F440901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 425 | 249 | 412 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10108315|Ga0065707_101083151 |
| Length | 260 |
| Sequence | MLTFAGFRSAKRFIHIWEKSMTRVAIVTGGTRGIGEAISLALRKMDMTVVANYAGNADKANAFTERTGIKSVKWDVSDPEACQAGVEQVEAEFGPVDVLINNAGITRDGTLMRMTYQDWKEVIDTNLGGCFNMAKATFPGMRARGWGRIVNIGSVNGQAGQYGQVNYAAAKSGIHGFTKALAQEGAKAGVTVNAIAPGYIDTEMVAGVPADVLTKIVAKVPIGRLGEVGEIARAVVFLCAEDAGFVTGSTMSLNGGQHMY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 7 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 8 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 9 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 10 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 11 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 12 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 173 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 201 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 230 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 231 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 232 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 233 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 234 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 235 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 236 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 238 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 239 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 240 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.35 |
| Metatranscriptomes | 2.59 |
| Isolates | 3.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.41 |
| Nodule | 0.47 |
| Rhizoplane | 1.88 |
| Rhizosphere | 82.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1013414 | 3300001904 | Bacteria | 1323 |
| 2 | JGI24752J21851_1001110 | 3300001976 | Bacteria | 3688 |
| 3 | JGI24739J22299_10000394 | 3300001989 | Bacteria | 15147 |
| 4 | JGI24737J22298_10018343 | 3300001990 | Bacteria | 2246 |
| 5 | JGI24735J21928_10012035 | 3300002067 | Bacteria | 2737 |
| 6 | JGI24735J21928_10039199 | 3300002067 | Bacteria | 1385 |
| 7 | JGI24738J21930_10000528 | 3300002075 | Bacteria | 10921 |
| 8 | JGI24751J29686_10000135 | 3300002459 | Bacteria | 37169 |
| 9 | JGI25151J46595_10000624 | 3300003187 | Bacteria | 30772 |
| 10 | JGI25160J50197_1015010 | 3300003354 | Bacteria | 2562 |
| 11 | Ga0065704_10075983 | 3300005289 | Bacteria | 5318 |
| 12 | Ga0065704_10083410 | 3300005289 | Bacteria | 3470 |
| 13 | Ga0065707_10081960 | 3300005295 | Bacteria | 27438 |
| 14 | Ga0065707_10085937 | 3300005295 | Bacteria | 5780 |
| 15 | Ga0065707_10108315 | 3300005295 | Bacteria | 2515 |
| 16 | Ga0070658_10000040 | 3300005327 | Bacteria | 136073 |
| 17 | Ga0070658_10005671 | 3300005327 | Bacteria | 10120 |
| 18 | Ga0070658_10205693 | 3300005327 | Bacteria | 1662 |
| 19 | Ga0070670_100000090 | 3300005331 | Bacteria | 86222 |
| 20 | Ga0070670_100000965 | 3300005331 | Bacteria | 22582 |
| 21 | Ga0070670_100049568 | 3300005331 | Bacteria | 3610 |
| 22 | Ga0068869_100000568 | 3300005334 | Bacteria | 20681 |
| 23 | Ga0070680_100543403 | 3300005336 | Bacteria | 996 |
| 24 | Ga0068868_100000133 | 3300005338 | Bacteria | 47802 |
| 25 | Ga0068868_100043658 | 3300005338 | Bacteria | 3502 |
| 26 | Ga0068868_100124338 | 3300005338 | Bacteria | 2106 |
| 27 | Ga0070660_100003719 | 3300005339 | Bacteria | 10539 |
| 28 | Ga0070660_100514408 | 3300005339 | Bacteria | 996 |
| 29 | Ga0070689_100568115 | 3300005340 | Bacteria | 979 |
| 30 | Ga0070661_100084031 | 3300005344 | Bacteria | 2352 |
| 31 | Ga0070661_100599177 | 3300005344 | Bacteria | 891 |
| 32 | Ga0070692_10016423 | 3300005345 | Bacteria | 3520 |
| 33 | Ga0070668_100000132 | 3300005347 | Bacteria | 46719 |
| 34 | Ga0070668_100001305 | 3300005347 | Bacteria | 17832 |
| 35 | Ga0070668_100002711 | 3300005347 | Bacteria | 13030 |
| 36 | Ga0070668_100016881 | 3300005347 | Bacteria | 5460 |
| 37 | Ga0070669_100000093 | 3300005353 | Bacteria | 87563 |
| 38 | Ga0070669_100001282 | 3300005353 | Bacteria | 18155 |
| 39 | Ga0070671_100001115 | 3300005355 | Bacteria | 19917 |
| 40 | Ga0070671_100004606 | 3300005355 | Bacteria | 10934 |
| 41 | Ga0070671_100191523 | 3300005355 | Bacteria | 1733 |
| 42 | Ga0070673_100000015 | 3300005364 | Bacteria | 118064 |
| 43 | Ga0070673_100042584 | 3300005364 | Bacteria | 3502 |
| 44 | Ga0070659_100003241 | 3300005366 | Bacteria | 11581 |
| 45 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 46 | Ga0070667_100002068 | 3300005367 | Bacteria | 17765 |
| 47 | Ga0070667_100004333 | 3300005367 | Bacteria | 11971 |
| 48 | Ga0070662_100006260 | 3300005457 | Bacteria | 7666 |
| 49 | Ga0070681_10377301 | 3300005458 | Bacteria | 1329 |
| 50 | Ga0068867_100000030 | 3300005459 | Bacteria | 86560 |
| 51 | Ga0068867_100044583 | 3300005459 | Bacteria | 3250 |
| 52 | Ga0070685_10542377 | 3300005466 | Bacteria | 829 |
| 53 | Ga0070698_100285428 | 3300005471 | Bacteria | 1582 |
| 54 | Ga0070679_100066157 | 3300005530 | Bacteria | 3602 |
| 55 | Ga0070679_100132326 | 3300005530 | Bacteria | 2475 |
| 56 | Ga0070679_100171015 | 3300005530 | Bacteria | 2146 |
| 57 | Ga0068853_100034401 | 3300005539 | Bacteria | 4301 |
| 58 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 59 | Ga0070665_100000685 | 3300005548 | Bacteria | 45385 |
| 60 | Ga0070665_100442522 | 3300005548 | Bacteria | 1309 |
| 61 | Ga0070704_100720814 | 3300005549 | Bacteria | 886 |
| 62 | Ga0068855_100002861 | 3300005563 | Bacteria | 21208 |
| 63 | Ga0068855_100090318 | 3300005563 | Bacteria | 3535 |
| 64 | Ga0068855_100230369 | 3300005563 | Bacteria | 2075 |
| 65 | Ga0068857_100038041 | 3300005577 | Bacteria | 4262 |
| 66 | Ga0068854_100024392 | 3300005578 | Bacteria | 4141 |
| 67 | Ga0068856_100091488 | 3300005614 | Bacteria | 3026 |
| 68 | Ga0068856_100385085 | 3300005614 | Bacteria | 1422 |
| 69 | Ga0068852_100004127 | 3300005616 | Bacteria | 10227 |
| 70 | Ga0068859_100003838 | 3300005617 | Bacteria | 15350 |
| 71 | Ga0068859_100004144 | 3300005617 | Bacteria | 14804 |
| 72 | Ga0068864_100000332 | 3300005618 | Bacteria | 41671 |
| 73 | Ga0068864_100004959 | 3300005618 | Bacteria | 10910 |
| 74 | Ga0068864_100061570 | 3300005618 | Bacteria | 3251 |
| 75 | Ga0068861_100005566 | 3300005719 | Bacteria | 8535 |
| 76 | Ga0068863_100000456 | 3300005841 | Bacteria | 41671 |
| 77 | Ga0068863_100028002 | 3300005841 | Bacteria | 5379 |
| 78 | Ga0068863_100068311 | 3300005841 | Bacteria | 3362 |
| 79 | Ga0068858_100000278 | 3300005842 | Bacteria | 55142 |
| 80 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 81 | Ga0068860_100108028 | 3300005843 | Bacteria | 2659 |
| 82 | Ga0068860_100483817 | 3300005843 | Bacteria | 1234 |
| 83 | Ga0068862_100000126 | 3300005844 | Bacteria | 89210 |
| 84 | Ga0068862_100000506 | 3300005844 | Bacteria | 41538 |
| 85 | Ga0068862_100001480 | 3300005844 | Bacteria | 21523 |
| 86 | Ga0068862_100021672 | 3300005844 | Bacteria | 5373 |
| 87 | Ga0068862_100041197 | 3300005844 | Bacteria | 3929 |
| 88 | Ga0068862_100041464 | 3300005844 | Bacteria | 3916 |
| 89 | Ga0081455_10002924 | 3300005937 | Bacteria | 20032 |
| 90 | Ga0081455_10077601 | 3300005937 | Bacteria | 2732 |
| 91 | Ga0081540_1026022 | 3300005983 | Bacteria | 3351 |
| 92 | Ga0070717_10192640 | 3300006028 | Bacteria | 1782 |
| 93 | Ga0068871_100114839 | 3300006358 | Bacteria | 2269 |
| 94 | Ga0068865_100000021 | 3300006881 | Bacteria | 103137 |
| 95 | Ga0097620_100003839 | 3300006931 | Bacteria | 15350 |
| 96 | Ga0097620_100004144 | 3300006931 | Bacteria | 14804 |
| 97 | Ga0105251_10001625 | 3300009011 | Bacteria | 19048 |
| 98 | Ga0105251_10036569 | 3300009011 | Bacteria | 2415 |
| 99 | Ga0105240_10029009 | 3300009093 | Bacteria | 7217 |
| 100 | Ga0105240_10052010 | 3300009093 | Bacteria | 5151 |
| 101 | Ga0105240_10249545 | 3300009093 | Bacteria | 2053 |
| 102 | Ga0105240_10746396 | 3300009093 | Bacteria | 1064 |
| 103 | Ga0105245_10325097 | 3300009098 | Bacteria | 1516 |
| 104 | Ga0105247_10008192 | 3300009101 | Bacteria | 6381 |
| 105 | Ga0105247_10037904 | 3300009101 | Bacteria | 2941 |
| 106 | Ga0105243_10001435 | 3300009148 | Bacteria | 20998 |
| 107 | Ga0105243_10001795 | 3300009148 | Bacteria | 18418 |
| 108 | Ga0105241_10104914 | 3300009174 | Bacteria | 2253 |
| 109 | Ga0105242_10000198 | 3300009176 | Bacteria | 46869 |
| 110 | Ga0105242_10034070 | 3300009176 | Bacteria | 4081 |
| 111 | Ga0105248_10000029 | 3300009177 | Bacteria | 223366 |
| 112 | Ga0105248_10000155 | 3300009177 | Bacteria | 79121 |
| 113 | Ga0105248_10293103 | 3300009177 | Bacteria | 1832 |
| 114 | Ga0105248_10303974 | 3300009177 | Bacteria | 1796 |
| 115 | Ga0105237_10002575 | 3300009545 | Bacteria | 22351 |
| 116 | Ga0105237_10348474 | 3300009545 | Bacteria | 1485 |
| 117 | Ga0105237_10678921 | 3300009545 | Bacteria | 1037 |
| 118 | Ga0105237_10737180 | 3300009545 | Bacteria | 992 |
| 119 | Ga0105238_10009116 | 3300009551 | Bacteria | 9931 |
| 120 | Ga0105238_10251887 | 3300009551 | Bacteria | 1744 |
| 121 | Ga0105238_10446424 | 3300009551 | Bacteria | 1290 |
| 122 | Ga0105249_10000024 | 3300009553 | Bacteria | 232947 |
| 123 | Ga0105239_10000131 | 3300010375 | Bacteria | 105796 |
| 124 | Ga0105239_10196436 | 3300010375 | Bacteria | 2259 |
| 125 | Ga0157373_10093177 | 3300013100 | Bacteria | 2122 |
| 126 | Ga0157370_10000203 | 3300013104 | Bacteria | 75249 |
| 127 | Ga0157370_10046403 | 3300013104 | Bacteria | 4166 |
| 128 | Ga0157369_10029339 | 3300013105 | Bacteria | 6079 |
| 129 | Ga0157374_10002712 | 3300013296 | Bacteria | 14884 |
| 130 | Ga0157378_10002734 | 3300013297 | Bacteria | 15710 |
| 131 | Ga0163162_10086804 | 3300013306 | Bacteria | 3207 |
| 132 | Ga0163162_10096946 | 3300013306 | Bacteria | 3037 |
| 133 | Ga0163162_10345313 | 3300013306 | Bacteria | 1621 |
| 134 | Ga0157375_10001617 | 3300013308 | Bacteria | 19361 |
| 135 | Ga0157380_10000137 | 3300014326 | Bacteria | 40923 |
| 136 | Ga0157380_10007500 | 3300014326 | Bacteria | 7747 |
| 137 | Ga0182008_10023235 | 3300014497 | Bacteria | 3169 |
| 138 | Ga0182008_10066578 | 3300014497 | Bacteria | 1773 |
| 139 | Ga0157377_10004241 | 3300014745 | Bacteria | 6564 |
| 140 | Ga0157379_10089237 | 3300014968 | Bacteria | 2765 |
| 141 | Ga0157376_10000140 | 3300014969 | Bacteria | 49314 |
| 142 | Ga0163161_10277101 | 3300017792 | Bacteria | 1314 |
| 143 | Ga0206355_1150189 | 3300020076 | Bacteria | 939 |
| 144 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 145 | Ga0209130_1000706 | 3300025284 | Bacteria | 29893 |
| 146 | Ga0209025_1000750 | 3300025294 | Bacteria | 54523 |
| 147 | Ga0209758_1006313 | 3300025297 | Bacteria | 8605 |
| 148 | Ga0207426_1000336 | 3300025302 | Bacteria | 88370 |
| 149 | Ga0207697_10028962 | 3300025315 | Bacteria | 2266 |
| 150 | Ga0207713_1000673 | 3300025735 | Bacteria | 32203 |
| 151 | Ga0207713_1007728 | 3300025735 | Bacteria | 6281 |
| 152 | Ga0207642_10044275 | 3300025899 | Bacteria | 1969 |
| 153 | Ga0207710_10005907 | 3300025900 | Bacteria | 5251 |
| 154 | Ga0207710_10135353 | 3300025900 | Bacteria | 1186 |
| 155 | Ga0207647_10001987 | 3300025904 | Bacteria | 15638 |
| 156 | Ga0207647_10015909 | 3300025904 | Bacteria | 5147 |
| 157 | Ga0207645_10000523 | 3300025907 | Bacteria | 31917 |
| 158 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 159 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 160 | Ga0207705_10001656 | 3300025909 | Bacteria | 17693 |
| 161 | Ga0207654_10450920 | 3300025911 | Bacteria | 902 |
| 162 | Ga0207707_10380545 | 3300025912 | Bacteria | 1213 |
| 163 | Ga0207707_10432006 | 3300025912 | Bacteria | 1128 |
| 164 | Ga0207695_10024374 | 3300025913 | Bacteria | 6810 |
| 165 | Ga0207695_10027218 | 3300025913 | Bacteria | 6370 |
| 166 | Ga0207695_10051576 | 3300025913 | Bacteria | 4317 |
| 167 | Ga0207695_10143665 | 3300025913 | Bacteria | 2332 |
| 168 | Ga0207695_10335348 | 3300025913 | Bacteria | 1400 |
| 169 | Ga0207671_10001065 | 3300025914 | Bacteria | 33324 |
| 170 | Ga0207671_10051462 | 3300025914 | Bacteria | 3052 |
| 171 | Ga0207671_10501666 | 3300025914 | Bacteria | 967 |
| 172 | Ga0207693_10403580 | 3300025915 | Bacteria | 1068 |
| 173 | Ga0207657_10007632 | 3300025919 | Bacteria | 11071 |
| 174 | Ga0207657_10039632 | 3300025919 | Bacteria | 4184 |
| 175 | Ga0207649_10051937 | 3300025920 | Bacteria | 2541 |
| 176 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 177 | Ga0207681_10000261 | 3300025923 | Bacteria | 40384 |
| 178 | Ga0207694_10008785 | 3300025924 | Bacteria | 7623 |
| 179 | Ga0207694_10249229 | 3300025924 | Bacteria | 1453 |
| 180 | Ga0207694_10282110 | 3300025924 | Bacteria | 1365 |
| 181 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 182 | Ga0207650_10000545 | 3300025925 | Bacteria | 30685 |
| 183 | Ga0207659_10200214 | 3300025926 | Bacteria | 1594 |
| 184 | Ga0207687_10005128 | 3300025927 | Bacteria | 8686 |
| 185 | Ga0207687_10285170 | 3300025927 | Bacteria | 1325 |
| 186 | Ga0207700_10165386 | 3300025928 | Bacteria | 1841 |
| 187 | Ga0207700_10261626 | 3300025928 | Bacteria | 1482 |
| 188 | Ga0207644_10000294 | 3300025931 | Bacteria | 32960 |
| 189 | Ga0207644_10005069 | 3300025931 | Bacteria | 8599 |
| 190 | Ga0207644_10159545 | 3300025931 | Bacteria | 1752 |
| 191 | Ga0207690_10002318 | 3300025932 | Bacteria | 11610 |
| 192 | Ga0207690_10055331 | 3300025932 | Bacteria | 2672 |
| 193 | Ga0207690_10215242 | 3300025932 | Bacteria | 1467 |
| 194 | Ga0207706_10007622 | 3300025933 | Bacteria | 10008 |
| 195 | Ga0207686_10006212 | 3300025934 | Bacteria | 6424 |
| 196 | Ga0207686_10043721 | 3300025934 | Bacteria | 2746 |
| 197 | Ga0207709_10000118 | 3300025935 | Bacteria | 122125 |
| 198 | Ga0207704_10000027 | 3300025938 | Bacteria | 122372 |
| 199 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 200 | Ga0207711_10005137 | 3300025941 | Bacteria | 11096 |
| 201 | Ga0207711_10006059 | 3300025941 | Bacteria | 10217 |
| 202 | Ga0207689_10000584 | 3300025942 | Bacteria | 34795 |
| 203 | Ga0207661_10005016 | 3300025944 | Bacteria | 9281 |
| 204 | Ga0207667_10002922 | 3300025949 | Bacteria | 21209 |
| 205 | Ga0207667_10117957 | 3300025949 | Bacteria | 2735 |
| 206 | Ga0207667_10240974 | 3300025949 | Bacteria | 1851 |
| 207 | Ga0207651_10000016 | 3300025960 | Bacteria | 122094 |
| 208 | Ga0207651_10010648 | 3300025960 | Bacteria | 5107 |
| 209 | Ga0207712_10000034 | 3300025961 | Bacteria | 202320 |
| 210 | Ga0207668_10000030 | 3300025972 | Bacteria | 122797 |
| 211 | Ga0207668_10004978 | 3300025972 | Bacteria | 7818 |
| 212 | Ga0207668_10007717 | 3300025972 | Bacteria | 6400 |
| 213 | Ga0207668_10026592 | 3300025972 | Bacteria | 3758 |
| 214 | Ga0207668_10069184 | 3300025972 | Bacteria | 2512 |
| 215 | Ga0207640_10036089 | 3300025981 | Bacteria | 3100 |
| 216 | Ga0207640_10346896 | 3300025981 | Bacteria | 1191 |
| 217 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 218 | Ga0207658_10000434 | 3300025986 | Bacteria | 39528 |
| 219 | Ga0207658_10005601 | 3300025986 | Bacteria | 8591 |
| 220 | Ga0207658_10010032 | 3300025986 | Bacteria | 6433 |
| 221 | Ga0207677_10000192 | 3300026023 | Bacteria | 49458 |
| 222 | Ga0207677_10086826 | 3300026023 | Bacteria | 2263 |
| 223 | Ga0207703_10000587 | 3300026035 | Bacteria | 37079 |
| 224 | Ga0207639_10034891 | 3300026041 | Bacteria | 3721 |
| 225 | Ga0207639_10125204 | 3300026041 | Bacteria | 2118 |
| 226 | Ga0207641_10000010 | 3300026088 | Bacteria | 402193 |
| 227 | Ga0207641_10000199 | 3300026088 | Bacteria | 81050 |
| 228 | Ga0207641_10003708 | 3300026088 | Bacteria | 13453 |
| 229 | Ga0207641_10006245 | 3300026088 | Bacteria | 10080 |
| 230 | Ga0207641_10075882 | 3300026088 | Bacteria | 2904 |
| 231 | Ga0207648_10000116 | 3300026089 | Bacteria | 77755 |
| 232 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 233 | Ga0207676_10000036 | 3300026095 | Bacteria | 198447 |
| 234 | Ga0207676_10037144 | 3300026095 | Bacteria | 3710 |
| 235 | Ga0207674_10066042 | 3300026116 | Bacteria | 3645 |
| 236 | Ga0207674_10083581 | 3300026116 | Bacteria | 3192 |
| 237 | Ga0207675_100000385 | 3300026118 | Bacteria | 42428 |
| 238 | Ga0207698_10001220 | 3300026142 | Bacteria | 15021 |
| 239 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 240 | Ga0268266_10000329 | 3300028379 | Bacteria | 74608 |
| 241 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 242 | Ga0268265_10000059 | 3300028380 | Bacteria | 152531 |
| 243 | Ga0268265_10004576 | 3300028380 | Bacteria | 9564 |
| 244 | Ga0268265_10020157 | 3300028380 | Bacteria | 4650 |
| 245 | Ga0268265_10034737 | 3300028380 | Bacteria | 3677 |
| 246 | Ga0268265_10272096 | 3300028380 | Bacteria | 1511 |
| 247 | Ga0268265_10613696 | 3300028380 | Bacteria | 1041 |
| 248 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 249 | Ga0268264_10024380 | 3300028381 | Bacteria | 4939 |
| 250 | Ga0265334_10013837 | 3300028573 | Bacteria | 3372 |
| 251 | Ga0307517_10074320 | 3300028786 | Bacteria | 2999 |
| 252 | Ga0265338_10029568 | 3300028800 | Bacteria | 5426 |
| 253 | Ga0307513_10313091 | 3300031456 | Bacteria | 1331 |
| 254 | Ga0307408_100029973 | 3300031548 | Bacteria | 3775 |
| 255 | Ga0265314_10053773 | 3300031711 | Bacteria | 2791 |
| 256 | Ga0265314_10075556 | 3300031711 | Bacteria | 2241 |
| 257 | Ga0307405_10095803 | 3300031731 | Bacteria | 1977 |
| 258 | Ga0307413_10213403 | 3300031824 | Bacteria | 1404 |
| 259 | Ga0307410_10284212 | 3300031852 | Bacteria | 1299 |
| 260 | Ga0307407_10106730 | 3300031903 | Bacteria | 1750 |
| 261 | Ga0307412_10057250 | 3300031911 | Bacteria | 2601 |
| 262 | Ga0307412_10130690 | 3300031911 | Bacteria | 1823 |
| 263 | Ga0307412_10167191 | 3300031911 | Bacteria | 1641 |
| 264 | Ga0307409_100079518 | 3300031995 | Bacteria | 2643 |
| 265 | Ga0307416_100032632 | 3300032002 | Bacteria | 3938 |
| 266 | Ga0307416_100072295 | 3300032002 | Bacteria | 2870 |
| 267 | Ga0307414_10000842 | 3300032004 | Bacteria | 15692 |
| 268 | Ga0307414_10002252 | 3300032004 | Bacteria | 10077 |
| 269 | Ga0307414_10074995 | 3300032004 | Bacteria | 2453 |
| 270 | Ga0307411_10227859 | 3300032005 | Bacteria | 1450 |
| 271 | Ga0373936_0011119 | 3300035113 | Bacteria | 3402 |
| 272 | Ga0373941_0174140 | 3300035115 | Bacteria | 804 |
| 273 | Ga0373956_0173862 | 3300035119 | Bacteria | 1017 |
| 274 | Ga0316574_0495030 | 3300035398 | Bacteria | 763 |
| 275 | Ga0373933_0318855 | 3300035724 | Bacteria | 1008 |
| 276 | Ga0373933_0348612 | 3300035724 | Bacteria | 962 |
| 277 | Ga0373937_0783953 | 3300036401 | Bacteria | 901 |
| 278 | Ga0395900_0669718 | 3300037418 | Bacteria | 973 |
| 279 | Ga0395905_0132640 | 3300037471 | Bacteria | 2343 |
| 280 | Ga0436364_0602458 | 3300037853 | Bacteria | 947 |
| 281 | Ga0395901_0008801 | 3300038443 | Bacteria | 10216 |
| 282 | Ga0395901_0053106 | 3300038443 | Bacteria | 4211 |
| 283 | Ga0395901_0168957 | 3300038443 | Bacteria | 2295 |
| 284 | Ga0436361_0977713 | 3300039447 | Bacteria | 1809 |
| 285 | Ga0436363_0120568 | 3300039450 | Bacteria | 1318 |
| 286 | Ga0439448_0032258 | 3300042005 | Bacteria | 1666 |
| 287 | Ga0439455_0034490 | 3300042012 | Bacteria | 1273 |
| 288 | Ga0439458_0000048 | 3300042157 | Bacteria | 19869 |
| 289 | Ga0466961_0031975 | 3300044693 | Bacteria | 3381 |
| 290 | Ga0466961_0052446 | 3300044693 | Bacteria | 2603 |
| 291 | Ga0466963_0012325 | 3300044694 | Bacteria | 5229 |
| 292 | Ga0466971_0001004 | 3300044719 | Bacteria | 11648 |
| 293 | Ga0466957_0010106 | 3300044842 | Bacteria | 5402 |
| 294 | Ga0466957_0117011 | 3300044842 | Bacteria | 1696 |
| 295 | Ga0466957_0335348 | 3300044842 | Bacteria | 1023 |
| 296 | Ga0466959_0187074 | 3300045049 | Bacteria | 1446 |
| 297 | Ga0451576_1184382 | 3300045051 | Bacteria | 798 |
| 298 | Ga0466958_0000542 | 3300045836 | Bacteria | 16044 |
| 299 | Ga0466967_0035436 | 3300045976 | Bacteria | 4248 |
| 300 | Ga0466967_0098563 | 3300045976 | Bacteria | 2669 |
| 301 | Ga0466967_0402281 | 3300045976 | Bacteria | 1332 |
| 302 | Ga0466967_1040647 | 3300045976 | Bacteria | 815 |
| 303 | Ga0495664_0186402 | 3300046477 | Bacteria | 1258 |
| 304 | Ga0495630_0117679 | 3300046517 | Unclassified | 2015 |
| 305 | Ga0495643_0021446 | 3300046522 | Bacteria | 3706 |
| 306 | Ga0495652_0052575 | 3300046529 | Bacteria | 3474 |
| 307 | Ga0495668_0041791 | 3300046616 | Bacteria | 2553 |
| 308 | Ga0495669_0137161 | 3300046684 | Bacteria | 1154 |
| 309 | Ga0495613_0003587 | 3300046689 | Bacteria | 11631 |
| 310 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 311 | Ga0496102_0000100 | 3300048905 | Bacteria | 123531 |
| 312 | Ga0496102_0139022 | 3300048905 | Bacteria | 2277 |
| 313 | Ga0496103_0000070 | 3300048906 | Bacteria | 121077 |
| 314 | Ga0496103_0013787 | 3300048906 | Bacteria | 4799 |
| 315 | Ga0496103_0199037 | 3300048906 | Bacteria | 1288 |
| 316 | Ga0496108_0867467 | 3300048911 | Bacteria | 776 |
| 317 | Ga0496115_0224187 | 3300048918 | Bacteria | 1551 |
| 318 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 319 | Ga0496116_0001752 | 3300048919 | Bacteria | 23645 |
| 320 | Ga0496117_0000194 | 3300048920 | Bacteria | 123531 |
| 321 | Ga0496117_0005305 | 3300048920 | Bacteria | 13633 |
| 322 | Ga0496117_0010705 | 3300048920 | Bacteria | 8297 |
| 323 | Ga0496117_0023598 | 3300048920 | Bacteria | 4895 |
| 324 | Ga0496118_0000146 | 3300048921 | Bacteria | 123531 |
| 325 | Ga0496118_0001200 | 3300048921 | Bacteria | 39881 |
| 326 | Ga0496118_0004591 | 3300048921 | Bacteria | 16240 |
| 327 | Ga0496118_0027705 | 3300048921 | Bacteria | 4788 |
| 328 | Ga0496118_0082996 | 3300048921 | Bacteria | 2242 |
| 329 | Ga0496119_0033374 | 3300048922 | Bacteria | 3412 |
| 330 | Ga0496119_0036195 | 3300048922 | Bacteria | 3225 |
| 331 | Ga0496119_0068394 | 3300048922 | Bacteria | 2091 |
| 332 | Ga0496120_0148537 | 3300048923 | Bacteria | 1180 |
| 333 | Ga0496120_0171386 | 3300048923 | Bacteria | 1073 |
| 334 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 335 | Ga0496121_0011369 | 3300048924 | Bacteria | 9895 |
| 336 | Ga0496121_0028649 | 3300048924 | Bacteria | 5179 |
| 337 | Ga0496122_0004681 | 3300048925 | Bacteria | 16797 |
| 338 | Ga0496122_0118356 | 3300048925 | Bacteria | 1717 |
| 339 | Ga0496123_0002896 | 3300048926 | Bacteria | 20095 |
| 340 | Ga0496123_0054707 | 3300048926 | Bacteria | 2625 |
| 341 | Ga0496124_0000185 | 3300048927 | Bacteria | 123531 |
| 342 | Ga0496124_0006995 | 3300048927 | Bacteria | 12093 |
| 343 | Ga0496124_0007034 | 3300048927 | Bacteria | 12052 |
| 344 | Ga0496124_0062904 | 3300048927 | Bacteria | 3103 |
| 345 | Ga0496124_0081232 | 3300048927 | Bacteria | 2665 |
| 346 | Ga0496125_0006050 | 3300048928 | Bacteria | 13227 |
| 347 | Ga0496125_0069852 | 3300048928 | Bacteria | 2752 |
| 348 | Ga0496126_0000641 | 3300048929 | Bacteria | 65115 |
| 349 | Ga0496126_0013949 | 3300048929 | Bacteria | 8151 |
| 350 | Ga0496126_0558937 | 3300048929 | Bacteria | 907 |
| 351 | Ga0501314_001657 | 3300049530 | Bacteria | 1640 |
| 352 | Ga0501031_0213358 | 3300049568 | Bacteria | 1258 |
| 353 | Ga0501033_0130415 | 3300049570 | Bacteria | 1821 |
| 354 | Ga0501033_0163326 | 3300049570 | Bacteria | 1602 |
| 355 | Ga0501034_0145297 | 3300049571 | Bacteria | 2349 |
| 356 | Ga0501034_0193996 | 3300049571 | Bacteria | 1992 |
| 357 | Ga0501034_0514441 | 3300049571 | Bacteria | 1109 |
| 358 | Ga0501036_0226032 | 3300049572 | Bacteria | 1571 |
| 359 | Ga0501036_0669003 | 3300049572 | Bacteria | 859 |
| 360 | Ga0501043_0011178 | 3300049579 | Bacteria | 7030 |
| 361 | Ga0501043_0030046 | 3300049579 | Bacteria | 4269 |
| 362 | Ga0501046_0158362 | 3300049580 | Bacteria | 1704 |
| 363 | Ga0501047_0002100 | 3300049581 | Bacteria | 19058 |
| 364 | Ga0501047_0002711 | 3300049581 | Bacteria | 16852 |
| 365 | Ga0501069_0036930 | 3300049585 | Bacteria | 2695 |
| 366 | Ga0501070_0141748 | 3300049586 | Bacteria | 1984 |
| 367 | Ga0501073_0029192 | 3300049589 | Bacteria | 3941 |
| 368 | Ga0501073_0098262 | 3300049589 | Bacteria | 2033 |
| 369 | Ga0501223_000055 | 3300049663 | Bacteria | 38140 |
| 370 | Ga0501223_004618 | 3300049663 | Bacteria | 2933 |
| 371 | Ga0501224_000002 | 3300049664 | Bacteria | 229331 |
| 372 | Ga0501233_000660 | 3300049668 | Bacteria | 5653 |
| 373 | Ga0501235_004155 | 3300049669 | Bacteria | 3136 |
| 374 | Ga0501257_000064 | 3300049686 | Bacteria | 29858 |
| 375 | Ga0501225_0000039 | 3300049705 | Bacteria | 44735 |
| 376 | Ga0501234_000132 | 3300049707 | Bacteria | 9862 |
| 377 | Ga0501080_0224295 | 3300049742 | Bacteria | 1719 |
| 378 | Ga0501280_000700 | 3300049776 | Bacteria | 7417 |
| 379 | Ga0501035_0379871 | 3300049822 | Bacteria | 1178 |
| 380 | Ga0501035_0459771 | 3300049822 | Bacteria | 1052 |
| 381 | Ga0501044_0000338 | 3300049823 | Bacteria | 59252 |
| 382 | Ga0501044_0005365 | 3300049823 | Bacteria | 14244 |
| 383 | Ga0501044_0137914 | 3300049823 | Bacteria | 2429 |
| 384 | Ga0501044_0214755 | 3300049823 | Bacteria | 1876 |
| 385 | Ga0501226_000046 | 3300049853 | Bacteria | 54629 |
| 386 | nmdc:mga0sz30_3345_c1 | 3300050516 | Bacteria | 4558 |
| 387 | Ga0500643_000033 | 3300053087 | Bacteria | 189987 |
| 388 | Ga0500643_000933 | 3300053087 | Bacteria | 18300 |
| 389 | Ga0500592_000134 | 3300053116 | Bacteria | 15761 |
| 390 | Ga0500592_000653 | 3300053116 | Bacteria | 5698 |
| 391 | Ga0500592_000869 | 3300053116 | Bacteria | 4931 |
| 392 | Ga0500608_003694 | 3300053122 | Bacteria | 5793 |
| 393 | Ga0500655_006723 | 3300053133 | Bacteria | 2069 |
| 394 | Ga0500559_0001479 | 3300053136 | Bacteria | 13261 |
| 395 | Ga0500559_0033290 | 3300053136 | Bacteria | 2218 |
| 396 | Ga0500590_020369 | 3300053148 | Bacteria | 3442 |
| 397 | Ga0500604_0076415 | 3300053151 | Bacteria | 1076 |
| 398 | Ga0500627_0000230 | 3300053158 | Bacteria | 15971 |
| 399 | Ga0500637_0167800 | 3300053178 | Bacteria | 1263 |
| 400 | Ga0500625_000004 | 3300053729 | Bacteria | 245905 |
| 401 | Ga0500645_003846 | 3300053730 | Bacteria | 5949 |
| 402 | Ga0587066_010533 | 3300059490 | Bacteria | 1335 |
| 403 | Ga0587077_013038 | 3300059493 | Bacteria | 1341 |
| 404 | Ga0587080_025466 | 3300059503 | Bacteria | 999 |
| 405 | Ga0587082_005893 | 3300059504 | Bacteria | 1612 |
| 406 | Ga0587106_014356 | 3300059605 | Bacteria | 1090 |
| 407 | Ga0587072_015040 | 3300059643 | Bacteria | 1310 |
| 408 | Ga0587075_012495 | 3300059644 | Bacteria | 1155 |
| 409 | Ga0587079_034795 | 3300059647 | Bacteria | 988 |
| 410 | Ga0587100_005045 | 3300059648 | Bacteria | 969 |
| 411 | Ga0466962_0025480 | 3300061719 | Bacteria | 2839 |
| 412 | Ga0466962_0187539 | 3300061719 | Bacteria | 1009 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10052010 | Ga0105240_100520104 | 200 |
| 2 | 3300037418 | Ga0395900_0669718 | Ga0395900_0669718_110_772 | 200 |
| 3 | 3300038443 | Ga0395901_0168957 | Ga0395901_0168957_1203_1865 | 200 |
| 4 | 3300049570 | Ga0501033_0130415 | Ga0501033_0130415_435_1142 | 213 |
| 5 | 3300049579 | Ga0501043_0011178 | Ga0501043_0011178_1321_2028 | 213 |
| 6 | 3300045051 | Ga0451576_1184382 | Ga0451576_1184382_115_759 | 214 |
| 7 | 3300025981 | Ga0207640_10346896 | Ga0207640_103468961 | 216 |
| 8 | 3300005340 | Ga0070689_100568115 | Ga0070689_1005681151 | 217 |
| 9 | 3300005563 | Ga0068855_100230369 | Ga0068855_1002303693 | 218 |
| 10 | 3300005614 | Ga0068856_100385085 | Ga0068856_1003850851 | 218 |
| 11 | 3300025949 | Ga0207667_10240974 | Ga0207667_102409741 | 218 |
| 12 | 3300039450 | Ga0436363_0120568 | Ga0436363_0120568_78_800 | 218 |
| 13 | 3300049572 | Ga0501036_0226032 | Ga0501036_0226032_228_950 | 218 |
| 14 | 3300049823 | Ga0501044_0214755 | Ga0501044_0214755_538_1260 | 218 |
| 15 | 3300036401 | Ga0373937_0783953 | Ga0373937_0783953_229_888 | 219 |
| 16 | 3300009545 | Ga0105237_10737180 | Ga0105237_107371801 | 220 |
| 17 | 3300009551 | Ga0105238_10009116 | Ga0105238_100091166 | 220 |
| 18 | 3300025913 | Ga0207695_10143665 | Ga0207695_101436651 | 220 |
| 19 | 3300025914 | Ga0207671_10501666 | Ga0207671_105016662 | 220 |
| 20 | 3300025924 | Ga0207694_10008785 | Ga0207694_100087857 | 220 |
| 21 | 3300053151 | Ga0500604_0076415 | Ga0500604_0076415_396_1058 | 220 |
| 22 | 3300013104 | Ga0157370_10046403 | Ga0157370_100464033 | 223 |
| 23 | 3300048929 | Ga0496126_0558937 | Ga0496126_0558937_188_859 | 223 |
| 24 | 3300049589 | Ga0501073_0098262 | Ga0501073_0098262_1200_1976 | 223 |
| 25 | 3300006358 | Ga0068871_100114839 | Ga0068871_1001148392 | 224 |
| 26 | 3300025927 | Ga0207687_10285170 | Ga0207687_102851702 | 224 |
| 27 | 3300005336 | Ga0070680_100543403 | Ga0070680_1005434031 | 227 |
| 28 | 3300005339 | Ga0070660_100514408 | Ga0070660_1005144081 | 227 |
| 29 | 3300005530 | Ga0070679_100132326 | Ga0070679_1001323261 | 227 |
| 30 | 3300005539 | Ga0068853_100034401 | Ga0068853_1000344012 | 227 |
| 31 | 3300005548 | Ga0070665_100000685 | Ga0070665_10000068545 | 227 |
| 32 | 3300005563 | Ga0068855_100090318 | Ga0068855_1000903181 | 227 |
| 33 | 3300009545 | Ga0105237_10348474 | Ga0105237_103484741 | 227 |
| 34 | 3300025909 | Ga0207705_10001656 | Ga0207705_100016563 | 227 |
| 35 | 3300025912 | Ga0207707_10380545 | Ga0207707_103805452 | 227 |
| 36 | 3300025919 | Ga0207657_10039632 | Ga0207657_100396322 | 227 |
| 37 | 3300025932 | Ga0207690_10215242 | Ga0207690_102152422 | 227 |
| 38 | 3300025944 | Ga0207661_10005016 | Ga0207661_1000501614 | 227 |
| 39 | 3300025949 | Ga0207667_10117957 | Ga0207667_101179571 | 227 |
| 40 | 3300028379 | Ga0268266_10000329 | Ga0268266_1000032926 | 227 |
| 41 | 3300035115 | Ga0373941_0174140 | Ga0373941_0174140_14_727 | 227 |
| 42 | 3300038443 | Ga0395901_0008801 | Ga0395901_0008801_894_1616 | 227 |
| 43 | 3300044842 | Ga0466957_0335348 | Ga0466957_0335348_153_875 | 227 |
| 44 | 3300045976 | Ga0466967_1040647 | Ga0466967_1040647_54_776 | 227 |
| 45 | 3300049570 | Ga0501033_0163326 | Ga0501033_0163326_685_1407 | 227 |
| 46 | 3300049571 | Ga0501034_0193996 | Ga0501034_0193996_608_1330 | 227 |
| 47 | 3300049589 | Ga0501073_0029192 | Ga0501073_0029192_2941_3663 | 227 |
| 48 | 3300049822 | Ga0501035_0459771 | Ga0501035_0459771_280_1002 | 227 |
| 49 | 3300049823 | Ga0501044_0005365 | Ga0501044_0005365_10957_11679 | 227 |
| 50 | 3300049580 | Ga0501046_0158362 | Ga0501046_0158362_245_967 | 228 |
| 51 | 3300049581 | Ga0501047_0002100 | Ga0501047_0002100_3900_4676 | 228 |
| 52 | 3300049742 | Ga0501080_0224295 | Ga0501080_0224295_700_1476 | 228 |
| 53 | 3300005338 | Ga0068868_100124338 | Ga0068868_1001243383 | 229 |
| 54 | 3300009093 | Ga0105240_10746396 | Ga0105240_107463961 | 229 |
| 55 | 3300009098 | Ga0105245_10325097 | Ga0105245_103250972 | 229 |
| 56 | 3300009177 | Ga0105248_10303974 | Ga0105248_103039741 | 229 |
| 57 | 3300031711 | Ga0265314_10053773 | Ga0265314_100537732 | 229 |
| 58 | 3300046684 | Ga0495669_0137161 | Ga0495669_0137161_173_895 | 229 |
| 59 | 3300005338 | Ga0068868_100043658 | Ga0068868_1000436582 | 234 |
| 60 | 3300005364 | Ga0070673_100042584 | Ga0070673_1000425843 | 234 |
| 61 | 3300005459 | Ga0068867_100044583 | Ga0068867_1000445832 | 234 |
| 62 | 3300009148 | Ga0105243_10001795 | Ga0105243_100017955 | 234 |
| 63 | 3300009176 | Ga0105242_10034070 | Ga0105242_100340703 | 234 |
| 64 | 3300025926 | Ga0207659_10200214 | Ga0207659_102002142 | 234 |
| 65 | 3300025934 | Ga0207686_10043721 | Ga0207686_100437212 | 234 |
| 66 | 3300025960 | Ga0207651_10010648 | Ga0207651_100106485 | 234 |
| 67 | 3300026023 | Ga0207677_10086826 | Ga0207677_100868262 | 234 |
| 68 | iso_pu_bacteria | 2599185359 | 2600228766 | 236 |
| 69 | iso_pu_bacteria | 2643221541 | 2643731326 | 236 |
| 70 | iso_pu_bacteria | 2643221605 | 2644038090 | 236 |
| 71 | iso_pu_bacteria | 2643221606 | 2644042346 | 236 |
| 72 | iso_pu_bacteria | 2643221671 | 2644394012 | 236 |
| 73 | iso_pu_bacteria | 2818991466 | 2819715938 | 236 |
| 74 | iso_pu_bacteria | 2842333319 | 2842339372 | 236 |
| 75 | iso_pu_bacteria | 2842333319 | 2842340837 | 236 |
| 76 | iso_pu_bacteria | 2879163058 | 2879163298 | 236 |
| 77 | iso_pu_bacteria | 2882806704 | 2882809126 | 236 |
| 78 | iso_pu_bacteria | 2883354860 | 2883359331 | 236 |
| 79 | iso_pu_bacteria | 2928526807 | 2928529980 | 236 |
| 80 | iso_pu_bacteria | 2928968154 | 2928970598 | 236 |
| 81 | 3300048911 | Ga0496108_0867467 | Ga0496108_0867467_13_726 | 237 |
| 82 | 3300005466 | Ga0070685_10542377 | Ga0070685_105423771 | 239 |
| 83 | 3300028380 | Ga0268265_10613696 | Ga0268265_106136962 | 239 |
| 84 | 3300001904 | JGI24736J21556_1013414 | JGI24736J21556_10134141 | 240 |
| 85 | 3300001976 | JGI24752J21851_1001110 | JGI24752J21851_10011103 | 240 |
| 86 | 3300001989 | JGI24739J22299_10000394 | JGI24739J22299_100003943 | 240 |
| 87 | 3300001990 | JGI24737J22298_10018343 | JGI24737J22298_100183433 | 240 |
| 88 | 3300002067 | JGI24735J21928_10012035 | JGI24735J21928_100120353 | 240 |
| 89 | 3300002067 | JGI24735J21928_10039199 | JGI24735J21928_100391991 | 240 |
| 90 | 3300002075 | JGI24738J21930_10000528 | JGI24738J21930_100005289 | 240 |
| 91 | 3300002459 | JGI24751J29686_10000135 | JGI24751J29686_1000013535 | 240 |
| 92 | 3300003187 | JGI25151J46595_10000624 | JGI25151J46595_1000062415 | 240 |
| 93 | 3300003354 | JGI25160J50197_1015010 | JGI25160J50197_10150102 | 240 |
| 94 | 3300005289 | Ga0065704_10075983 | Ga0065704_100759831 | 240 |
| 95 | 3300005289 | Ga0065704_10083410 | Ga0065704_100834103 | 240 |
| 96 | 3300005295 | Ga0065707_10081960 | Ga0065707_100819606 | 240 |
| 97 | 3300005295 | Ga0065707_10085937 | Ga0065707_100859373 | 240 |
| 98 | 3300005295 | Ga0065707_10108315 | Ga0065707_101083151 | 240 |
| 99 | 3300005327 | Ga0070658_10000040 | Ga0070658_10000040109 | 240 |
| 100 | 3300005327 | Ga0070658_10005671 | Ga0070658_100056715 | 240 |
| 101 | 3300005327 | Ga0070658_10205693 | Ga0070658_102056932 | 240 |
| 102 | 3300005331 | Ga0070670_100000090 | Ga0070670_1000000907 | 240 |
| 103 | 3300005331 | Ga0070670_100000965 | Ga0070670_1000009655 | 240 |
| 104 | 3300005331 | Ga0070670_100049568 | Ga0070670_1000495684 | 240 |
| 105 | 3300005334 | Ga0068869_100000568 | Ga0068869_10000056811 | 240 |
| 106 | 3300005338 | Ga0068868_100000133 | Ga0068868_10000013331 | 240 |
| 107 | 3300005339 | Ga0070660_100003719 | Ga0070660_1000037193 | 240 |
| 108 | 3300005344 | Ga0070661_100084031 | Ga0070661_1000840313 | 240 |
| 109 | 3300005344 | Ga0070661_100599177 | Ga0070661_1005991771 | 240 |
| 110 | 3300005345 | Ga0070692_10016423 | Ga0070692_100164232 | 240 |
| 111 | 3300005347 | Ga0070668_100000132 | Ga0070668_1000001328 | 240 |
| 112 | 3300005347 | Ga0070668_100001305 | Ga0070668_10000130514 | 240 |
| 113 | 3300005347 | Ga0070668_100002711 | Ga0070668_1000027114 | 240 |
| 114 | 3300005347 | Ga0070668_100016881 | Ga0070668_1000168812 | 240 |
| 115 | 3300005353 | Ga0070669_100000093 | Ga0070669_1000000936 | 240 |
| 116 | 3300005353 | Ga0070669_100001282 | Ga0070669_1000012828 | 240 |
| 117 | 3300005355 | Ga0070671_100001115 | Ga0070671_1000011153 | 240 |
| 118 | 3300005355 | Ga0070671_100004606 | Ga0070671_1000046066 | 240 |
| 119 | 3300005355 | Ga0070671_100191523 | Ga0070671_1001915233 | 240 |
| 120 | 3300005364 | Ga0070673_100000015 | Ga0070673_10000001512 | 240 |
| 121 | 3300005366 | Ga0070659_100003241 | Ga0070659_1000032413 | 240 |
| 122 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003379 | 240 |
| 123 | 3300005367 | Ga0070667_100002068 | Ga0070667_10000206812 | 240 |
| 124 | 3300005367 | Ga0070667_100004333 | Ga0070667_1000043333 | 240 |
| 125 | 3300005457 | Ga0070662_100006260 | Ga0070662_1000062606 | 240 |
| 126 | 3300005458 | Ga0070681_10377301 | Ga0070681_103773011 | 240 |
| 127 | 3300005459 | Ga0068867_100000030 | Ga0068867_10000003070 | 240 |
| 128 | 3300005471 | Ga0070698_100285428 | Ga0070698_1002854282 | 240 |
| 129 | 3300005530 | Ga0070679_100066157 | Ga0070679_1000661572 | 240 |
| 130 | 3300005530 | Ga0070679_100171015 | Ga0070679_1001710152 | 240 |
| 131 | 3300005548 | Ga0070665_100000079 | Ga0070665_100000079153 | 240 |
| 132 | 3300005548 | Ga0070665_100442522 | Ga0070665_1004425222 | 240 |
| 133 | 3300005549 | Ga0070704_100720814 | Ga0070704_1007208141 | 240 |
| 134 | 3300005563 | Ga0068855_100002861 | Ga0068855_10000286120 | 240 |
| 135 | 3300005577 | Ga0068857_100038041 | Ga0068857_1000380412 | 240 |
| 136 | 3300005578 | Ga0068854_100024392 | Ga0068854_1000243923 | 240 |
| 137 | 3300005614 | Ga0068856_100091488 | Ga0068856_1000914882 | 240 |
| 138 | 3300005616 | Ga0068852_100004127 | Ga0068852_1000041278 | 240 |
| 139 | 3300005617 | Ga0068859_100003838 | Ga0068859_1000038384 | 240 |
| 140 | 3300005617 | Ga0068859_100004144 | Ga0068859_10000414411 | 240 |
| 141 | 3300005618 | Ga0068864_100000332 | Ga0068864_10000033244 | 240 |
| 142 | 3300005618 | Ga0068864_100004959 | Ga0068864_1000049592 | 240 |
| 143 | 3300005618 | Ga0068864_100061570 | Ga0068864_1000615703 | 240 |
| 144 | 3300005719 | Ga0068861_100005566 | Ga0068861_1000055666 | 240 |
| 145 | 3300005841 | Ga0068863_100000456 | Ga0068863_1000004565 | 240 |
| 146 | 3300005841 | Ga0068863_100028002 | Ga0068863_1000280024 | 240 |
| 147 | 3300005841 | Ga0068863_100068311 | Ga0068863_1000683113 | 240 |
| 148 | 3300005842 | Ga0068858_100000278 | Ga0068858_10000027827 | 240 |
| 149 | 3300005843 | Ga0068860_100000045 | Ga0068860_100000045148 | 240 |
| 150 | 3300005843 | Ga0068860_100108028 | Ga0068860_1001080282 | 240 |
| 151 | 3300005843 | Ga0068860_100483817 | Ga0068860_1004838171 | 240 |
| 152 | 3300005844 | Ga0068862_100000126 | Ga0068862_10000012693 | 240 |
| 153 | 3300005844 | Ga0068862_100000506 | Ga0068862_10000050644 | 240 |
| 154 | 3300005844 | Ga0068862_100001480 | Ga0068862_1000014808 | 240 |
| 155 | 3300005844 | Ga0068862_100021672 | Ga0068862_1000216724 | 240 |
| 156 | 3300005844 | Ga0068862_100041197 | Ga0068862_1000411973 | 240 |
| 157 | 3300005844 | Ga0068862_100041464 | Ga0068862_1000414642 | 240 |
| 158 | 3300005937 | Ga0081455_10002924 | Ga0081455_100029243 | 240 |
| 159 | 3300005937 | Ga0081455_10077601 | Ga0081455_100776012 | 240 |
| 160 | 3300005983 | Ga0081540_1026022 | Ga0081540_10260223 | 240 |
| 161 | 3300006028 | Ga0070717_10192640 | Ga0070717_101926403 | 240 |
| 162 | 3300006881 | Ga0068865_100000021 | Ga0068865_10000002112 | 240 |
| 163 | 3300006931 | Ga0097620_100003839 | Ga0097620_1000038394 | 240 |
| 164 | 3300006931 | Ga0097620_100004144 | Ga0097620_1000041445 | 240 |
| 165 | 3300009011 | Ga0105251_10001625 | Ga0105251_1000162514 | 240 |
| 166 | 3300009011 | Ga0105251_10036569 | Ga0105251_100365692 | 240 |
| 167 | 3300009093 | Ga0105240_10029009 | Ga0105240_100290095 | 240 |
| 168 | 3300009093 | Ga0105240_10249545 | Ga0105240_102495452 | 240 |
| 169 | 3300009101 | Ga0105247_10008192 | Ga0105247_100081923 | 240 |
| 170 | 3300009101 | Ga0105247_10037904 | Ga0105247_100379045 | 240 |
| 171 | 3300009148 | Ga0105243_10001435 | Ga0105243_100014358 | 240 |
| 172 | 3300009174 | Ga0105241_10104914 | Ga0105241_101049143 | 240 |
| 173 | 3300009176 | Ga0105242_10000198 | Ga0105242_100001983 | 240 |
| 174 | 3300009177 | Ga0105248_10000029 | Ga0105248_1000002944 | 240 |
| 175 | 3300009177 | Ga0105248_10000155 | Ga0105248_100001554 | 240 |
| 176 | 3300009177 | Ga0105248_10293103 | Ga0105248_102931032 | 240 |
| 177 | 3300009545 | Ga0105237_10002575 | Ga0105237_100025755 | 240 |
| 178 | 3300009545 | Ga0105237_10678921 | Ga0105237_106789212 | 240 |
| 179 | 3300009551 | Ga0105238_10251887 | Ga0105238_102518871 | 240 |
| 180 | 3300009551 | Ga0105238_10446424 | Ga0105238_104464242 | 240 |
| 181 | 3300009553 | Ga0105249_10000024 | Ga0105249_1000002427 | 240 |
| 182 | 3300010375 | Ga0105239_10000131 | Ga0105239_1000013190 | 240 |
| 183 | 3300010375 | Ga0105239_10196436 | Ga0105239_101964363 | 240 |
| 184 | 3300013100 | Ga0157373_10093177 | Ga0157373_100931774 | 240 |
| 185 | 3300013104 | Ga0157370_10000203 | Ga0157370_1000020333 | 240 |
| 186 | 3300013105 | Ga0157369_10029339 | Ga0157369_100293393 | 240 |
| 187 | 3300013296 | Ga0157374_10002712 | Ga0157374_100027128 | 240 |
| 188 | 3300013297 | Ga0157378_10002734 | Ga0157378_100027349 | 240 |
| 189 | 3300013306 | Ga0163162_10086804 | Ga0163162_100868043 | 240 |
| 190 | 3300013306 | Ga0163162_10096946 | Ga0163162_100969463 | 240 |
| 191 | 3300013306 | Ga0163162_10345313 | Ga0163162_103453132 | 240 |
| 192 | 3300013308 | Ga0157375_10001617 | Ga0157375_100016174 | 240 |
| 193 | 3300014326 | Ga0157380_10000137 | Ga0157380_100001373 | 240 |
| 194 | 3300014326 | Ga0157380_10007500 | Ga0157380_100075004 | 240 |
| 195 | 3300014497 | Ga0182008_10023235 | Ga0182008_100232352 | 240 |
| 196 | 3300014497 | Ga0182008_10066578 | Ga0182008_100665782 | 240 |
| 197 | 3300014745 | Ga0157377_10004241 | Ga0157377_100042415 | 240 |
| 198 | 3300014968 | Ga0157379_10089237 | Ga0157379_100892372 | 240 |
| 199 | 3300014969 | Ga0157376_10000140 | Ga0157376_1000014030 | 240 |
| 200 | 3300017792 | Ga0163161_10277101 | Ga0163161_102771012 | 240 |
| 201 | 3300020076 | Ga0206355_1150189 | Ga0206355_11501891 | 240 |
| 202 | 3300025261 | Ga0209233_1000065 | Ga0209233_1000065119 | 240 |
| 203 | 3300025284 | Ga0209130_1000706 | Ga0209130_100070613 | 240 |
| 204 | 3300025294 | Ga0209025_1000750 | Ga0209025_100075030 | 240 |
| 205 | 3300025297 | Ga0209758_1006313 | Ga0209758_10063138 | 240 |
| 206 | 3300025302 | Ga0207426_1000336 | Ga0207426_100033667 | 240 |
| 207 | 3300025315 | Ga0207697_10028962 | Ga0207697_100289622 | 240 |
| 208 | 3300025735 | Ga0207713_1000673 | Ga0207713_100067313 | 240 |
| 209 | 3300025735 | Ga0207713_1007728 | Ga0207713_10077283 | 240 |
| 210 | 3300025899 | Ga0207642_10044275 | Ga0207642_100442752 | 240 |
| 211 | 3300025900 | Ga0207710_10005907 | Ga0207710_100059073 | 240 |
| 212 | 3300025900 | Ga0207710_10135353 | Ga0207710_101353532 | 240 |
| 213 | 3300025904 | Ga0207647_10001987 | Ga0207647_100019875 | 240 |
| 214 | 3300025904 | Ga0207647_10015909 | Ga0207647_100159094 | 240 |
| 215 | 3300025907 | Ga0207645_10000523 | Ga0207645_1000052326 | 240 |
| 216 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002247 | 240 |
| 217 | 3300025909 | Ga0207705_10000025 | Ga0207705_1000002511 | 240 |
| 218 | 3300025911 | Ga0207654_10450920 | Ga0207654_104509201 | 240 |
| 219 | 3300025912 | Ga0207707_10432006 | Ga0207707_104320061 | 240 |
| 220 | 3300025913 | Ga0207695_10024374 | Ga0207695_100243746 | 240 |
| 221 | 3300025913 | Ga0207695_10027218 | Ga0207695_100272185 | 240 |
| 222 | 3300025913 | Ga0207695_10051576 | Ga0207695_100515763 | 240 |
| 223 | 3300025913 | Ga0207695_10335348 | Ga0207695_103353481 | 240 |
| 224 | 3300025914 | Ga0207671_10001065 | Ga0207671_100010655 | 240 |
| 225 | 3300025914 | Ga0207671_10051462 | Ga0207671_100514622 | 240 |
| 226 | 3300025915 | Ga0207693_10403580 | Ga0207693_104035802 | 240 |
| 227 | 3300025919 | Ga0207657_10007632 | Ga0207657_100076326 | 240 |
| 228 | 3300025920 | Ga0207649_10051937 | Ga0207649_100519373 | 240 |
| 229 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005154 | 240 |
| 230 | 3300025923 | Ga0207681_10000261 | Ga0207681_1000026131 | 240 |
| 231 | 3300025924 | Ga0207694_10249229 | Ga0207694_102492292 | 240 |
| 232 | 3300025924 | Ga0207694_10282110 | Ga0207694_102821102 | 240 |
| 233 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004568 | 240 |
| 234 | 3300025925 | Ga0207650_10000545 | Ga0207650_1000054520 | 240 |
| 235 | 3300025927 | Ga0207687_10005128 | Ga0207687_100051288 | 240 |
| 236 | 3300025928 | Ga0207700_10165386 | Ga0207700_101653862 | 240 |
| 237 | 3300025928 | Ga0207700_10261626 | Ga0207700_102616263 | 240 |
| 238 | 3300025931 | Ga0207644_10000294 | Ga0207644_1000029415 | 240 |
| 239 | 3300025931 | Ga0207644_10005069 | Ga0207644_100050696 | 240 |
| 240 | 3300025931 | Ga0207644_10159545 | Ga0207644_101595452 | 240 |
| 241 | 3300025932 | Ga0207690_10002318 | Ga0207690_100023183 | 240 |
| 242 | 3300025932 | Ga0207690_10055331 | Ga0207690_100553314 | 240 |
| 243 | 3300025933 | Ga0207706_10007622 | Ga0207706_100076223 | 240 |
| 244 | 3300025934 | Ga0207686_10006212 | Ga0207686_100062123 | 240 |
| 245 | 3300025935 | Ga0207709_10000118 | Ga0207709_1000011816 | 240 |
| 246 | 3300025938 | Ga0207704_10000027 | Ga0207704_1000002716 | 240 |
| 247 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004463 | 240 |
| 248 | 3300025941 | Ga0207711_10005137 | Ga0207711_100051376 | 240 |
| 249 | 3300025941 | Ga0207711_10006059 | Ga0207711_100060598 | 240 |
| 250 | 3300025942 | Ga0207689_10000584 | Ga0207689_100005849 | 240 |
| 251 | 3300025949 | Ga0207667_10002922 | Ga0207667_1000292220 | 240 |
| 252 | 3300025960 | Ga0207651_10000016 | Ga0207651_1000001616 | 240 |
| 253 | 3300025961 | Ga0207712_10000034 | Ga0207712_1000003428 | 240 |
| 254 | 3300025972 | Ga0207668_10000030 | Ga0207668_100000302 | 240 |
| 255 | 3300025972 | Ga0207668_10004978 | Ga0207668_100049784 | 240 |
| 256 | 3300025972 | Ga0207668_10007717 | Ga0207668_100077172 | 240 |
| 257 | 3300025972 | Ga0207668_10026592 | Ga0207668_100265923 | 240 |
| 258 | 3300025972 | Ga0207668_10069184 | Ga0207668_100691843 | 240 |
| 259 | 3300025981 | Ga0207640_10036089 | Ga0207640_100360893 | 240 |
| 260 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021280 | 240 |
| 261 | 3300025986 | Ga0207658_10000434 | Ga0207658_1000043429 | 240 |
| 262 | 3300025986 | Ga0207658_10005601 | Ga0207658_100056013 | 240 |
| 263 | 3300025986 | Ga0207658_10010032 | Ga0207658_100100325 | 240 |
| 264 | 3300026023 | Ga0207677_10000192 | Ga0207677_1000019216 | 240 |
| 265 | 3300026035 | Ga0207703_10000587 | Ga0207703_1000058710 | 240 |
| 266 | 3300026041 | Ga0207639_10034891 | Ga0207639_100348914 | 240 |
| 267 | 3300026041 | Ga0207639_10125204 | Ga0207639_101252042 | 240 |
| 268 | 3300026088 | Ga0207641_10000010 | Ga0207641_10000010114 | 240 |
| 269 | 3300026088 | Ga0207641_10000199 | Ga0207641_1000019967 | 240 |
| 270 | 3300026088 | Ga0207641_10003708 | Ga0207641_100037083 | 240 |
| 271 | 3300026088 | Ga0207641_10006245 | Ga0207641_100062458 | 240 |
| 272 | 3300026088 | Ga0207641_10075882 | Ga0207641_100758823 | 240 |
| 273 | 3300026089 | Ga0207648_10000116 | Ga0207648_1000011660 | 240 |
| 274 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006144 | 240 |
| 275 | 3300026095 | Ga0207676_10000036 | Ga0207676_10000036156 | 240 |
| 276 | 3300026095 | Ga0207676_10037144 | Ga0207676_100371443 | 240 |
| 277 | 3300026116 | Ga0207674_10066042 | Ga0207674_100660424 | 240 |
| 278 | 3300026116 | Ga0207674_10083581 | Ga0207674_100835813 | 240 |
| 279 | 3300026118 | Ga0207675_100000385 | Ga0207675_10000038536 | 240 |
| 280 | 3300026142 | Ga0207698_10001220 | Ga0207698_100012208 | 240 |
| 281 | 3300028379 | Ga0268266_10000175 | Ga0268266_100001755 | 240 |
| 282 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011034 | 240 |
| 283 | 3300028380 | Ga0268265_10000059 | Ga0268265_10000059109 | 240 |
| 284 | 3300028380 | Ga0268265_10004576 | Ga0268265_100045766 | 240 |
| 285 | 3300028380 | Ga0268265_10020157 | Ga0268265_100201574 | 240 |
| 286 | 3300028380 | Ga0268265_10034737 | Ga0268265_100347374 | 240 |
| 287 | 3300028380 | Ga0268265_10272096 | Ga0268265_102720962 | 240 |
| 288 | 3300028381 | Ga0268264_10000101 | Ga0268264_10000101150 | 240 |
| 289 | 3300028381 | Ga0268264_10024380 | Ga0268264_100243805 | 240 |
| 290 | 3300028573 | Ga0265334_10013837 | Ga0265334_100138373 | 240 |
| 291 | 3300028786 | Ga0307517_10074320 | Ga0307517_100743201 | 240 |
| 292 | 3300028800 | Ga0265338_10029568 | Ga0265338_100295683 | 240 |
| 293 | 3300031456 | Ga0307513_10313091 | Ga0307513_103130912 | 240 |
| 294 | 3300031548 | Ga0307408_100029973 | Ga0307408_1000299733 | 240 |
| 295 | 3300031711 | Ga0265314_10075556 | Ga0265314_100755561 | 240 |
| 296 | 3300031731 | Ga0307405_10095803 | Ga0307405_100958032 | 240 |
| 297 | 3300031824 | Ga0307413_10213403 | Ga0307413_102134032 | 240 |
| 298 | 3300031852 | Ga0307410_10284212 | Ga0307410_102842122 | 240 |
| 299 | 3300031903 | Ga0307407_10106730 | Ga0307407_101067302 | 240 |
| 300 | 3300031911 | Ga0307412_10057250 | Ga0307412_100572502 | 240 |
| 301 | 3300031911 | Ga0307412_10130690 | Ga0307412_101306903 | 240 |
| 302 | 3300031911 | Ga0307412_10167191 | Ga0307412_101671912 | 240 |
| 303 | 3300031995 | Ga0307409_100079518 | Ga0307409_1000795181 | 240 |
| 304 | 3300032002 | Ga0307416_100032632 | Ga0307416_1000326322 | 240 |
| 305 | 3300032002 | Ga0307416_100072295 | Ga0307416_1000722953 | 240 |
| 306 | 3300032004 | Ga0307414_10000842 | Ga0307414_100008427 | 240 |
| 307 | 3300032004 | Ga0307414_10002252 | Ga0307414_100022529 | 240 |
| 308 | 3300032004 | Ga0307414_10074995 | Ga0307414_100749951 | 240 |
| 309 | 3300032005 | Ga0307411_10227859 | Ga0307411_102278592 | 240 |
| 310 | 3300035113 | Ga0373936_0011119 | Ga0373936_0011119_261_983 | 240 |
| 311 | 3300035119 | Ga0373956_0173862 | Ga0373956_0173862_61_783 | 240 |
| 312 | 3300035398 | Ga0316574_0495030 | Ga0316574_0495030_19_741 | 240 |
| 313 | 3300035724 | Ga0373933_0318855 | Ga0373933_0318855_45_767 | 240 |
| 314 | 3300035724 | Ga0373933_0348612 | Ga0373933_0348612_38_760 | 240 |
| 315 | 3300037471 | Ga0395905_0132640 | Ga0395905_0132640_86_808 | 240 |
| 316 | 3300037853 | Ga0436364_0602458 | Ga0436364_0602458_123_845 | 240 |
| 317 | 3300038443 | Ga0395901_0053106 | Ga0395901_0053106_2164_2886 | 240 |
| 318 | 3300039447 | Ga0436361_0977713 | Ga0436361_0977713_826_1548 | 240 |
| 319 | 3300042005 | Ga0439448_0032258 | Ga0439448_0032258_480_1202 | 240 |
| 320 | 3300042012 | Ga0439455_0034490 | Ga0439455_0034490_259_981 | 240 |
| 321 | 3300042157 | Ga0439458_0000048 | Ga0439458_0000048_5087_5809 | 240 |
| 322 | 3300044693 | Ga0466961_0031975 | Ga0466961_0031975_446_1168 | 240 |
| 323 | 3300044693 | Ga0466961_0052446 | Ga0466961_0052446_954_1676 | 240 |
| 324 | 3300044694 | Ga0466963_0012325 | Ga0466963_0012325_498_1220 | 240 |
| 325 | 3300044719 | Ga0466971_0001004 | Ga0466971_0001004_4930_5652 | 240 |
| 326 | 3300044842 | Ga0466957_0010106 | Ga0466957_0010106_4187_4909 | 240 |
| 327 | 3300044842 | Ga0466957_0117011 | Ga0466957_0117011_274_996 | 240 |
| 328 | 3300045049 | Ga0466959_0187074 | Ga0466959_0187074_139_861 | 240 |
| 329 | 3300045836 | Ga0466958_0000542 | Ga0466958_0000542_12385_13107 | 240 |
| 330 | 3300045976 | Ga0466967_0035436 | Ga0466967_0035436_3248_3970 | 240 |
| 331 | 3300045976 | Ga0466967_0098563 | Ga0466967_0098563_633_1355 | 240 |
| 332 | 3300045976 | Ga0466967_0402281 | Ga0466967_0402281_524_1246 | 240 |
| 333 | 3300046477 | Ga0495664_0186402 | Ga0495664_0186402_70_792 | 240 |
| 334 | 3300046517 | Ga0495630_0117679 | Ga0495630_0117679_351_1076 | 240 |
| 335 | 3300046522 | Ga0495643_0021446 | Ga0495643_0021446_2130_2852 | 240 |
| 336 | 3300046529 | Ga0495652_0052575 | Ga0495652_0052575_2193_2915 | 240 |
| 337 | 3300046616 | Ga0495668_0041791 | Ga0495668_0041791_1042_1764 | 240 |
| 338 | 3300046689 | Ga0495613_0003587 | Ga0495613_0003587_332_1054 | 240 |
| 339 | 3300047472 | Ga0495686_0000262 | Ga0495686_0000262_43256_43978 | 240 |
| 340 | 3300048905 | Ga0496102_0000100 | Ga0496102_0000100_86633_87355 | 240 |
| 341 | 3300048905 | Ga0496102_0139022 | Ga0496102_0139022_1134_1856 | 240 |
| 342 | 3300048906 | Ga0496103_0000070 | Ga0496103_0000070_86614_87336 | 240 |
| 343 | 3300048906 | Ga0496103_0013787 | Ga0496103_0013787_2403_3125 | 240 |
| 344 | 3300048906 | Ga0496103_0199037 | Ga0496103_0199037_446_1168 | 240 |
| 345 | 3300048918 | Ga0496115_0224187 | Ga0496115_0224187_87_809 | 240 |
| 346 | 3300048919 | Ga0496116_0000045 | Ga0496116_0000045_29206_29928 | 240 |
| 347 | 3300048919 | Ga0496116_0001752 | Ga0496116_0001752_14729_15451 | 240 |
| 348 | 3300048920 | Ga0496117_0000194 | Ga0496117_0000194_86633_87355 | 240 |
| 349 | 3300048920 | Ga0496117_0005305 | Ga0496117_0005305_4222_4944 | 240 |
| 350 | 3300048920 | Ga0496117_0010705 | Ga0496117_0010705_6589_7311 | 240 |
| 351 | 3300048920 | Ga0496117_0023598 | Ga0496117_0023598_3605_4327 | 240 |
| 352 | 3300048921 | Ga0496118_0000146 | Ga0496118_0000146_86633_87355 | 240 |
| 353 | 3300048921 | Ga0496118_0001200 | Ga0496118_0001200_20846_21568 | 240 |
| 354 | 3300048921 | Ga0496118_0004591 | Ga0496118_0004591_13035_13757 | 240 |
| 355 | 3300048921 | Ga0496118_0027705 | Ga0496118_0027705_1981_2703 | 240 |
| 356 | 3300048921 | Ga0496118_0082996 | Ga0496118_0082996_1212_1934 | 240 |
| 357 | 3300048922 | Ga0496119_0033374 | Ga0496119_0033374_1707_2429 | 240 |
| 358 | 3300048922 | Ga0496119_0036195 | Ga0496119_0036195_1436_2158 | 240 |
| 359 | 3300048922 | Ga0496119_0068394 | Ga0496119_0068394_225_947 | 240 |
| 360 | 3300048923 | Ga0496120_0148537 | Ga0496120_0148537_44_766 | 240 |
| 361 | 3300048923 | Ga0496120_0171386 | Ga0496120_0171386_28_750 | 240 |
| 362 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_71381_72103 | 240 |
| 363 | 3300048924 | Ga0496121_0011369 | Ga0496121_0011369_6998_7720 | 240 |
| 364 | 3300048924 | Ga0496121_0028649 | Ga0496121_0028649_1408_2130 | 240 |
| 365 | 3300048925 | Ga0496122_0004681 | Ga0496122_0004681_3244_3966 | 240 |
| 366 | 3300048925 | Ga0496122_0118356 | Ga0496122_0118356_275_997 | 240 |
| 367 | 3300048926 | Ga0496123_0002896 | Ga0496123_0002896_6440_7162 | 240 |
| 368 | 3300048926 | Ga0496123_0054707 | Ga0496123_0054707_1640_2362 | 240 |
| 369 | 3300048927 | Ga0496124_0000185 | Ga0496124_0000185_36177_36899 | 240 |
| 370 | 3300048927 | Ga0496124_0006995 | Ga0496124_0006995_9496_10218 | 240 |
| 371 | 3300048927 | Ga0496124_0007034 | Ga0496124_0007034_1544_2272 | 240 |
| 372 | 3300048927 | Ga0496124_0062904 | Ga0496124_0062904_1944_2666 | 240 |
| 373 | 3300048927 | Ga0496124_0081232 | Ga0496124_0081232_887_1609 | 240 |
| 374 | 3300048928 | Ga0496125_0006050 | Ga0496125_0006050_6541_7263 | 240 |
| 375 | 3300048928 | Ga0496125_0069852 | Ga0496125_0069852_570_1292 | 240 |
| 376 | 3300048929 | Ga0496126_0000641 | Ga0496126_0000641_58678_59400 | 240 |
| 377 | 3300048929 | Ga0496126_0013949 | Ga0496126_0013949_3628_4350 | 240 |
| 378 | 3300049530 | Ga0501314_001657 | Ga0501314_001657_791_1513 | 240 |
| 379 | 3300049568 | Ga0501031_0213358 | Ga0501031_0213358_513_1235 | 240 |
| 380 | 3300049571 | Ga0501034_0145297 | Ga0501034_0145297_51_773 | 240 |
| 381 | 3300049571 | Ga0501034_0514441 | Ga0501034_0514441_174_896 | 240 |
| 382 | 3300049572 | Ga0501036_0669003 | Ga0501036_0669003_117_839 | 240 |
| 383 | 3300049579 | Ga0501043_0030046 | Ga0501043_0030046_1811_2533 | 240 |
| 384 | 3300049581 | Ga0501047_0002711 | Ga0501047_0002711_10558_11280 | 240 |
| 385 | 3300049585 | Ga0501069_0036930 | Ga0501069_0036930_1028_1750 | 240 |
| 386 | 3300049586 | Ga0501070_0141748 | Ga0501070_0141748_272_994 | 240 |
| 387 | 3300049663 | Ga0501223_000055 | Ga0501223_000055_25135_25857 | 240 |
| 388 | 3300049663 | Ga0501223_004618 | Ga0501223_004618_1364_2086 | 240 |
| 389 | 3300049664 | Ga0501224_000002 | Ga0501224_000002_25249_25971 | 240 |
| 390 | 3300049668 | Ga0501233_000660 | Ga0501233_000660_2147_2869 | 240 |
| 391 | 3300049669 | Ga0501235_004155 | Ga0501235_004155_1510_2232 | 240 |
| 392 | 3300049686 | Ga0501257_000064 | Ga0501257_000064_12266_12988 | 240 |
| 393 | 3300049705 | Ga0501225_0000039 | Ga0501225_0000039_14676_15398 | 240 |
| 394 | 3300049707 | Ga0501234_000132 | Ga0501234_000132_1062_1784 | 240 |
| 395 | 3300049776 | Ga0501280_000700 | Ga0501280_000700_2802_3524 | 240 |
| 396 | 3300049822 | Ga0501035_0379871 | Ga0501035_0379871_48_770 | 240 |
| 397 | 3300049823 | Ga0501044_0000338 | Ga0501044_0000338_2078_2800 | 240 |
| 398 | 3300049823 | Ga0501044_0137914 | Ga0501044_0137914_46_768 | 240 |
| 399 | 3300049853 | Ga0501226_000046 | Ga0501226_000046_28664_29386 | 240 |
| 400 | 3300050516 | nmdc:mga0sz30_3345_c1 | nmdc:mga0sz30_3345_c1_447_1169 | 240 |
| 401 | 3300053087 | Ga0500643_000033 | Ga0500643_000033_74860_75582 | 240 |
| 402 | 3300053087 | Ga0500643_000933 | Ga0500643_000933_16155_16877 | 240 |
| 403 | 3300053116 | Ga0500592_000134 | Ga0500592_000134_14982_15704 | 240 |
| 404 | 3300053116 | Ga0500592_000653 | Ga0500592_000653_3411_4133 | 240 |
| 405 | 3300053116 | Ga0500592_000869 | Ga0500592_000869_1636_2358 | 240 |
| 406 | 3300053122 | Ga0500608_003694 | Ga0500608_003694_2270_2992 | 240 |
| 407 | 3300053133 | Ga0500655_006723 | Ga0500655_006723_610_1332 | 240 |
| 408 | 3300053136 | Ga0500559_0001479 | Ga0500559_0001479_3575_4297 | 240 |
| 409 | 3300053136 | Ga0500559_0033290 | Ga0500559_0033290_36_758 | 240 |
| 410 | 3300053148 | Ga0500590_020369 | Ga0500590_020369_543_1265 | 240 |
| 411 | 3300053158 | Ga0500627_0000230 | Ga0500627_0000230_5648_6370 | 240 |
| 412 | 3300053178 | Ga0500637_0167800 | Ga0500637_0167800_293_1018 | 240 |
| 413 | 3300053729 | Ga0500625_000004 | Ga0500625_000004_115318_116040 | 240 |
| 414 | 3300053730 | Ga0500645_003846 | Ga0500645_003846_3907_4629 | 240 |
| 415 | 3300059490 | Ga0587066_010533 | Ga0587066_010533_453_1175 | 240 |
| 416 | 3300059493 | Ga0587077_013038 | Ga0587077_013038_158_880 | 240 |
| 417 | 3300059503 | Ga0587080_025466 | Ga0587080_025466_123_845 | 240 |
| 418 | 3300059504 | Ga0587082_005893 | Ga0587082_005893_824_1546 | 240 |
| 419 | 3300059605 | Ga0587106_014356 | Ga0587106_014356_92_814 | 240 |
| 420 | 3300059643 | Ga0587072_015040 | Ga0587072_015040_155_877 | 240 |
| 421 | 3300059644 | Ga0587075_012495 | Ga0587075_012495_284_1006 | 240 |
| 422 | 3300059647 | Ga0587079_034795 | Ga0587079_034795_106_828 | 240 |
| 423 | 3300059648 | Ga0587100_005045 | Ga0587100_005045_87_809 | 240 |
| 424 | 3300061719 | Ga0466962_0025480 | Ga0466962_0025480_1842_2564 | 240 |
| 425 | 3300061719 | Ga0466962_0187539 | Ga0466962_0187539_80_802 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kms-assembly1.cif.gz_B-2 | crystal structure of acetoacetyl-coa reductase from rickettsia felis | 0.9571 | 1 | 236 |
| 4kms-assembly1.cif.gz_A-2 | crystal structure of acetoacetyl-coa reductase from rickettsia felis | 0.9557 | 1 | 236 |
| 4wk6-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9438 | 3 | 240 |
| 4wk6-assembly1.cif.gz_B | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9423 | 3 | 236 |
| 4wk6-assembly1.cif.gz_C | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9408 | 3 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kmsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 1 | 236 | 3.40.50.720 |
| 4kmsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9365 | 1 | 236 | 3.40.50.720 |
| 4rziB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9312 | 3 | 238 | 3.40.50.720 |
| 1ulsC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9296 | 2 | 237 | 3.40.50.720 |
| af_P9WGR9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9277 | 3 | 236 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G4UGZ1-F1-model_v4 | deleted | 0.9539 | 2 | 237 |
|
| AF-N0B6H7-F1-model_v4 | Acetoacetyl-CoA reductase | 0.9535 | 1 | 237 |
GO:0005737
GO:0018454 GO:0042619 |
| AF-A0A6I3T1P8-F1-model_v4 | Acetoacetyl-CoA reductase (EC 1.1.1.36) | 0.9535 | 1 | 237 |
GO:0005737
GO:0018454 GO:0042619 |
| AF-A0A6A5LF29-F1-model_v4 | deleted | 0.9522 | 1 | 227 |
|
| AF-A0A2U8BRP6-F1-model_v4 | Acetoacetyl-CoA reductase | 0.9512 | 1 | 236 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar