F440901

General Info

Members Datasets Scaffolds Average Seq Length
425 249 412 238

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10108315|Ga0065707_101083151
Length 260
Sequence MLTFAGFRSAKRFIHIWEKSMTRVAIVTGGTRGIGEAISLALRKMDMTVVANYAGNADKANAFTERTGIKSVKWDVSDPEACQAGVEQVEAEFGPVDVLINNAGITRDGTLMRMTYQDWKEVIDTNLGGCFNMAKATFPGMRARGWGRIVNIGSVNGQAGQYGQVNYAAAKSGIHGFTKALAQEGAKAGVTVNAIAPGYIDTEMVAGVPADVLTKIVAKVPIGRLGEVGEIARAVVFLCAEDAGFVTGSTMSLNGGQHMY

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
8 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
9 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
10 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
11 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
12 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 2.59
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.47
Rhizoplane 1.88
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 10.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013414 3300001904 Bacteria 1323
2 JGI24752J21851_1001110 3300001976 Bacteria 3688
3 JGI24739J22299_10000394 3300001989 Bacteria 15147
4 JGI24737J22298_10018343 3300001990 Bacteria 2246
5 JGI24735J21928_10012035 3300002067 Bacteria 2737
6 JGI24735J21928_10039199 3300002067 Bacteria 1385
7 JGI24738J21930_10000528 3300002075 Bacteria 10921
8 JGI24751J29686_10000135 3300002459 Bacteria 37169
9 JGI25151J46595_10000624 3300003187 Bacteria 30772
10 JGI25160J50197_1015010 3300003354 Bacteria 2562
11 Ga0065704_10075983 3300005289 Bacteria 5318
12 Ga0065704_10083410 3300005289 Bacteria 3470
13 Ga0065707_10081960 3300005295 Bacteria 27438
14 Ga0065707_10085937 3300005295 Bacteria 5780
15 Ga0065707_10108315 3300005295 Bacteria 2515
16 Ga0070658_10000040 3300005327 Bacteria 136073
17 Ga0070658_10005671 3300005327 Bacteria 10120
18 Ga0070658_10205693 3300005327 Bacteria 1662
19 Ga0070670_100000090 3300005331 Bacteria 86222
20 Ga0070670_100000965 3300005331 Bacteria 22582
21 Ga0070670_100049568 3300005331 Bacteria 3610
22 Ga0068869_100000568 3300005334 Bacteria 20681
23 Ga0070680_100543403 3300005336 Bacteria 996
24 Ga0068868_100000133 3300005338 Bacteria 47802
25 Ga0068868_100043658 3300005338 Bacteria 3502
26 Ga0068868_100124338 3300005338 Bacteria 2106
27 Ga0070660_100003719 3300005339 Bacteria 10539
28 Ga0070660_100514408 3300005339 Bacteria 996
29 Ga0070689_100568115 3300005340 Bacteria 979
30 Ga0070661_100084031 3300005344 Bacteria 2352
31 Ga0070661_100599177 3300005344 Bacteria 891
32 Ga0070692_10016423 3300005345 Bacteria 3520
33 Ga0070668_100000132 3300005347 Bacteria 46719
34 Ga0070668_100001305 3300005347 Bacteria 17832
35 Ga0070668_100002711 3300005347 Bacteria 13030
36 Ga0070668_100016881 3300005347 Bacteria 5460
37 Ga0070669_100000093 3300005353 Bacteria 87563
38 Ga0070669_100001282 3300005353 Bacteria 18155
39 Ga0070671_100001115 3300005355 Bacteria 19917
40 Ga0070671_100004606 3300005355 Bacteria 10934
41 Ga0070671_100191523 3300005355 Bacteria 1733
42 Ga0070673_100000015 3300005364 Bacteria 118064
43 Ga0070673_100042584 3300005364 Bacteria 3502
44 Ga0070659_100003241 3300005366 Bacteria 11581
45 Ga0070667_100000003 3300005367 Bacteria 447715
46 Ga0070667_100002068 3300005367 Bacteria 17765
47 Ga0070667_100004333 3300005367 Bacteria 11971
48 Ga0070662_100006260 3300005457 Bacteria 7666
49 Ga0070681_10377301 3300005458 Bacteria 1329
50 Ga0068867_100000030 3300005459 Bacteria 86560
51 Ga0068867_100044583 3300005459 Bacteria 3250
52 Ga0070685_10542377 3300005466 Bacteria 829
53 Ga0070698_100285428 3300005471 Bacteria 1582
54 Ga0070679_100066157 3300005530 Bacteria 3602
55 Ga0070679_100132326 3300005530 Bacteria 2475
56 Ga0070679_100171015 3300005530 Bacteria 2146
57 Ga0068853_100034401 3300005539 Bacteria 4301
58 Ga0070665_100000079 3300005548 Bacteria 186925
59 Ga0070665_100000685 3300005548 Bacteria 45385
60 Ga0070665_100442522 3300005548 Bacteria 1309
61 Ga0070704_100720814 3300005549 Bacteria 886
62 Ga0068855_100002861 3300005563 Bacteria 21208
63 Ga0068855_100090318 3300005563 Bacteria 3535
64 Ga0068855_100230369 3300005563 Bacteria 2075
65 Ga0068857_100038041 3300005577 Bacteria 4262
66 Ga0068854_100024392 3300005578 Bacteria 4141
67 Ga0068856_100091488 3300005614 Bacteria 3026
68 Ga0068856_100385085 3300005614 Bacteria 1422
69 Ga0068852_100004127 3300005616 Bacteria 10227
70 Ga0068859_100003838 3300005617 Bacteria 15350
71 Ga0068859_100004144 3300005617 Bacteria 14804
72 Ga0068864_100000332 3300005618 Bacteria 41671
73 Ga0068864_100004959 3300005618 Bacteria 10910
74 Ga0068864_100061570 3300005618 Bacteria 3251
75 Ga0068861_100005566 3300005719 Bacteria 8535
76 Ga0068863_100000456 3300005841 Bacteria 41671
77 Ga0068863_100028002 3300005841 Bacteria 5379
78 Ga0068863_100068311 3300005841 Bacteria 3362
79 Ga0068858_100000278 3300005842 Bacteria 55142
80 Ga0068860_100000045 3300005843 Bacteria 223252
81 Ga0068860_100108028 3300005843 Bacteria 2659
82 Ga0068860_100483817 3300005843 Bacteria 1234
83 Ga0068862_100000126 3300005844 Bacteria 89210
84 Ga0068862_100000506 3300005844 Bacteria 41538
85 Ga0068862_100001480 3300005844 Bacteria 21523
86 Ga0068862_100021672 3300005844 Bacteria 5373
87 Ga0068862_100041197 3300005844 Bacteria 3929
88 Ga0068862_100041464 3300005844 Bacteria 3916
89 Ga0081455_10002924 3300005937 Bacteria 20032
90 Ga0081455_10077601 3300005937 Bacteria 2732
91 Ga0081540_1026022 3300005983 Bacteria 3351
92 Ga0070717_10192640 3300006028 Bacteria 1782
93 Ga0068871_100114839 3300006358 Bacteria 2269
94 Ga0068865_100000021 3300006881 Bacteria 103137
95 Ga0097620_100003839 3300006931 Bacteria 15350
96 Ga0097620_100004144 3300006931 Bacteria 14804
97 Ga0105251_10001625 3300009011 Bacteria 19048
98 Ga0105251_10036569 3300009011 Bacteria 2415
99 Ga0105240_10029009 3300009093 Bacteria 7217
100 Ga0105240_10052010 3300009093 Bacteria 5151
101 Ga0105240_10249545 3300009093 Bacteria 2053
102 Ga0105240_10746396 3300009093 Bacteria 1064
103 Ga0105245_10325097 3300009098 Bacteria 1516
104 Ga0105247_10008192 3300009101 Bacteria 6381
105 Ga0105247_10037904 3300009101 Bacteria 2941
106 Ga0105243_10001435 3300009148 Bacteria 20998
107 Ga0105243_10001795 3300009148 Bacteria 18418
108 Ga0105241_10104914 3300009174 Bacteria 2253
109 Ga0105242_10000198 3300009176 Bacteria 46869
110 Ga0105242_10034070 3300009176 Bacteria 4081
111 Ga0105248_10000029 3300009177 Bacteria 223366
112 Ga0105248_10000155 3300009177 Bacteria 79121
113 Ga0105248_10293103 3300009177 Bacteria 1832
114 Ga0105248_10303974 3300009177 Bacteria 1796
115 Ga0105237_10002575 3300009545 Bacteria 22351
116 Ga0105237_10348474 3300009545 Bacteria 1485
117 Ga0105237_10678921 3300009545 Bacteria 1037
118 Ga0105237_10737180 3300009545 Bacteria 992
119 Ga0105238_10009116 3300009551 Bacteria 9931
120 Ga0105238_10251887 3300009551 Bacteria 1744
121 Ga0105238_10446424 3300009551 Bacteria 1290
122 Ga0105249_10000024 3300009553 Bacteria 232947
123 Ga0105239_10000131 3300010375 Bacteria 105796
124 Ga0105239_10196436 3300010375 Bacteria 2259
125 Ga0157373_10093177 3300013100 Bacteria 2122
126 Ga0157370_10000203 3300013104 Bacteria 75249
127 Ga0157370_10046403 3300013104 Bacteria 4166
128 Ga0157369_10029339 3300013105 Bacteria 6079
129 Ga0157374_10002712 3300013296 Bacteria 14884
130 Ga0157378_10002734 3300013297 Bacteria 15710
131 Ga0163162_10086804 3300013306 Bacteria 3207
132 Ga0163162_10096946 3300013306 Bacteria 3037
133 Ga0163162_10345313 3300013306 Bacteria 1621
134 Ga0157375_10001617 3300013308 Bacteria 19361
135 Ga0157380_10000137 3300014326 Bacteria 40923
136 Ga0157380_10007500 3300014326 Bacteria 7747
137 Ga0182008_10023235 3300014497 Bacteria 3169
138 Ga0182008_10066578 3300014497 Bacteria 1773
139 Ga0157377_10004241 3300014745 Bacteria 6564
140 Ga0157379_10089237 3300014968 Bacteria 2765
141 Ga0157376_10000140 3300014969 Bacteria 49314
142 Ga0163161_10277101 3300017792 Bacteria 1314
143 Ga0206355_1150189 3300020076 Bacteria 939
144 Ga0209233_1000065 3300025261 Bacteria 387195
145 Ga0209130_1000706 3300025284 Bacteria 29893
146 Ga0209025_1000750 3300025294 Bacteria 54523
147 Ga0209758_1006313 3300025297 Bacteria 8605
148 Ga0207426_1000336 3300025302 Bacteria 88370
149 Ga0207697_10028962 3300025315 Bacteria 2266
150 Ga0207713_1000673 3300025735 Bacteria 32203
151 Ga0207713_1007728 3300025735 Bacteria 6281
152 Ga0207642_10044275 3300025899 Bacteria 1969
153 Ga0207710_10005907 3300025900 Bacteria 5251
154 Ga0207710_10135353 3300025900 Bacteria 1186
155 Ga0207647_10001987 3300025904 Bacteria 15638
156 Ga0207647_10015909 3300025904 Bacteria 5147
157 Ga0207645_10000523 3300025907 Bacteria 31917
158 Ga0207705_10000002 3300025909 Bacteria 2046852
159 Ga0207705_10000025 3300025909 Bacteria 259826
160 Ga0207705_10001656 3300025909 Bacteria 17693
161 Ga0207654_10450920 3300025911 Bacteria 902
162 Ga0207707_10380545 3300025912 Bacteria 1213
163 Ga0207707_10432006 3300025912 Bacteria 1128
164 Ga0207695_10024374 3300025913 Bacteria 6810
165 Ga0207695_10027218 3300025913 Bacteria 6370
166 Ga0207695_10051576 3300025913 Bacteria 4317
167 Ga0207695_10143665 3300025913 Bacteria 2332
168 Ga0207695_10335348 3300025913 Bacteria 1400
169 Ga0207671_10001065 3300025914 Bacteria 33324
170 Ga0207671_10051462 3300025914 Bacteria 3052
171 Ga0207671_10501666 3300025914 Bacteria 967
172 Ga0207693_10403580 3300025915 Bacteria 1068
173 Ga0207657_10007632 3300025919 Bacteria 11071
174 Ga0207657_10039632 3300025919 Bacteria 4184
175 Ga0207649_10051937 3300025920 Bacteria 2541
176 Ga0207681_10000005 3300025923 Bacteria 555724
177 Ga0207681_10000261 3300025923 Bacteria 40384
178 Ga0207694_10008785 3300025924 Bacteria 7623
179 Ga0207694_10249229 3300025924 Bacteria 1453
180 Ga0207694_10282110 3300025924 Bacteria 1365
181 Ga0207650_10000004 3300025925 Bacteria 743372
182 Ga0207650_10000545 3300025925 Bacteria 30685
183 Ga0207659_10200214 3300025926 Bacteria 1594
184 Ga0207687_10005128 3300025927 Bacteria 8686
185 Ga0207687_10285170 3300025927 Bacteria 1325
186 Ga0207700_10165386 3300025928 Bacteria 1841
187 Ga0207700_10261626 3300025928 Bacteria 1482
188 Ga0207644_10000294 3300025931 Bacteria 32960
189 Ga0207644_10005069 3300025931 Bacteria 8599
190 Ga0207644_10159545 3300025931 Bacteria 1752
191 Ga0207690_10002318 3300025932 Bacteria 11610
192 Ga0207690_10055331 3300025932 Bacteria 2672
193 Ga0207690_10215242 3300025932 Bacteria 1467
194 Ga0207706_10007622 3300025933 Bacteria 10008
195 Ga0207686_10006212 3300025934 Bacteria 6424
196 Ga0207686_10043721 3300025934 Bacteria 2746
197 Ga0207709_10000118 3300025935 Bacteria 122125
198 Ga0207704_10000027 3300025938 Bacteria 122372
199 Ga0207711_10000004 3300025941 Bacteria 870636
200 Ga0207711_10005137 3300025941 Bacteria 11096
201 Ga0207711_10006059 3300025941 Bacteria 10217
202 Ga0207689_10000584 3300025942 Bacteria 34795
203 Ga0207661_10005016 3300025944 Bacteria 9281
204 Ga0207667_10002922 3300025949 Bacteria 21209
205 Ga0207667_10117957 3300025949 Bacteria 2735
206 Ga0207667_10240974 3300025949 Bacteria 1851
207 Ga0207651_10000016 3300025960 Bacteria 122094
208 Ga0207651_10010648 3300025960 Bacteria 5107
209 Ga0207712_10000034 3300025961 Bacteria 202320
210 Ga0207668_10000030 3300025972 Bacteria 122797
211 Ga0207668_10004978 3300025972 Bacteria 7818
212 Ga0207668_10007717 3300025972 Bacteria 6400
213 Ga0207668_10026592 3300025972 Bacteria 3758
214 Ga0207668_10069184 3300025972 Bacteria 2512
215 Ga0207640_10036089 3300025981 Bacteria 3100
216 Ga0207640_10346896 3300025981 Bacteria 1191
217 Ga0207658_10000002 3300025986 Bacteria 1364188
218 Ga0207658_10000434 3300025986 Bacteria 39528
219 Ga0207658_10005601 3300025986 Bacteria 8591
220 Ga0207658_10010032 3300025986 Bacteria 6433
221 Ga0207677_10000192 3300026023 Bacteria 49458
222 Ga0207677_10086826 3300026023 Bacteria 2263
223 Ga0207703_10000587 3300026035 Bacteria 37079
224 Ga0207639_10034891 3300026041 Bacteria 3721
225 Ga0207639_10125204 3300026041 Bacteria 2118
226 Ga0207641_10000010 3300026088 Bacteria 402193
227 Ga0207641_10000199 3300026088 Bacteria 81050
228 Ga0207641_10003708 3300026088 Bacteria 13453
229 Ga0207641_10006245 3300026088 Bacteria 10080
230 Ga0207641_10075882 3300026088 Bacteria 2904
231 Ga0207648_10000116 3300026089 Bacteria 77755
232 Ga0207676_10000006 3300026095 Bacteria 681936
233 Ga0207676_10000036 3300026095 Bacteria 198447
234 Ga0207676_10037144 3300026095 Bacteria 3710
235 Ga0207674_10066042 3300026116 Bacteria 3645
236 Ga0207674_10083581 3300026116 Bacteria 3192
237 Ga0207675_100000385 3300026118 Bacteria 42428
238 Ga0207698_10001220 3300026142 Bacteria 15021
239 Ga0268266_10000175 3300028379 Bacteria 115897
240 Ga0268266_10000329 3300028379 Bacteria 74608
241 Ga0268265_10000001 3300028380 Bacteria 1230727
242 Ga0268265_10000059 3300028380 Bacteria 152531
243 Ga0268265_10004576 3300028380 Bacteria 9564
244 Ga0268265_10020157 3300028380 Bacteria 4650
245 Ga0268265_10034737 3300028380 Bacteria 3677
246 Ga0268265_10272096 3300028380 Bacteria 1511
247 Ga0268265_10613696 3300028380 Bacteria 1041
248 Ga0268264_10000101 3300028381 Bacteria 225109
249 Ga0268264_10024380 3300028381 Bacteria 4939
250 Ga0265334_10013837 3300028573 Bacteria 3372
251 Ga0307517_10074320 3300028786 Bacteria 2999
252 Ga0265338_10029568 3300028800 Bacteria 5426
253 Ga0307513_10313091 3300031456 Bacteria 1331
254 Ga0307408_100029973 3300031548 Bacteria 3775
255 Ga0265314_10053773 3300031711 Bacteria 2791
256 Ga0265314_10075556 3300031711 Bacteria 2241
257 Ga0307405_10095803 3300031731 Bacteria 1977
258 Ga0307413_10213403 3300031824 Bacteria 1404
259 Ga0307410_10284212 3300031852 Bacteria 1299
260 Ga0307407_10106730 3300031903 Bacteria 1750
261 Ga0307412_10057250 3300031911 Bacteria 2601
262 Ga0307412_10130690 3300031911 Bacteria 1823
263 Ga0307412_10167191 3300031911 Bacteria 1641
264 Ga0307409_100079518 3300031995 Bacteria 2643
265 Ga0307416_100032632 3300032002 Bacteria 3938
266 Ga0307416_100072295 3300032002 Bacteria 2870
267 Ga0307414_10000842 3300032004 Bacteria 15692
268 Ga0307414_10002252 3300032004 Bacteria 10077
269 Ga0307414_10074995 3300032004 Bacteria 2453
270 Ga0307411_10227859 3300032005 Bacteria 1450
271 Ga0373936_0011119 3300035113 Bacteria 3402
272 Ga0373941_0174140 3300035115 Bacteria 804
273 Ga0373956_0173862 3300035119 Bacteria 1017
274 Ga0316574_0495030 3300035398 Bacteria 763
275 Ga0373933_0318855 3300035724 Bacteria 1008
276 Ga0373933_0348612 3300035724 Bacteria 962
277 Ga0373937_0783953 3300036401 Bacteria 901
278 Ga0395900_0669718 3300037418 Bacteria 973
279 Ga0395905_0132640 3300037471 Bacteria 2343
280 Ga0436364_0602458 3300037853 Bacteria 947
281 Ga0395901_0008801 3300038443 Bacteria 10216
282 Ga0395901_0053106 3300038443 Bacteria 4211
283 Ga0395901_0168957 3300038443 Bacteria 2295
284 Ga0436361_0977713 3300039447 Bacteria 1809
285 Ga0436363_0120568 3300039450 Bacteria 1318
286 Ga0439448_0032258 3300042005 Bacteria 1666
287 Ga0439455_0034490 3300042012 Bacteria 1273
288 Ga0439458_0000048 3300042157 Bacteria 19869
289 Ga0466961_0031975 3300044693 Bacteria 3381
290 Ga0466961_0052446 3300044693 Bacteria 2603
291 Ga0466963_0012325 3300044694 Bacteria 5229
292 Ga0466971_0001004 3300044719 Bacteria 11648
293 Ga0466957_0010106 3300044842 Bacteria 5402
294 Ga0466957_0117011 3300044842 Bacteria 1696
295 Ga0466957_0335348 3300044842 Bacteria 1023
296 Ga0466959_0187074 3300045049 Bacteria 1446
297 Ga0451576_1184382 3300045051 Bacteria 798
298 Ga0466958_0000542 3300045836 Bacteria 16044
299 Ga0466967_0035436 3300045976 Bacteria 4248
300 Ga0466967_0098563 3300045976 Bacteria 2669
301 Ga0466967_0402281 3300045976 Bacteria 1332
302 Ga0466967_1040647 3300045976 Bacteria 815
303 Ga0495664_0186402 3300046477 Bacteria 1258
304 Ga0495630_0117679 3300046517 Unclassified 2015
305 Ga0495643_0021446 3300046522 Bacteria 3706
306 Ga0495652_0052575 3300046529 Bacteria 3474
307 Ga0495668_0041791 3300046616 Bacteria 2553
308 Ga0495669_0137161 3300046684 Bacteria 1154
309 Ga0495613_0003587 3300046689 Bacteria 11631
310 Ga0495686_0000262 3300047472 Bacteria 94462
311 Ga0496102_0000100 3300048905 Bacteria 123531
312 Ga0496102_0139022 3300048905 Bacteria 2277
313 Ga0496103_0000070 3300048906 Bacteria 121077
314 Ga0496103_0013787 3300048906 Bacteria 4799
315 Ga0496103_0199037 3300048906 Bacteria 1288
316 Ga0496108_0867467 3300048911 Bacteria 776
317 Ga0496115_0224187 3300048918 Bacteria 1551
318 Ga0496116_0000045 3300048919 Bacteria 324307
319 Ga0496116_0001752 3300048919 Bacteria 23645
320 Ga0496117_0000194 3300048920 Bacteria 123531
321 Ga0496117_0005305 3300048920 Bacteria 13633
322 Ga0496117_0010705 3300048920 Bacteria 8297
323 Ga0496117_0023598 3300048920 Bacteria 4895
324 Ga0496118_0000146 3300048921 Bacteria 123531
325 Ga0496118_0001200 3300048921 Bacteria 39881
326 Ga0496118_0004591 3300048921 Bacteria 16240
327 Ga0496118_0027705 3300048921 Bacteria 4788
328 Ga0496118_0082996 3300048921 Bacteria 2242
329 Ga0496119_0033374 3300048922 Bacteria 3412
330 Ga0496119_0036195 3300048922 Bacteria 3225
331 Ga0496119_0068394 3300048922 Bacteria 2091
332 Ga0496120_0148537 3300048923 Bacteria 1180
333 Ga0496120_0171386 3300048923 Bacteria 1073
334 Ga0496121_0000024 3300048924 Bacteria 462959
335 Ga0496121_0011369 3300048924 Bacteria 9895
336 Ga0496121_0028649 3300048924 Bacteria 5179
337 Ga0496122_0004681 3300048925 Bacteria 16797
338 Ga0496122_0118356 3300048925 Bacteria 1717
339 Ga0496123_0002896 3300048926 Bacteria 20095
340 Ga0496123_0054707 3300048926 Bacteria 2625
341 Ga0496124_0000185 3300048927 Bacteria 123531
342 Ga0496124_0006995 3300048927 Bacteria 12093
343 Ga0496124_0007034 3300048927 Bacteria 12052
344 Ga0496124_0062904 3300048927 Bacteria 3103
345 Ga0496124_0081232 3300048927 Bacteria 2665
346 Ga0496125_0006050 3300048928 Bacteria 13227
347 Ga0496125_0069852 3300048928 Bacteria 2752
348 Ga0496126_0000641 3300048929 Bacteria 65115
349 Ga0496126_0013949 3300048929 Bacteria 8151
350 Ga0496126_0558937 3300048929 Bacteria 907
351 Ga0501314_001657 3300049530 Bacteria 1640
352 Ga0501031_0213358 3300049568 Bacteria 1258
353 Ga0501033_0130415 3300049570 Bacteria 1821
354 Ga0501033_0163326 3300049570 Bacteria 1602
355 Ga0501034_0145297 3300049571 Bacteria 2349
356 Ga0501034_0193996 3300049571 Bacteria 1992
357 Ga0501034_0514441 3300049571 Bacteria 1109
358 Ga0501036_0226032 3300049572 Bacteria 1571
359 Ga0501036_0669003 3300049572 Bacteria 859
360 Ga0501043_0011178 3300049579 Bacteria 7030
361 Ga0501043_0030046 3300049579 Bacteria 4269
362 Ga0501046_0158362 3300049580 Bacteria 1704
363 Ga0501047_0002100 3300049581 Bacteria 19058
364 Ga0501047_0002711 3300049581 Bacteria 16852
365 Ga0501069_0036930 3300049585 Bacteria 2695
366 Ga0501070_0141748 3300049586 Bacteria 1984
367 Ga0501073_0029192 3300049589 Bacteria 3941
368 Ga0501073_0098262 3300049589 Bacteria 2033
369 Ga0501223_000055 3300049663 Bacteria 38140
370 Ga0501223_004618 3300049663 Bacteria 2933
371 Ga0501224_000002 3300049664 Bacteria 229331
372 Ga0501233_000660 3300049668 Bacteria 5653
373 Ga0501235_004155 3300049669 Bacteria 3136
374 Ga0501257_000064 3300049686 Bacteria 29858
375 Ga0501225_0000039 3300049705 Bacteria 44735
376 Ga0501234_000132 3300049707 Bacteria 9862
377 Ga0501080_0224295 3300049742 Bacteria 1719
378 Ga0501280_000700 3300049776 Bacteria 7417
379 Ga0501035_0379871 3300049822 Bacteria 1178
380 Ga0501035_0459771 3300049822 Bacteria 1052
381 Ga0501044_0000338 3300049823 Bacteria 59252
382 Ga0501044_0005365 3300049823 Bacteria 14244
383 Ga0501044_0137914 3300049823 Bacteria 2429
384 Ga0501044_0214755 3300049823 Bacteria 1876
385 Ga0501226_000046 3300049853 Bacteria 54629
386 nmdc:mga0sz30_3345_c1 3300050516 Bacteria 4558
387 Ga0500643_000033 3300053087 Bacteria 189987
388 Ga0500643_000933 3300053087 Bacteria 18300
389 Ga0500592_000134 3300053116 Bacteria 15761
390 Ga0500592_000653 3300053116 Bacteria 5698
391 Ga0500592_000869 3300053116 Bacteria 4931
392 Ga0500608_003694 3300053122 Bacteria 5793
393 Ga0500655_006723 3300053133 Bacteria 2069
394 Ga0500559_0001479 3300053136 Bacteria 13261
395 Ga0500559_0033290 3300053136 Bacteria 2218
396 Ga0500590_020369 3300053148 Bacteria 3442
397 Ga0500604_0076415 3300053151 Bacteria 1076
398 Ga0500627_0000230 3300053158 Bacteria 15971
399 Ga0500637_0167800 3300053178 Bacteria 1263
400 Ga0500625_000004 3300053729 Bacteria 245905
401 Ga0500645_003846 3300053730 Bacteria 5949
402 Ga0587066_010533 3300059490 Bacteria 1335
403 Ga0587077_013038 3300059493 Bacteria 1341
404 Ga0587080_025466 3300059503 Bacteria 999
405 Ga0587082_005893 3300059504 Bacteria 1612
406 Ga0587106_014356 3300059605 Bacteria 1090
407 Ga0587072_015040 3300059643 Bacteria 1310
408 Ga0587075_012495 3300059644 Bacteria 1155
409 Ga0587079_034795 3300059647 Bacteria 988
410 Ga0587100_005045 3300059648 Bacteria 969
411 Ga0466962_0025480 3300061719 Bacteria 2839
412 Ga0466962_0187539 3300061719 Bacteria 1009

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10052010 Ga0105240_100520104 200
2 3300037418 Ga0395900_0669718 Ga0395900_0669718_110_772 200
3 3300038443 Ga0395901_0168957 Ga0395901_0168957_1203_1865 200
4 3300049570 Ga0501033_0130415 Ga0501033_0130415_435_1142 213
5 3300049579 Ga0501043_0011178 Ga0501043_0011178_1321_2028 213
6 3300045051 Ga0451576_1184382 Ga0451576_1184382_115_759 214
7 3300025981 Ga0207640_10346896 Ga0207640_103468961 216
8 3300005340 Ga0070689_100568115 Ga0070689_1005681151 217
9 3300005563 Ga0068855_100230369 Ga0068855_1002303693 218
10 3300005614 Ga0068856_100385085 Ga0068856_1003850851 218
11 3300025949 Ga0207667_10240974 Ga0207667_102409741 218
12 3300039450 Ga0436363_0120568 Ga0436363_0120568_78_800 218
13 3300049572 Ga0501036_0226032 Ga0501036_0226032_228_950 218
14 3300049823 Ga0501044_0214755 Ga0501044_0214755_538_1260 218
15 3300036401 Ga0373937_0783953 Ga0373937_0783953_229_888 219
16 3300009545 Ga0105237_10737180 Ga0105237_107371801 220
17 3300009551 Ga0105238_10009116 Ga0105238_100091166 220
18 3300025913 Ga0207695_10143665 Ga0207695_101436651 220
19 3300025914 Ga0207671_10501666 Ga0207671_105016662 220
20 3300025924 Ga0207694_10008785 Ga0207694_100087857 220
21 3300053151 Ga0500604_0076415 Ga0500604_0076415_396_1058 220
22 3300013104 Ga0157370_10046403 Ga0157370_100464033 223
23 3300048929 Ga0496126_0558937 Ga0496126_0558937_188_859 223
24 3300049589 Ga0501073_0098262 Ga0501073_0098262_1200_1976 223
25 3300006358 Ga0068871_100114839 Ga0068871_1001148392 224
26 3300025927 Ga0207687_10285170 Ga0207687_102851702 224
27 3300005336 Ga0070680_100543403 Ga0070680_1005434031 227
28 3300005339 Ga0070660_100514408 Ga0070660_1005144081 227
29 3300005530 Ga0070679_100132326 Ga0070679_1001323261 227
30 3300005539 Ga0068853_100034401 Ga0068853_1000344012 227
31 3300005548 Ga0070665_100000685 Ga0070665_10000068545 227
32 3300005563 Ga0068855_100090318 Ga0068855_1000903181 227
33 3300009545 Ga0105237_10348474 Ga0105237_103484741 227
34 3300025909 Ga0207705_10001656 Ga0207705_100016563 227
35 3300025912 Ga0207707_10380545 Ga0207707_103805452 227
36 3300025919 Ga0207657_10039632 Ga0207657_100396322 227
37 3300025932 Ga0207690_10215242 Ga0207690_102152422 227
38 3300025944 Ga0207661_10005016 Ga0207661_1000501614 227
39 3300025949 Ga0207667_10117957 Ga0207667_101179571 227
40 3300028379 Ga0268266_10000329 Ga0268266_1000032926 227
41 3300035115 Ga0373941_0174140 Ga0373941_0174140_14_727 227
42 3300038443 Ga0395901_0008801 Ga0395901_0008801_894_1616 227
43 3300044842 Ga0466957_0335348 Ga0466957_0335348_153_875 227
44 3300045976 Ga0466967_1040647 Ga0466967_1040647_54_776 227
45 3300049570 Ga0501033_0163326 Ga0501033_0163326_685_1407 227
46 3300049571 Ga0501034_0193996 Ga0501034_0193996_608_1330 227
47 3300049589 Ga0501073_0029192 Ga0501073_0029192_2941_3663 227
48 3300049822 Ga0501035_0459771 Ga0501035_0459771_280_1002 227
49 3300049823 Ga0501044_0005365 Ga0501044_0005365_10957_11679 227
50 3300049580 Ga0501046_0158362 Ga0501046_0158362_245_967 228
51 3300049581 Ga0501047_0002100 Ga0501047_0002100_3900_4676 228
52 3300049742 Ga0501080_0224295 Ga0501080_0224295_700_1476 228
53 3300005338 Ga0068868_100124338 Ga0068868_1001243383 229
54 3300009093 Ga0105240_10746396 Ga0105240_107463961 229
55 3300009098 Ga0105245_10325097 Ga0105245_103250972 229
56 3300009177 Ga0105248_10303974 Ga0105248_103039741 229
57 3300031711 Ga0265314_10053773 Ga0265314_100537732 229
58 3300046684 Ga0495669_0137161 Ga0495669_0137161_173_895 229
59 3300005338 Ga0068868_100043658 Ga0068868_1000436582 234
60 3300005364 Ga0070673_100042584 Ga0070673_1000425843 234
61 3300005459 Ga0068867_100044583 Ga0068867_1000445832 234
62 3300009148 Ga0105243_10001795 Ga0105243_100017955 234
63 3300009176 Ga0105242_10034070 Ga0105242_100340703 234
64 3300025926 Ga0207659_10200214 Ga0207659_102002142 234
65 3300025934 Ga0207686_10043721 Ga0207686_100437212 234
66 3300025960 Ga0207651_10010648 Ga0207651_100106485 234
67 3300026023 Ga0207677_10086826 Ga0207677_100868262 234
68 iso_pu_bacteria 2599185359 2600228766 236
69 iso_pu_bacteria 2643221541 2643731326 236
70 iso_pu_bacteria 2643221605 2644038090 236
71 iso_pu_bacteria 2643221606 2644042346 236
72 iso_pu_bacteria 2643221671 2644394012 236
73 iso_pu_bacteria 2818991466 2819715938 236
74 iso_pu_bacteria 2842333319 2842339372 236
75 iso_pu_bacteria 2842333319 2842340837 236
76 iso_pu_bacteria 2879163058 2879163298 236
77 iso_pu_bacteria 2882806704 2882809126 236
78 iso_pu_bacteria 2883354860 2883359331 236
79 iso_pu_bacteria 2928526807 2928529980 236
80 iso_pu_bacteria 2928968154 2928970598 236
81 3300048911 Ga0496108_0867467 Ga0496108_0867467_13_726 237
82 3300005466 Ga0070685_10542377 Ga0070685_105423771 239
83 3300028380 Ga0268265_10613696 Ga0268265_106136962 239
84 3300001904 JGI24736J21556_1013414 JGI24736J21556_10134141 240
85 3300001976 JGI24752J21851_1001110 JGI24752J21851_10011103 240
86 3300001989 JGI24739J22299_10000394 JGI24739J22299_100003943 240
87 3300001990 JGI24737J22298_10018343 JGI24737J22298_100183433 240
88 3300002067 JGI24735J21928_10012035 JGI24735J21928_100120353 240
89 3300002067 JGI24735J21928_10039199 JGI24735J21928_100391991 240
90 3300002075 JGI24738J21930_10000528 JGI24738J21930_100005289 240
91 3300002459 JGI24751J29686_10000135 JGI24751J29686_1000013535 240
92 3300003187 JGI25151J46595_10000624 JGI25151J46595_1000062415 240
93 3300003354 JGI25160J50197_1015010 JGI25160J50197_10150102 240
94 3300005289 Ga0065704_10075983 Ga0065704_100759831 240
95 3300005289 Ga0065704_10083410 Ga0065704_100834103 240
96 3300005295 Ga0065707_10081960 Ga0065707_100819606 240
97 3300005295 Ga0065707_10085937 Ga0065707_100859373 240
98 3300005295 Ga0065707_10108315 Ga0065707_101083151 240
99 3300005327 Ga0070658_10000040 Ga0070658_10000040109 240
100 3300005327 Ga0070658_10005671 Ga0070658_100056715 240
101 3300005327 Ga0070658_10205693 Ga0070658_102056932 240
102 3300005331 Ga0070670_100000090 Ga0070670_1000000907 240
103 3300005331 Ga0070670_100000965 Ga0070670_1000009655 240
104 3300005331 Ga0070670_100049568 Ga0070670_1000495684 240
105 3300005334 Ga0068869_100000568 Ga0068869_10000056811 240
106 3300005338 Ga0068868_100000133 Ga0068868_10000013331 240
107 3300005339 Ga0070660_100003719 Ga0070660_1000037193 240
108 3300005344 Ga0070661_100084031 Ga0070661_1000840313 240
109 3300005344 Ga0070661_100599177 Ga0070661_1005991771 240
110 3300005345 Ga0070692_10016423 Ga0070692_100164232 240
111 3300005347 Ga0070668_100000132 Ga0070668_1000001328 240
112 3300005347 Ga0070668_100001305 Ga0070668_10000130514 240
113 3300005347 Ga0070668_100002711 Ga0070668_1000027114 240
114 3300005347 Ga0070668_100016881 Ga0070668_1000168812 240
115 3300005353 Ga0070669_100000093 Ga0070669_1000000936 240
116 3300005353 Ga0070669_100001282 Ga0070669_1000012828 240
117 3300005355 Ga0070671_100001115 Ga0070671_1000011153 240
118 3300005355 Ga0070671_100004606 Ga0070671_1000046066 240
119 3300005355 Ga0070671_100191523 Ga0070671_1001915233 240
120 3300005364 Ga0070673_100000015 Ga0070673_10000001512 240
121 3300005366 Ga0070659_100003241 Ga0070659_1000032413 240
122 3300005367 Ga0070667_100000003 Ga0070667_100000003379 240
123 3300005367 Ga0070667_100002068 Ga0070667_10000206812 240
124 3300005367 Ga0070667_100004333 Ga0070667_1000043333 240
125 3300005457 Ga0070662_100006260 Ga0070662_1000062606 240
126 3300005458 Ga0070681_10377301 Ga0070681_103773011 240
127 3300005459 Ga0068867_100000030 Ga0068867_10000003070 240
128 3300005471 Ga0070698_100285428 Ga0070698_1002854282 240
129 3300005530 Ga0070679_100066157 Ga0070679_1000661572 240
130 3300005530 Ga0070679_100171015 Ga0070679_1001710152 240
131 3300005548 Ga0070665_100000079 Ga0070665_100000079153 240
132 3300005548 Ga0070665_100442522 Ga0070665_1004425222 240
133 3300005549 Ga0070704_100720814 Ga0070704_1007208141 240
134 3300005563 Ga0068855_100002861 Ga0068855_10000286120 240
135 3300005577 Ga0068857_100038041 Ga0068857_1000380412 240
136 3300005578 Ga0068854_100024392 Ga0068854_1000243923 240
137 3300005614 Ga0068856_100091488 Ga0068856_1000914882 240
138 3300005616 Ga0068852_100004127 Ga0068852_1000041278 240
139 3300005617 Ga0068859_100003838 Ga0068859_1000038384 240
140 3300005617 Ga0068859_100004144 Ga0068859_10000414411 240
141 3300005618 Ga0068864_100000332 Ga0068864_10000033244 240
142 3300005618 Ga0068864_100004959 Ga0068864_1000049592 240
143 3300005618 Ga0068864_100061570 Ga0068864_1000615703 240
144 3300005719 Ga0068861_100005566 Ga0068861_1000055666 240
145 3300005841 Ga0068863_100000456 Ga0068863_1000004565 240
146 3300005841 Ga0068863_100028002 Ga0068863_1000280024 240
147 3300005841 Ga0068863_100068311 Ga0068863_1000683113 240
148 3300005842 Ga0068858_100000278 Ga0068858_10000027827 240
149 3300005843 Ga0068860_100000045 Ga0068860_100000045148 240
150 3300005843 Ga0068860_100108028 Ga0068860_1001080282 240
151 3300005843 Ga0068860_100483817 Ga0068860_1004838171 240
152 3300005844 Ga0068862_100000126 Ga0068862_10000012693 240
153 3300005844 Ga0068862_100000506 Ga0068862_10000050644 240
154 3300005844 Ga0068862_100001480 Ga0068862_1000014808 240
155 3300005844 Ga0068862_100021672 Ga0068862_1000216724 240
156 3300005844 Ga0068862_100041197 Ga0068862_1000411973 240
157 3300005844 Ga0068862_100041464 Ga0068862_1000414642 240
158 3300005937 Ga0081455_10002924 Ga0081455_100029243 240
159 3300005937 Ga0081455_10077601 Ga0081455_100776012 240
160 3300005983 Ga0081540_1026022 Ga0081540_10260223 240
161 3300006028 Ga0070717_10192640 Ga0070717_101926403 240
162 3300006881 Ga0068865_100000021 Ga0068865_10000002112 240
163 3300006931 Ga0097620_100003839 Ga0097620_1000038394 240
164 3300006931 Ga0097620_100004144 Ga0097620_1000041445 240
165 3300009011 Ga0105251_10001625 Ga0105251_1000162514 240
166 3300009011 Ga0105251_10036569 Ga0105251_100365692 240
167 3300009093 Ga0105240_10029009 Ga0105240_100290095 240
168 3300009093 Ga0105240_10249545 Ga0105240_102495452 240
169 3300009101 Ga0105247_10008192 Ga0105247_100081923 240
170 3300009101 Ga0105247_10037904 Ga0105247_100379045 240
171 3300009148 Ga0105243_10001435 Ga0105243_100014358 240
172 3300009174 Ga0105241_10104914 Ga0105241_101049143 240
173 3300009176 Ga0105242_10000198 Ga0105242_100001983 240
174 3300009177 Ga0105248_10000029 Ga0105248_1000002944 240
175 3300009177 Ga0105248_10000155 Ga0105248_100001554 240
176 3300009177 Ga0105248_10293103 Ga0105248_102931032 240
177 3300009545 Ga0105237_10002575 Ga0105237_100025755 240
178 3300009545 Ga0105237_10678921 Ga0105237_106789212 240
179 3300009551 Ga0105238_10251887 Ga0105238_102518871 240
180 3300009551 Ga0105238_10446424 Ga0105238_104464242 240
181 3300009553 Ga0105249_10000024 Ga0105249_1000002427 240
182 3300010375 Ga0105239_10000131 Ga0105239_1000013190 240
183 3300010375 Ga0105239_10196436 Ga0105239_101964363 240
184 3300013100 Ga0157373_10093177 Ga0157373_100931774 240
185 3300013104 Ga0157370_10000203 Ga0157370_1000020333 240
186 3300013105 Ga0157369_10029339 Ga0157369_100293393 240
187 3300013296 Ga0157374_10002712 Ga0157374_100027128 240
188 3300013297 Ga0157378_10002734 Ga0157378_100027349 240
189 3300013306 Ga0163162_10086804 Ga0163162_100868043 240
190 3300013306 Ga0163162_10096946 Ga0163162_100969463 240
191 3300013306 Ga0163162_10345313 Ga0163162_103453132 240
192 3300013308 Ga0157375_10001617 Ga0157375_100016174 240
193 3300014326 Ga0157380_10000137 Ga0157380_100001373 240
194 3300014326 Ga0157380_10007500 Ga0157380_100075004 240
195 3300014497 Ga0182008_10023235 Ga0182008_100232352 240
196 3300014497 Ga0182008_10066578 Ga0182008_100665782 240
197 3300014745 Ga0157377_10004241 Ga0157377_100042415 240
198 3300014968 Ga0157379_10089237 Ga0157379_100892372 240
199 3300014969 Ga0157376_10000140 Ga0157376_1000014030 240
200 3300017792 Ga0163161_10277101 Ga0163161_102771012 240
201 3300020076 Ga0206355_1150189 Ga0206355_11501891 240
202 3300025261 Ga0209233_1000065 Ga0209233_1000065119 240
203 3300025284 Ga0209130_1000706 Ga0209130_100070613 240
204 3300025294 Ga0209025_1000750 Ga0209025_100075030 240
205 3300025297 Ga0209758_1006313 Ga0209758_10063138 240
206 3300025302 Ga0207426_1000336 Ga0207426_100033667 240
207 3300025315 Ga0207697_10028962 Ga0207697_100289622 240
208 3300025735 Ga0207713_1000673 Ga0207713_100067313 240
209 3300025735 Ga0207713_1007728 Ga0207713_10077283 240
210 3300025899 Ga0207642_10044275 Ga0207642_100442752 240
211 3300025900 Ga0207710_10005907 Ga0207710_100059073 240
212 3300025900 Ga0207710_10135353 Ga0207710_101353532 240
213 3300025904 Ga0207647_10001987 Ga0207647_100019875 240
214 3300025904 Ga0207647_10015909 Ga0207647_100159094 240
215 3300025907 Ga0207645_10000523 Ga0207645_1000052326 240
216 3300025909 Ga0207705_10000002 Ga0207705_10000002247 240
217 3300025909 Ga0207705_10000025 Ga0207705_1000002511 240
218 3300025911 Ga0207654_10450920 Ga0207654_104509201 240
219 3300025912 Ga0207707_10432006 Ga0207707_104320061 240
220 3300025913 Ga0207695_10024374 Ga0207695_100243746 240
221 3300025913 Ga0207695_10027218 Ga0207695_100272185 240
222 3300025913 Ga0207695_10051576 Ga0207695_100515763 240
223 3300025913 Ga0207695_10335348 Ga0207695_103353481 240
224 3300025914 Ga0207671_10001065 Ga0207671_100010655 240
225 3300025914 Ga0207671_10051462 Ga0207671_100514622 240
226 3300025915 Ga0207693_10403580 Ga0207693_104035802 240
227 3300025919 Ga0207657_10007632 Ga0207657_100076326 240
228 3300025920 Ga0207649_10051937 Ga0207649_100519373 240
229 3300025923 Ga0207681_10000005 Ga0207681_10000005154 240
230 3300025923 Ga0207681_10000261 Ga0207681_1000026131 240
231 3300025924 Ga0207694_10249229 Ga0207694_102492292 240
232 3300025924 Ga0207694_10282110 Ga0207694_102821102 240
233 3300025925 Ga0207650_10000004 Ga0207650_10000004568 240
234 3300025925 Ga0207650_10000545 Ga0207650_1000054520 240
235 3300025927 Ga0207687_10005128 Ga0207687_100051288 240
236 3300025928 Ga0207700_10165386 Ga0207700_101653862 240
237 3300025928 Ga0207700_10261626 Ga0207700_102616263 240
238 3300025931 Ga0207644_10000294 Ga0207644_1000029415 240
239 3300025931 Ga0207644_10005069 Ga0207644_100050696 240
240 3300025931 Ga0207644_10159545 Ga0207644_101595452 240
241 3300025932 Ga0207690_10002318 Ga0207690_100023183 240
242 3300025932 Ga0207690_10055331 Ga0207690_100553314 240
243 3300025933 Ga0207706_10007622 Ga0207706_100076223 240
244 3300025934 Ga0207686_10006212 Ga0207686_100062123 240
245 3300025935 Ga0207709_10000118 Ga0207709_1000011816 240
246 3300025938 Ga0207704_10000027 Ga0207704_1000002716 240
247 3300025941 Ga0207711_10000004 Ga0207711_10000004463 240
248 3300025941 Ga0207711_10005137 Ga0207711_100051376 240
249 3300025941 Ga0207711_10006059 Ga0207711_100060598 240
250 3300025942 Ga0207689_10000584 Ga0207689_100005849 240
251 3300025949 Ga0207667_10002922 Ga0207667_1000292220 240
252 3300025960 Ga0207651_10000016 Ga0207651_1000001616 240
253 3300025961 Ga0207712_10000034 Ga0207712_1000003428 240
254 3300025972 Ga0207668_10000030 Ga0207668_100000302 240
255 3300025972 Ga0207668_10004978 Ga0207668_100049784 240
256 3300025972 Ga0207668_10007717 Ga0207668_100077172 240
257 3300025972 Ga0207668_10026592 Ga0207668_100265923 240
258 3300025972 Ga0207668_10069184 Ga0207668_100691843 240
259 3300025981 Ga0207640_10036089 Ga0207640_100360893 240
260 3300025986 Ga0207658_10000002 Ga0207658_100000021280 240
261 3300025986 Ga0207658_10000434 Ga0207658_1000043429 240
262 3300025986 Ga0207658_10005601 Ga0207658_100056013 240
263 3300025986 Ga0207658_10010032 Ga0207658_100100325 240
264 3300026023 Ga0207677_10000192 Ga0207677_1000019216 240
265 3300026035 Ga0207703_10000587 Ga0207703_1000058710 240
266 3300026041 Ga0207639_10034891 Ga0207639_100348914 240
267 3300026041 Ga0207639_10125204 Ga0207639_101252042 240
268 3300026088 Ga0207641_10000010 Ga0207641_10000010114 240
269 3300026088 Ga0207641_10000199 Ga0207641_1000019967 240
270 3300026088 Ga0207641_10003708 Ga0207641_100037083 240
271 3300026088 Ga0207641_10006245 Ga0207641_100062458 240
272 3300026088 Ga0207641_10075882 Ga0207641_100758823 240
273 3300026089 Ga0207648_10000116 Ga0207648_1000011660 240
274 3300026095 Ga0207676_10000006 Ga0207676_10000006144 240
275 3300026095 Ga0207676_10000036 Ga0207676_10000036156 240
276 3300026095 Ga0207676_10037144 Ga0207676_100371443 240
277 3300026116 Ga0207674_10066042 Ga0207674_100660424 240
278 3300026116 Ga0207674_10083581 Ga0207674_100835813 240
279 3300026118 Ga0207675_100000385 Ga0207675_10000038536 240
280 3300026142 Ga0207698_10001220 Ga0207698_100012208 240
281 3300028379 Ga0268266_10000175 Ga0268266_100001755 240
282 3300028380 Ga0268265_10000001 Ga0268265_100000011034 240
283 3300028380 Ga0268265_10000059 Ga0268265_10000059109 240
284 3300028380 Ga0268265_10004576 Ga0268265_100045766 240
285 3300028380 Ga0268265_10020157 Ga0268265_100201574 240
286 3300028380 Ga0268265_10034737 Ga0268265_100347374 240
287 3300028380 Ga0268265_10272096 Ga0268265_102720962 240
288 3300028381 Ga0268264_10000101 Ga0268264_10000101150 240
289 3300028381 Ga0268264_10024380 Ga0268264_100243805 240
290 3300028573 Ga0265334_10013837 Ga0265334_100138373 240
291 3300028786 Ga0307517_10074320 Ga0307517_100743201 240
292 3300028800 Ga0265338_10029568 Ga0265338_100295683 240
293 3300031456 Ga0307513_10313091 Ga0307513_103130912 240
294 3300031548 Ga0307408_100029973 Ga0307408_1000299733 240
295 3300031711 Ga0265314_10075556 Ga0265314_100755561 240
296 3300031731 Ga0307405_10095803 Ga0307405_100958032 240
297 3300031824 Ga0307413_10213403 Ga0307413_102134032 240
298 3300031852 Ga0307410_10284212 Ga0307410_102842122 240
299 3300031903 Ga0307407_10106730 Ga0307407_101067302 240
300 3300031911 Ga0307412_10057250 Ga0307412_100572502 240
301 3300031911 Ga0307412_10130690 Ga0307412_101306903 240
302 3300031911 Ga0307412_10167191 Ga0307412_101671912 240
303 3300031995 Ga0307409_100079518 Ga0307409_1000795181 240
304 3300032002 Ga0307416_100032632 Ga0307416_1000326322 240
305 3300032002 Ga0307416_100072295 Ga0307416_1000722953 240
306 3300032004 Ga0307414_10000842 Ga0307414_100008427 240
307 3300032004 Ga0307414_10002252 Ga0307414_100022529 240
308 3300032004 Ga0307414_10074995 Ga0307414_100749951 240
309 3300032005 Ga0307411_10227859 Ga0307411_102278592 240
310 3300035113 Ga0373936_0011119 Ga0373936_0011119_261_983 240
311 3300035119 Ga0373956_0173862 Ga0373956_0173862_61_783 240
312 3300035398 Ga0316574_0495030 Ga0316574_0495030_19_741 240
313 3300035724 Ga0373933_0318855 Ga0373933_0318855_45_767 240
314 3300035724 Ga0373933_0348612 Ga0373933_0348612_38_760 240
315 3300037471 Ga0395905_0132640 Ga0395905_0132640_86_808 240
316 3300037853 Ga0436364_0602458 Ga0436364_0602458_123_845 240
317 3300038443 Ga0395901_0053106 Ga0395901_0053106_2164_2886 240
318 3300039447 Ga0436361_0977713 Ga0436361_0977713_826_1548 240
319 3300042005 Ga0439448_0032258 Ga0439448_0032258_480_1202 240
320 3300042012 Ga0439455_0034490 Ga0439455_0034490_259_981 240
321 3300042157 Ga0439458_0000048 Ga0439458_0000048_5087_5809 240
322 3300044693 Ga0466961_0031975 Ga0466961_0031975_446_1168 240
323 3300044693 Ga0466961_0052446 Ga0466961_0052446_954_1676 240
324 3300044694 Ga0466963_0012325 Ga0466963_0012325_498_1220 240
325 3300044719 Ga0466971_0001004 Ga0466971_0001004_4930_5652 240
326 3300044842 Ga0466957_0010106 Ga0466957_0010106_4187_4909 240
327 3300044842 Ga0466957_0117011 Ga0466957_0117011_274_996 240
328 3300045049 Ga0466959_0187074 Ga0466959_0187074_139_861 240
329 3300045836 Ga0466958_0000542 Ga0466958_0000542_12385_13107 240
330 3300045976 Ga0466967_0035436 Ga0466967_0035436_3248_3970 240
331 3300045976 Ga0466967_0098563 Ga0466967_0098563_633_1355 240
332 3300045976 Ga0466967_0402281 Ga0466967_0402281_524_1246 240
333 3300046477 Ga0495664_0186402 Ga0495664_0186402_70_792 240
334 3300046517 Ga0495630_0117679 Ga0495630_0117679_351_1076 240
335 3300046522 Ga0495643_0021446 Ga0495643_0021446_2130_2852 240
336 3300046529 Ga0495652_0052575 Ga0495652_0052575_2193_2915 240
337 3300046616 Ga0495668_0041791 Ga0495668_0041791_1042_1764 240
338 3300046689 Ga0495613_0003587 Ga0495613_0003587_332_1054 240
339 3300047472 Ga0495686_0000262 Ga0495686_0000262_43256_43978 240
340 3300048905 Ga0496102_0000100 Ga0496102_0000100_86633_87355 240
341 3300048905 Ga0496102_0139022 Ga0496102_0139022_1134_1856 240
342 3300048906 Ga0496103_0000070 Ga0496103_0000070_86614_87336 240
343 3300048906 Ga0496103_0013787 Ga0496103_0013787_2403_3125 240
344 3300048906 Ga0496103_0199037 Ga0496103_0199037_446_1168 240
345 3300048918 Ga0496115_0224187 Ga0496115_0224187_87_809 240
346 3300048919 Ga0496116_0000045 Ga0496116_0000045_29206_29928 240
347 3300048919 Ga0496116_0001752 Ga0496116_0001752_14729_15451 240
348 3300048920 Ga0496117_0000194 Ga0496117_0000194_86633_87355 240
349 3300048920 Ga0496117_0005305 Ga0496117_0005305_4222_4944 240
350 3300048920 Ga0496117_0010705 Ga0496117_0010705_6589_7311 240
351 3300048920 Ga0496117_0023598 Ga0496117_0023598_3605_4327 240
352 3300048921 Ga0496118_0000146 Ga0496118_0000146_86633_87355 240
353 3300048921 Ga0496118_0001200 Ga0496118_0001200_20846_21568 240
354 3300048921 Ga0496118_0004591 Ga0496118_0004591_13035_13757 240
355 3300048921 Ga0496118_0027705 Ga0496118_0027705_1981_2703 240
356 3300048921 Ga0496118_0082996 Ga0496118_0082996_1212_1934 240
357 3300048922 Ga0496119_0033374 Ga0496119_0033374_1707_2429 240
358 3300048922 Ga0496119_0036195 Ga0496119_0036195_1436_2158 240
359 3300048922 Ga0496119_0068394 Ga0496119_0068394_225_947 240
360 3300048923 Ga0496120_0148537 Ga0496120_0148537_44_766 240
361 3300048923 Ga0496120_0171386 Ga0496120_0171386_28_750 240
362 3300048924 Ga0496121_0000024 Ga0496121_0000024_71381_72103 240
363 3300048924 Ga0496121_0011369 Ga0496121_0011369_6998_7720 240
364 3300048924 Ga0496121_0028649 Ga0496121_0028649_1408_2130 240
365 3300048925 Ga0496122_0004681 Ga0496122_0004681_3244_3966 240
366 3300048925 Ga0496122_0118356 Ga0496122_0118356_275_997 240
367 3300048926 Ga0496123_0002896 Ga0496123_0002896_6440_7162 240
368 3300048926 Ga0496123_0054707 Ga0496123_0054707_1640_2362 240
369 3300048927 Ga0496124_0000185 Ga0496124_0000185_36177_36899 240
370 3300048927 Ga0496124_0006995 Ga0496124_0006995_9496_10218 240
371 3300048927 Ga0496124_0007034 Ga0496124_0007034_1544_2272 240
372 3300048927 Ga0496124_0062904 Ga0496124_0062904_1944_2666 240
373 3300048927 Ga0496124_0081232 Ga0496124_0081232_887_1609 240
374 3300048928 Ga0496125_0006050 Ga0496125_0006050_6541_7263 240
375 3300048928 Ga0496125_0069852 Ga0496125_0069852_570_1292 240
376 3300048929 Ga0496126_0000641 Ga0496126_0000641_58678_59400 240
377 3300048929 Ga0496126_0013949 Ga0496126_0013949_3628_4350 240
378 3300049530 Ga0501314_001657 Ga0501314_001657_791_1513 240
379 3300049568 Ga0501031_0213358 Ga0501031_0213358_513_1235 240
380 3300049571 Ga0501034_0145297 Ga0501034_0145297_51_773 240
381 3300049571 Ga0501034_0514441 Ga0501034_0514441_174_896 240
382 3300049572 Ga0501036_0669003 Ga0501036_0669003_117_839 240
383 3300049579 Ga0501043_0030046 Ga0501043_0030046_1811_2533 240
384 3300049581 Ga0501047_0002711 Ga0501047_0002711_10558_11280 240
385 3300049585 Ga0501069_0036930 Ga0501069_0036930_1028_1750 240
386 3300049586 Ga0501070_0141748 Ga0501070_0141748_272_994 240
387 3300049663 Ga0501223_000055 Ga0501223_000055_25135_25857 240
388 3300049663 Ga0501223_004618 Ga0501223_004618_1364_2086 240
389 3300049664 Ga0501224_000002 Ga0501224_000002_25249_25971 240
390 3300049668 Ga0501233_000660 Ga0501233_000660_2147_2869 240
391 3300049669 Ga0501235_004155 Ga0501235_004155_1510_2232 240
392 3300049686 Ga0501257_000064 Ga0501257_000064_12266_12988 240
393 3300049705 Ga0501225_0000039 Ga0501225_0000039_14676_15398 240
394 3300049707 Ga0501234_000132 Ga0501234_000132_1062_1784 240
395 3300049776 Ga0501280_000700 Ga0501280_000700_2802_3524 240
396 3300049822 Ga0501035_0379871 Ga0501035_0379871_48_770 240
397 3300049823 Ga0501044_0000338 Ga0501044_0000338_2078_2800 240
398 3300049823 Ga0501044_0137914 Ga0501044_0137914_46_768 240
399 3300049853 Ga0501226_000046 Ga0501226_000046_28664_29386 240
400 3300050516 nmdc:mga0sz30_3345_c1 nmdc:mga0sz30_3345_c1_447_1169 240
401 3300053087 Ga0500643_000033 Ga0500643_000033_74860_75582 240
402 3300053087 Ga0500643_000933 Ga0500643_000933_16155_16877 240
403 3300053116 Ga0500592_000134 Ga0500592_000134_14982_15704 240
404 3300053116 Ga0500592_000653 Ga0500592_000653_3411_4133 240
405 3300053116 Ga0500592_000869 Ga0500592_000869_1636_2358 240
406 3300053122 Ga0500608_003694 Ga0500608_003694_2270_2992 240
407 3300053133 Ga0500655_006723 Ga0500655_006723_610_1332 240
408 3300053136 Ga0500559_0001479 Ga0500559_0001479_3575_4297 240
409 3300053136 Ga0500559_0033290 Ga0500559_0033290_36_758 240
410 3300053148 Ga0500590_020369 Ga0500590_020369_543_1265 240
411 3300053158 Ga0500627_0000230 Ga0500627_0000230_5648_6370 240
412 3300053178 Ga0500637_0167800 Ga0500637_0167800_293_1018 240
413 3300053729 Ga0500625_000004 Ga0500625_000004_115318_116040 240
414 3300053730 Ga0500645_003846 Ga0500645_003846_3907_4629 240
415 3300059490 Ga0587066_010533 Ga0587066_010533_453_1175 240
416 3300059493 Ga0587077_013038 Ga0587077_013038_158_880 240
417 3300059503 Ga0587080_025466 Ga0587080_025466_123_845 240
418 3300059504 Ga0587082_005893 Ga0587082_005893_824_1546 240
419 3300059605 Ga0587106_014356 Ga0587106_014356_92_814 240
420 3300059643 Ga0587072_015040 Ga0587072_015040_155_877 240
421 3300059644 Ga0587075_012495 Ga0587075_012495_284_1006 240
422 3300059647 Ga0587079_034795 Ga0587079_034795_106_828 240
423 3300059648 Ga0587100_005045 Ga0587100_005045_87_809 240
424 3300061719 Ga0466962_0025480 Ga0466962_0025480_1842_2564 240
425 3300061719 Ga0466962_0187539 Ga0466962_0187539_80_802 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

258

0.97

PF00106

adh_short

short chain dehydrogenase

23

212

0.96

PF08659

KR

KR domain

24

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kms-assembly1.cif.gz_B-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9571 1 236
4kms-assembly1.cif.gz_A-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9557 1 236
4wk6-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9438 3 240
4wk6-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9423 3 236
4wk6-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9408 3 240
ID Description Score Start End Superfamily
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 1 236 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 1 236 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 3 238 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 2 237 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 3 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G4UGZ1-F1-model_v4 deleted 0.9539 2 237
AF-N0B6H7-F1-model_v4 Acetoacetyl-CoA reductase 0.9535 1 237 GO:0005737
GO:0018454
GO:0042619
AF-A0A6I3T1P8-F1-model_v4 Acetoacetyl-CoA reductase (EC 1.1.1.36) 0.9535 1 237 GO:0005737
GO:0018454
GO:0042619
AF-A0A6A5LF29-F1-model_v4 deleted 0.9522 1 227
AF-A0A2U8BRP6-F1-model_v4 Acetoacetyl-CoA reductase 0.9512 1 236 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.77 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map