407 3300049741 Bacteria 13570
388 Ga0501079_0002862 3300049741 Bacteria 12583
389 Ga0501079_0013914 3300049741 Bacteria 6137
390 Ga0501079_0125842 3300049741 Bacteria 1994
391 Ga0501079_0243148 3300049741 Bacteria 1406
392 Ga0501080_0001483 3300049742 Bacteria 19784
393 Ga0501080_0021673 3300049742 Bacteria 5950
394 Ga0501080_0022725 3300049742 Bacteria 5810
395 Ga0501080_0312594 3300049742 Bacteria 1424
396 Ga0501081_0000047 3300049743 Bacteria 45820
397 Ga0501081_0008600 3300049743 Bacteria 6634
398 Ga0501081_0014034 3300049743 Bacteria 5276
399 Ga0501081_0037477 3300049743 Bacteria 3308
400 Ga0501081_0095501 3300049743 Bacteria 2096
401 Ga0501083_0019774 3300049744 Bacteria 4686
402 Ga0501083_0026524 3300049744 Bacteria 4004
403 Ga0501035_0028943 3300049822 Bacteria 5054
404 Ga0501044_0556798 3300049823 Bacteria 1043
405 Ga0501045_0000004 3300049824 Bacteria 86792
406 Ga0501045_0019845 3300049824 Bacteria 4797
407 Ga0501045_0032057 3300049824 Bacteria 3807
408 Ga0501045_0870410 3300049824 Bacteria 662
409 nmdc:mga0k408_44557_c1 3300050493 Bacteria 2559
410 nmdc:mga05p37_16247_c1 3300050507 Bacteria 8961
411 nmdc:mga05p37_26207_c1 3300050507 Bacteria 7089
412 nmdc:mga05p37_31344_c1 3300050507 Bacteria 6494
413 nmdc:mga05p37_764240_c1 3300050507 Bacteria 1063
414 nmdc:mga09592_151413_c1 3300050508 Bacteria 2001
415 nmdc:mga09592_31600_c1 3300050508 Bacteria 4412
416 nmdc:mga06r32_2998_c1 3300050510 Bacteria 15120
417 nmdc:mga08y16_37873_c1 3300050511 Bacteria 5063
418 nmdc:mga0n895_118215_c1 3300050512 Bacteria 2671
419 nmdc:mga0n895_2022_c1 3300050512 Bacteria 15597
420 nmdc:mga0n895_45553_c1 3300050512 Bacteria 4280
421 nmdc:mga0n895_582942_c1 3300050512 Bacteria 1122
422 nmdc:mga0n895_6989_c1 3300050512 Bacteria 9639
423 nmdc:mga0rr50_1027_c1 3300050513 Bacteria 15146
424 nmdc:mga0rr50_529255_c1 3300050513 Bacteria 1003
425 nmdc:mga08x19_6265_c1 3300050514 Bacteria 7042
426 nmdc:mga0a205_133608_c1 3300050515 Bacteria 2382
427 nmdc:mga0a205_15170_c1 3300050515 Bacteria 7197
428 nmdc:mga0a205_167260_c1 3300050515 Bacteria 2094
429 nmdc:mga0a205_380102_c1 3300050515 Bacteria 1278
430 nmdc:mga0a205_60991_c1 3300050515 Bacteria 3642
431 nmdc:mga0a205_86860_c1 3300050515 Bacteria 3021
432 nmdc:mga0a205_8805_c1 3300050515 Bacteria 9195
433 Ga0500559_0012030 3300053136 Bacteria 3686
434 Ga0500604_0004911 3300053151 Bacteria 3546
435 Ga0500627_0000228 3300053158 Bacteria 16175
436 Ga0501084_0000507 3300054114 Bacteria 29821
437 Ga0501084_0002272 3300054114 Bacteria 15432
438 Ga0501084_0013816 3300054114 Bacteria 6683
439 Ga0501084_0325994 3300054114 Bacteria 1297
440 Ga0501084_1052102 3300054114 Bacteria 684
441 Ga0590071_001289 3300059421 Bacteria 6721
442 Ga0590074_020213 3300059423 Bacteria 1145
443 Ga0590075_000818 3300059424 Bacteria 8179
444 Ga0590077_002914 3300059426 Bacteria 3589
445 Ga0501082_0000422 3300060353 Bacteria 37497
446 Ga0501082_0001107 3300060353 Bacteria 23813
447 Ga0501082_0002468 3300060353 Bacteria 16232
448 Ga0501082_0005201 3300060353 Bacteria 11313
449 Ga0501082_0537748 3300060353 Bacteria 1022
450 Ga0530510_0000001 3300061734 Bacteria 285623
451 Ga0530510_0042028 3300061734 Bacteria 3301
452 2881103844 2881101125 Bacteria 4590519
453 Ga0373937_0348397
454 JGI24034J14986_100326
455 JGI24740J21852_10037898
456 JGI24748J21848_1000035
457 JGI24034J26672_10000039
458 Ga0006759J45824_1032755
459 rootH1_10047457
460 JGI26129J50193_1002624
461 Ga0058859_10000079
462 Ga0058862_12796641
463 Ga0065714_10192988
464 Ga0065714_10206617
465 Ga0065712_10001725
466 Ga0065712_10044009
467 Ga0065707_10037936
468 Ga0070676_10114178
469 Ga0070683_100402211
470 Ga0070690_100024438
471 Ga0070690_100088022
472 Ga0070690_100220767
473 Ga0070670_100054848
474 Ga0070670_100149092
475 Ga0070677_10011310
476 Ga0068869_100075322
477 Ga0068869_100129462
478 Ga0070666_10088929
479 Ga0070680_100009389
480 Ga0070680_100048737
481 Ga0070680_100074030
482 Ga0068868_100021761
483 Ga0068868_100064457
484 Ga0070660_100179152
485 Ga0070660_100383310
486 Ga0070687_100087668
487 Ga0070661_100158508
488 Ga0070671_100029957
489 Ga0070671_100388041
490 Ga0070674_100300272
491 Ga0070674_100662853
492 Ga0070673_100051773
493 Ga0070673_100280272
494 Ga0070673_100794957
495 Ga0070659_100349865
496 Ga0070667_100049006
497 Ga0070705_100451453
498 Ga0070694_100000075
499 Ga0070694_100007837
500 Ga0070694_100014630
501 Ga0070694_100039677
502 Ga0070678_100026498
503 Ga0070662_100033287
504 Ga0068867_100153432
505 Ga0070685_10036793
506 Ga0070706_100005622
507 Ga0070706_100762223
508 Ga0070706_100812036
509 Ga0070707_100027380
510 Ga0070707_100052862
511 Ga0070698_100775214
512 Ga0070699_100003813
513 Ga0070699_100035652
514 Ga0070699_100174328
515 Ga0070699_100632225
516 Ga0070679_100046970
517 Ga0070684_100243878
518 Ga0070697_100013250
519 Ga0070697_100021221
520 Ga0070697_100326875
521 Ga0068853_100169618
522 Ga0068853_100297563
523 Ga0068853_100403125
524 Ga0070686_100010312
525 Ga0070695_100000723
526 Ga0070695_100007894
527 Ga0070695_100011995
528 Ga0070695_100504094
529 Ga0070696_100014990
530 Ga0070696_100430858
531 Ga0070693_100082665
532 Ga0070693_100156792
533 Ga0070665_100475949
534 Ga0070704_100000972
535 Ga0070704_100208583
536 Ga0068855_100021872
537 Ga0070664_100021165
538 Ga0070664_100356155
539 Ga0068857_100076801
540 Ga0068857_100084171
541 Ga0068857_100665172
542 Ga0070702_100849648
543 Ga0068852_100405924
544 Ga0068859_100270615
545 Ga0068859_100896333
546 Ga0068864_100556047
547 Ga0068866_10008102
548 Ga0068866_10112566
549 Ga0068861_100027459
550 Ga0068861_101185469
551 Ga0068863_100023715
552 Ga0068858_100000053
553 Ga0068860_100007163
554 Ga0068860_100040226
555 Ga0068862_101043797
556 Ga0081455_10000749
557 Ga0081539_10082356
558 Ga0081539_10178395
559 Ga0075368_10012109
560 Ga0075363_100153151
561 Ga0075366_10029235
562 Ga0075366_10438119
563 Ga0075370_10025873
564 Ga0068871_100059391
565 Ga0068871_100140535
566 Ga0075428_100000407
567 Ga0075428_100009016
568 Ga0075428_100229857
569 Ga0075430_100002966
570 Ga0075431_100001970
571 Ga0075433_10000423
572 Ga0075433_10025403
573 Ga0075433_10091613
574 Ga0075433_10193519
575 Ga0075433_10460408
576 Ga0075434_100030812
577 Ga0075434_100050870
578 Ga0075434_100058718
579 Ga0075434_100214288
580 Ga0075434_100600278
581 Ga0075429_100009181
582 Ga0068865_100073323
583 Ga0068865_100360902
584 Ga0075436_100015836
585 Ga0097620_100270600
586 Ga0097620_100896400
587 Ga0099794_10005607
588 Ga0099794_10009540
589 Ga0099794_10200846
590 Ga0105240_10000702
591 Ga0105240_10001692
592 Ga0105240_10596294
593 Ga0111539_10126875
594 Ga0111539_10709295
595 Ga0105245_10404612
596 Ga0105247_10000052
597 Ga0114129_10050731
598 Ga0114129_10114558
599 Ga0114129_10199830
600 Ga0114129_10365037
601 Ga0114129_10915585
602 Ga0105242_10002174
603 Ga0105242_10908490
604 Ga0105248_10158768
605 Ga0105237_10000895
606 Ga0105237_10171962
607 Ga0105237_10291583
608 Ga0105249_10020145
609 Ga0105249_10207046
610 Ga0105249_11234774
611 Ga0105239_10003849
612 Ga0105239_10006980
613 Ga0105239_10016176
614 Ga0105239_10026474
615 Ga0105246_10078561
616 Ga0157373_10025387
617 Ga0157373_10050869
618 Ga0157373_10106525
619 Ga0157371_10145879
620 Ga0157371_10213311
621 Ga0157370_10163542
622 Ga0157378_10021173
623 Ga0157378_10025930
624 Ga0157378_10047230
625 Ga0163162_10017085
626 Ga0163162_10099475
627 Ga0157372_10097986
628 Ga0157372_10135323
629 Ga0157372_10396858
630 Ga0157372_10704232
631 Ga0157375_10426087
632 Ga0157380_10245520
633 Ga0157377_10060005
634 Ga0182005_1078175
635 Ga0163161_10002796
636 Ga0163161_10151335
637 Ga0213871_10005575
638 Ga0213871_10037837
639 Ga0207672_1000462
640 Ga0207697_10002636
641 Ga0207682_10000307
642 Ga0207642_10005460
643 Ga0207642_10049220
644 Ga0207642_10093438
645 Ga0207710_10000004
646 Ga0207684_10009924
647 Ga0207684_10364111
648 Ga0207707_10691197
649 Ga0207695_10094646
650 Ga0207671_10028618
651 Ga0207671_10101971
652 Ga0207671_10177719
653 Ga0207660_10009565
654 Ga0207660_10313063
655 Ga0207662_10000169
656 Ga0207662_10025473
657 Ga0207662_10156049
658 Ga0207649_10107680
659 Ga0207649_10407659
660 Ga0207652_10028085
661 Ga0207646_10004996
662 Ga0207646_10017773
663 Ga0207646_10043718
664 Ga0207681_10076485
665 Ga0207650_10174740
666 Ga0207659_10006446
667 Ga0207687_10151494
668 Ga0207700_10036999
669 Ga0207700_10444765
670 Ga0207644_10000267
671 Ga0207644_10021051
672 Ga0207644_10343214
673 Ga0207690_10013159
674 Ga0207690_10146478
675 Ga0207706_10002103
676 Ga0207686_10008626
677 Ga0207709_10189157
678 Ga0207691_10074372
679 Ga0207689_10006436
680 Ga0207689_10021058
681 Ga0207689_10665200
682 Ga0207679_10011923
683 Ga0207667_10000356
684 Ga0207651_10098621
685 Ga0207651_10166974
686 Ga0207651_10216881
687 Ga0207712_10064013
688 Ga0207640_10059742
689 Ga0207677_10052035
690 Ga0207677_10184936
691 Ga0207677_10273472
692 Ga0207703_10000093
693 Ga0207703_10049076
694 Ga0207703_10290649
695 Ga0207639_10186965
696 Ga0207648_10164977
697 Ga0207676_10317301
698 Ga0207676_10368208
699 Ga0207676_10368650
700 Ga0207676_10471848
701 Ga0207674_10161807
702 Ga0207674_10216692
703 Ga0207674_10272873
704 Ga0207675_100002639
705 Ga0207675_100912452
706 Ga0207683_10010220
707 Ga0207683_10137957
708 Ga0207698_10246218
709 Ga0209967_1001146
710 Ga0209984_1003092
711 Ga0209970_1001825
712 Ga0209983_1000210
713 Ga0209588_1009530
714 Ga0209588_1017664
715 Ga0209971_1000016
716 Ga0209966_1000083
717 Ga0209998_10000121
718 Ga0209974_10007302
719 Ga0207428_10014860
720 Ga0207428_10088539
721 Ga0268266_10004629
722 Ga0268266_10041271
723 Ga0268265_10006866
724 Ga0268264_10243254
725 Ga0268264_10370656
726 Ga0316182_1291712
727 Ga0265329_10099086
728 Ga0265316_10061011
729 Ga0307413_10081854
730 Ga0307410_10198709
731 Ga0307407_10146777
732 Ga0307412_10151641
733 Ga0307409_100106706
734 Ga0307409_100153431
735 Ga0307409_100658851
736 Ga0307416_100412726
737 Ga0307411_10036654
738 Ga0307415_100392579
739 Ga0373932_0109914
740 Ga0373954_0022108
741 Ga0373937_0009920
742 Ga0373937_0245951
743 Ga0395905_0521082
744 Ga0436360_0293882
745 Ga0436360_1359430
746 Ga0436363_0929017
747 Ga0436362_0134369
748 Ga0439436_0132456
749 Ga0439448_0007334
750 Ga0439455_0109227
751 Ga0439464_0002077
752 Ga0439460_0002857
753 Ga0451577_0082260
754 Ga0453683_0029450
755 Ga0453683_0044769
756 Ga0453683_0074076
757 Ga0453684_0109518
758 Ga0453684_0251547
759 Ga0453684_0725519
760 Ga0451576_0040232
761 Ga0451576_0148535
762 Ga0495638_0186964
763 Ga0495639_0147387
764 Ga0495664_0083578
765 Ga0495606_0000100
766 Ga0495616_0017915
767 Ga0495644_0099207
768 Ga0495663_0011750
769 Ga0495654_0000348
770 Ga0495668_0003907
771 Ga0495625_0000036
772 Ga0495659_0103779
773 Ga0495613_0290832
774 Ga0495649_0000017
775 Ga0495600_0212264
776 Ga0495677_0071760
777 Ga0496102_0002029
778 Ga0496103_0472868
779 Ga0496110_0689003
780 Ga0496112_0693266
781 Ga0496119_0001340
782 Ga0496120_0000226
783 Ga0496126_0002000
784 Ga0501031_0011016
785 Ga0501032_0074190
786 Ga0501033_0411738
787 Ga0501034_0669537
788 Ga0501036_0004113
789 Ga0501036_0136799
790 Ga0501036_0273652
791 Ga0501036_0348699
792 Ga0501037_0197556
793 Ga0501038_0189094
794 Ga0501039_0001935
795 Ga0501039_0016997
796 Ga0501039_0273372
797 Ga0501040_0007051
798 Ga0501040_0053277
799 Ga0501040_0336578
800 Ga0501041_0018266
801 Ga0501041_0026462
802 Ga0501042_0000141
803 Ga0501042_0000478
804 Ga0501042_0152284
805 Ga0501042_0277767
806 Ga0501043_0025686
807 Ga0501046_0000115
808 Ga0501046_0029320
809 Ga0501046_0121741
810 Ga0501048_0009721
811 Ga0501048_0023470
812 Ga0501048_0152165
813 Ga0501048_0164535
814 Ga0501068_0021551
815 Ga0501070_0026349
816 Ga0501071_0036355
817 Ga0501071_0038156
818 Ga0501071_0180835
819 Ga0501072_0000069
820 Ga0501072_0003083
821 Ga0501072_0030060
822 Ga0501072_0111973
823 Ga0501072_0317954
824 Ga0501074_0001999
825 Ga0501074_0081395
826 Ga0501074_0150100
827 Ga0501075_0005281
828 Ga0501075_0011921
829 Ga0501075_0016573
830 Ga0501075_0057229
831 Ga0501076_0000140
832 Ga0501076_0009599
833 Ga0501076_0083442
834 Ga0501076_0255220
835 Ga0501077_0004545
836 Ga0501077_0015917
837 Ga0501077_0039959
838 Ga0501079_0000060
839 Ga0501079_0002407
840 Ga0501079_0002862
841 Ga0501079_0013914
842 Ga0501079_0125842
843 Ga0501079_0243148
844 Ga0501080_0001483
845 Ga0501080_0021673
846 Ga0501080_0022725
847 Ga0501080_0312594
848 Ga0501081_0000047
849 Ga0501081_0008600
850 Ga0501081_0014034
851 Ga0501081_0037477
852 Ga0501081_0095501
853 Ga0501083_0019774
854 Ga0501083_0026524
855 Ga0501035_0028943
856 Ga0501044_0556798
857 Ga0501045_0000004
858 Ga0501045_0019845
859 Ga0501045_0032057
860 Ga0501045_0870410
861 nmdc:mga0k408_44557_c1
862 nmdc:mga05p37_16247_c1
863 nmdc:mga05p37_26207_c1
864 nmdc:mga05p37_31344_c1
865 nmdc:mga05p37_764240_c1
866 nmdc:mga09592_151413_c1
867 nmdc:mga09592_31600_c1
868 nmdc:mga06r32_2998_c1
869 nmdc:mga08y16_37873_c1
870 nmdc:mga0n895_118215_c1
871 nmdc:mga0n895_2022_c1
872 nmdc:mga0n895_45553_c1
873 nmdc:mga0n895_582942_c1
874 nmdc:mga0n895_6989_c1
875 nmdc:mga0rr50_1027_c1
876 nmdc:mga0rr50_529255_c1
877 nmdc:mga08x19_6265_c1
878 nmdc:mga0a205_133608_c1
879 nmdc:mga0a205_15170_c1
880 nmdc:mga0a205_167260_c1
881 nmdc:mga0a205_380102_c1
882 nmdc:mga0a205_60991_c1
883 nmdc:mga0a205_86860_c1
884 nmdc:mga0a205_8805_c1
885 Ga0500559_0012030
886 Ga0500604_0004911
887 Ga0500627_0000228
888 Ga0501084_0000507
889 Ga0501084_0002272
890 Ga0501084_0013816
891 Ga0501084_0325994
892 Ga0501084_1052102
893 Ga0590071_001289
894 Ga0590074_020213
895 Ga0590075_000818
896 Ga0590077_002914
897 Ga0501082_0000422
898 Ga0501082_0001107
899 Ga0501082_0002468
900 Ga0501082_0005201
901 Ga0501082_0537748
902 Ga0530510_0000001
903 Ga0530510_0042028
904 2881103844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

17

157

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

177

216

0.94

PF08534

Redoxin

Redoxin

16

175

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9649 3 219
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9644 3 219
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9597 3 219
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9555 3 219
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9209 3 216
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9632 155 218 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9623 5 106 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9618 155 216 3.30.1020.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9517 155 218 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9488 155 218 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A659YRX5-F1-model_v4 deleted 0.9913 1 102
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9912 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.9906 3 94 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.9801 3 94 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A7K0YPB2-F1-model_v4 Redoxin domain-containing protein 0.9782 23 218 GO:0005829
GO:0045454
GO:0051920

Map