F440526

General Info

Members Datasets Scaffolds Average Seq Length
423 290 384 230

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000248|Ga0209676_100024847
Length 218
Sequence MSTLVSLRNITKTYQRGPEKVQVLHGIDLDIASGDFVALMGPSGSGKTTLLNLIGGLDNPSGGEISIEGERIDQMSGGQLSTWRSHHVGFVFQFYNLMPMLTAQKNVELPLLLTHLSAAQRRRADRRSHRPNELSGGQQQRVAIARAIVSDPTFLICDEPTGDLDRQSAEEILGLLQQLNREHGKTIIMVTHDPKAAEYATHTVHLDKGELADAPLAH

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
6 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
7 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
8 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
9 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
10 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
11 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
12 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
19 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
20 2919085039 Luteibacter sp. 1214 Isolate Unclassified
21 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
22 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
23 2919404418 Luteibacter sp. 3190 Isolate Unclassified
24 2919675420 Luteimonas terrae 4099 Isolate Unclassified
25 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
26 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
27 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
28 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
29 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
30 2941471342 Luteibacter sp. 621 Isolate Unclassified
31 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
32 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
33 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
34 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
35 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
36 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
37 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
179 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
210 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
219 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
290 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.13
Metatranscriptomes 1.65
Isolates 9.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.2
Nodule 0.47
Rhizoplane 2.6
Rhizosphere 63.36
Stem 0
Stem Tuber 0
Unclassified 15.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000688 3300002067 Bacteria 11988
2 JGI24738J21930_10000426 3300002075 Bacteria 11867
3 JGI25157J39369_1001047 3300002741 Bacteria 12626
4 JGI25152J39213_1002091 3300002773 Bacteria 7847
5 JGI25150J39212_1002735 3300002774 Bacteria 4293
6 JGI25153J46596_10008334 3300003215 Bacteria 4972
7 Ga0006562J51391_1030224 3300003578 Bacteria 6750
8 Ga0006562J51391_1030226 3300003578 Bacteria 4445
9 Ga0055539_1000353 3300003752 Bacteria 20222
10 Ga0055539_1003201 3300003752 Bacteria 2325
11 Ga0055533_1000011 3300003756 Bacteria 467893
12 Ga0055533_1003406 3300003756 Bacteria 3208
13 Ga0055533_1010271 3300003756 Bacteria 1069
14 Ga0055525_1000055 3300003759 Bacteria 215181
15 Ga0055525_1000845 3300003759 Bacteria 9102
16 Ga0055527_1000137 3300003760 Bacteria 52010
17 Ga0055527_1000145 3300003760 Bacteria 50249
18 Ga0055535_1000112 3300003761 Bacteria 87296
19 Ga0055535_1000301 3300003761 Bacteria 50253
20 Ga0055535_1000656 3300003761 Bacteria 27405
21 Ga0055542_1000154 3300003762 Bacteria 87295
22 Ga0055542_1000279 3300003762 Bacteria 57233
23 Ga0055542_1000332 3300003762 Bacteria 50253
24 Ga0055529_1000244 3300003763 Bacteria 66990
25 Ga0055529_1000389 3300003763 Bacteria 47286
26 Ga0055526_1006034 3300003771 Bacteria 6717
27 Ga0055536_1000126 3300003781 Bacteria 65482
28 Ga0055536_1001596 3300003781 Bacteria 13547
29 Ga0055530_10000132 3300003791 Bacteria 65482
30 Ga0055531_10000296 3300003794 Bacteria 49725
31 Ga0058692_1000005 3300003856 Bacteria 398815
32 Ga0065165_1000913 3300005262 Bacteria 38106
33 Ga0065707_10081942 3300005295 Bacteria 28468
34 Ga0070658_10008464 3300005327 Bacteria 8274
35 Ga0070658_10013977 3300005327 Bacteria 6445
36 Ga0068869_100233234 3300005334 Bacteria 1463
37 Ga0068868_100069689 3300005338 Bacteria 2803
38 Ga0070660_100041900 3300005339 Bacteria 3492
39 Ga0070660_100123475 3300005339 Bacteria 2068
40 Ga0070668_100037451 3300005347 Bacteria 3704
41 Ga0070675_100179864 3300005354 Bacteria 1828
42 Ga0070675_100520030 3300005354 Bacteria 1074
43 Ga0070671_100087908 3300005355 Bacteria 2601
44 Ga0070671_100297360 3300005355 Bacteria 1374
45 Ga0070659_100017323 3300005366 Bacteria 5419
46 Ga0070659_100170958 3300005366 Bacteria 1780
47 Ga0070667_100000011 3300005367 Bacteria 269772
48 Ga0070667_100607601 3300005367 Bacteria 1008
49 Ga0070713_100226778 3300005436 Bacteria 1697
50 Ga0070711_100002966 3300005439 Bacteria 9793
51 Ga0070663_100020804 3300005455 Bacteria 4349
52 Ga0068867_100300574 3300005459 Bacteria 1323
53 Ga0068853_100001130 3300005539 Bacteria 18915
54 Ga0070693_100346853 3300005547 Bacteria 1015
55 Ga0070665_100017522 3300005548 Bacteria 7192
56 Ga0070665_100046608 3300005548 Bacteria 4353
57 Ga0070665_100980570 3300005548 Bacteria 857
58 Ga0068855_100016092 3300005563 Bacteria 8995
59 Ga0068855_100062851 3300005563 Bacteria 4334
60 Ga0068855_100084433 3300005563 Bacteria 3676
61 Ga0068855_100103024 3300005563 Bacteria 3284
62 Ga0068856_100004925 3300005614 Bacteria 13219
63 Ga0068856_100393958 3300005614 Bacteria 1405
64 Ga0068852_100115729 3300005616 Bacteria 2445
65 Ga0068863_100032164 3300005841 Bacteria 5001
66 Ga0068863_100040304 3300005841 Bacteria 4441
67 Ga0068863_100103892 3300005841 Bacteria 2703
68 Ga0068860_100224448 3300005843 Bacteria 1825
69 Ga0068862_100055919 3300005844 Bacteria 3380
70 Ga0081455_10000494 3300005937 Bacteria 51140
71 Ga0081539_10000055 3300005985 Bacteria 257359
72 Ga0081539_10015515 3300005985 Bacteria 5529
73 Ga0075364_10031922 3300006051 Bacteria 3383
74 Ga0075364_10059492 3300006051 Bacteria 2504
75 Ga0070712_100143525 3300006175 Bacteria 1825
76 Ga0075369_10077472 3300006186 Bacteria 1470
77 Ga0075370_10035154 3300006353 Bacteria 2812
78 Ga0068871_100085744 3300006358 Bacteria 2616
79 Ga0075428_100123671 3300006844 Bacteria 2816
80 Ga0075429_100208513 3300006880 Bacteria 1712
81 Ga0075429_100213663 3300006880 Bacteria 1690
82 Ga0099794_10084849 3300007265 Bacteria 1566
83 Ga0099795_10006102 3300007788 Bacteria 3261
84 Ga0105244_10043669 3300009036 Bacteria 2311
85 Ga0105250_10023366 3300009092 Bacteria 2490
86 Ga0105240_10008496 3300009093 Bacteria 14685
87 Ga0105240_10023924 3300009093 Bacteria 8069
88 Ga0105240_10050022 3300009093 Bacteria 5271
89 Ga0105240_10078277 3300009093 Bacteria 4071
90 Ga0105240_10196940 3300009093 Bacteria 2364
91 Ga0111539_10121968 3300009094 Bacteria 3054
92 Ga0105248_10020266 3300009177 Bacteria 7368
93 Ga0105248_11030088 3300009177 Bacteria 930
94 Ga0105237_10199372 3300009545 Bacteria 2001
95 Ga0105238_10183543 3300009551 Bacteria 2069
96 Ga0105249_10045465 3300009553 Bacteria 3993
97 Ga0105249_10064634 3300009553 Bacteria 3364
98 Ga0105249_10223163 3300009553 Bacteria 1855
99 Ga0105239_10006011 3300010375 Bacteria 14120
100 Ga0105239_10009641 3300010375 Bacteria 10860
101 Ga0105239_10020796 3300010375 Bacteria 7241
102 Ga0105239_10351587 3300010375 Bacteria 1664
103 Ga0157315_1003300 3300012508 Bacteria 1077
104 Ga0157373_10002328 3300013100 Bacteria 14407
105 Ga0157370_10000045 3300013104 Bacteria 127627
106 Ga0157370_10000414 3300013104 Bacteria 53923
107 Ga0157370_10005004 3300013104 Bacteria 14994
108 Ga0157370_10013551 3300013104 Bacteria 8392
109 Ga0157370_10021424 3300013104 Bacteria 6441
110 Ga0157370_10091842 3300013104 Bacteria 2850
111 Ga0157369_10001321 3300013105 Bacteria 30731
112 Ga0157369_10006093 3300013105 Bacteria 13998
113 Ga0157369_10006716 3300013105 Bacteria 13275
114 Ga0157369_10084798 3300013105 Bacteria 3385
115 Ga0157374_10000139 3300013296 Bacteria 65427
116 Ga0157378_10089011 3300013297 Bacteria 2803
117 Ga0157372_10083723 3300013307 Bacteria 3614
118 Ga0157372_10820897 3300013307 Bacteria 1080
119 Ga0163163_10049740 3300014325 Bacteria 4126
120 Ga0182008_10026119 3300014497 Bacteria 2962
121 Ga0182008_10052770 3300014497 Bacteria 2014
122 Ga0182008_10068194 3300014497 Bacteria 1750
123 Ga0157379_10192046 3300014968 Bacteria 1845
124 Ga0182006_1083378 3300015261 Bacteria 1163
125 Ga0182005_1000113 3300015265 Bacteria 58004
126 Ga0182005_1077191 3300015265 Bacteria 918
127 Ga0206356_11052409 3300020070 Bacteria 1049
128 Ga0206353_11764899 3300020082 Bacteria 2067
129 Ga0224712_10000435 3300022467 Bacteria 8295
130 Ga0209566_111243 3300025225 Bacteria 881
131 Ga0209674_100003 3300025226 Bacteria 2196646
132 Ga0209674_100077 3300025226 Bacteria 206312
133 Ga0209674_100556 3300025226 Bacteria 14827
134 Ga0209672_100004 3300025228 Bacteria 1467504
135 Ga0209672_100022 3300025228 Bacteria 374313
136 Ga0209672_100817 3300025228 Bacteria 14658
137 Ga0209563_100010 3300025230 Bacteria 1337457
138 Ga0209563_100076 3300025230 Bacteria 215269
139 Ga0207427_102846 3300025231 Bacteria 4179
140 Ga0209258_100003 3300025242 Bacteria 1467504
141 Ga0209258_100004 3300025242 Bacteria 1376422
142 Ga0209258_100158 3300025242 Bacteria 156881
143 Ga0207425_1000168 3300025245 Bacteria 55214
144 Ga0209026_1000087 3300025250 Bacteria 184044
145 Ga0209677_100044 3300025253 Bacteria 215799
146 Ga0209677_103496 3300025253 Bacteria 5049
147 Ga0209148_1000025 3300025254 Bacteria 663262
148 Ga0209148_1000083 3300025254 Bacteria 270142
149 Ga0209148_1000362 3300025254 Bacteria 57285
150 Ga0209759_1000503 3300025256 Bacteria 42712
151 Ga0209759_1005936 3300025256 Bacteria 4172
152 Ga0209129_1000215 3300025258 Bacteria 66656
153 Ga0209129_1000697 3300025258 Bacteria 22024
154 Ga0209455_1000004 3300025272 Bacteria 1467504
155 Ga0209455_1000084 3300025272 Bacteria 253164
156 Ga0209455_1002956 3300025272 Bacteria 6248
157 Ga0209673_1010977 3300025273 Bacteria 3775
158 Ga0209676_1000011 3300025292 Bacteria 860463
159 Ga0209676_1000248 3300025292 Bacteria 115456
160 Ga0209564_1000057 3300025295 Bacteria 340400
161 Ga0209758_1000174 3300025297 Bacteria 147347
162 Ga0209758_1005359 3300025297 Bacteria 9945
163 Ga0209050_1000032 3300025298 Bacteria 456335
164 Ga0209050_1033906 3300025298 Bacteria 1539
165 Ga0207426_1023974 3300025302 Bacteria 2076
166 Ga0209051_1000382 3300025303 Bacteria 62931
167 Ga0209051_1004509 3300025303 Bacteria 8546
168 Ga0209051_1028908 3300025303 Bacteria 2180
169 Ga0209257_1000014 3300025304 Bacteria 946850
170 Ga0209257_1000147 3300025304 Bacteria 194105
171 Ga0207655_1079326 3300025728 Bacteria 1190
172 Ga0207680_10361100 3300025903 Bacteria 1021
173 Ga0207647_10000015 3300025904 Bacteria 138626
174 Ga0207647_10000987 3300025904 Bacteria 22063
175 Ga0207705_10005083 3300025909 Bacteria 9861
176 Ga0207705_10010381 3300025909 Bacteria 6773
177 Ga0207695_10075092 3300025913 Bacteria 3440
178 Ga0207695_10079435 3300025913 Bacteria 3325
179 Ga0207663_10004170 3300025916 Bacteria 7162
180 Ga0207657_10002768 3300025919 Bacteria 18875
181 Ga0207657_10639184 3300025919 Bacteria 829
182 Ga0207652_10148367 3300025921 Bacteria 2099
183 Ga0207650_10095678 3300025925 Bacteria 2277
184 Ga0207659_10200384 3300025926 Bacteria 1594
185 Ga0207659_10463508 3300025926 Bacteria 1069
186 Ga0207644_10099281 3300025931 Bacteria 2184
187 Ga0207690_10050289 3300025932 Bacteria 2782
188 Ga0207691_10187989 3300025940 Bacteria 1803
189 Ga0207689_10393869 3300025942 Bacteria 1154
190 Ga0207689_10589486 3300025942 Bacteria 935
191 Ga0207679_10097219 3300025945 Bacteria 2293
192 Ga0207667_10007773 3300025949 Bacteria 12818
193 Ga0207667_10009556 3300025949 Bacteria 11412
194 Ga0207667_10014879 3300025949 Bacteria 8849
195 Ga0207667_10154287 3300025949 Bacteria 2363
196 Ga0207651_10021204 3300025960 Bacteria 3943
197 Ga0207651_10406943 3300025960 Bacteria 1159
198 Ga0207712_10057520 3300025961 Bacteria 2744
199 Ga0207712_10077885 3300025961 Bacteria 2404
200 Ga0207712_10161895 3300025961 Bacteria 1740
201 Ga0207712_10211356 3300025961 Bacteria 1545
202 Ga0207668_10002794 3300025972 Bacteria 10202
203 Ga0207658_10000046 3300025986 Bacteria 130772
204 Ga0207658_10202625 3300025986 Bacteria 1658
205 Ga0207703_10804893 3300026035 Bacteria 897
206 Ga0207639_10001429 3300026041 Bacteria 16142
207 Ga0207639_10006186 3300026041 Bacteria 8130
208 Ga0207678_10074092 3300026067 Bacteria 2917
209 Ga0207678_10205041 3300026067 Bacteria 1686
210 Ga0207702_10209941 3300026078 Bacteria 1810
211 Ga0207641_10007559 3300026088 Bacteria 9039
212 Ga0207641_10009763 3300026088 Bacteria 7904
213 Ga0207641_10951150 3300026088 Bacteria 854
214 Ga0207648_10246617 3300026089 Bacteria 1592
215 Ga0207674_10276900 3300026116 Bacteria 1626
216 Ga0207675_100062666 3300026118 Bacteria 3474
217 Ga0209371_1000031 3300027312 Bacteria 399263
218 Ga0209984_1012384 3300027424 Bacteria 1112
219 Ga0209995_1028887 3300027471 Bacteria 926
220 Ga0209999_1000340 3300027543 Bacteria 7033
221 Ga0209982_1010234 3300027552 Bacteria 1389
222 Ga0209971_1001679 3300027682 Bacteria 5473
223 Ga0209974_10020661 3300027876 Bacteria 2182
224 Ga0265356_1001733 3300028017 Bacteria 3111
225 Ga0268266_10035205 3300028379 Bacteria 4259
226 Ga0268266_10068238 3300028379 Bacteria 3078
227 Ga0268266_10235666 3300028379 Bacteria 1687
228 Ga0268265_10311169 3300028380 Bacteria 1422
229 Ga0307515_10030444 3300028794 Bacteria 9061
230 Ga0265338_10030722 3300028800 Bacteria 5283
231 Ga0265338_10537609 3300028800 Bacteria 819
232 Ga0268256_1000034 3300030500 Bacteria 398909
233 Ga0316177_1026408 3300030731 Bacteria 3621
234 Ga0265770_1000095 3300030878 Bacteria 10105
235 Ga0265760_10000864 3300031090 Bacteria 8770
236 Ga0265339_10175929 3300031249 Bacteria 1068
237 Ga0265327_10000574 3300031251 Bacteria 62215
238 Ga0307513_10261017 3300031456 Bacteria 1522
239 Ga0307513_10342178 3300031456 Bacteria 1246
240 Ga0307509_10053951 3300031507 Bacteria 4281
241 Ga0307509_10088696 3300031507 Bacteria 3174
242 Ga0307509_10109579 3300031507 Bacteria 2770
243 Ga0265313_10028339 3300031595 Bacteria 2913
244 Ga0307508_10001558 3300031616 Bacteria 25672
245 Ga0307508_10002562 3300031616 Bacteria 19130
246 Ga0307514_10160368 3300031649 Bacteria 1490
247 Ga0316576_10052369 3300031727 Bacteria 2973
248 Ga0316576_10065563 3300031727 Bacteria 2669
249 Ga0307413_10278610 3300031824 Bacteria 1256
250 Ga0307412_10006311 3300031911 Bacteria 6695
251 Ga0307412_10214411 3300031911 Bacteria 1471
252 Ga0307414_10049277 3300032004 Bacteria 2911
253 Ga0307507_10096462 3300033179 Bacteria 2501
254 Ga0307510_10114203 3300033180 Bacteria 2430
255 Ga0307510_10169986 3300033180 Bacteria 1760
256 Ga0373939_0052136 3300035114 Bacteria 1274
257 Ga0316574_0006413 3300035398 Bacteria 6360
258 Ga0316574_0234010 3300035398 Bacteria 1175
259 Ga0373927_0311128 3300035695 Bacteria 1037
260 Ga0373933_0444606 3300035724 Bacteria 848
261 Ga0373947_0412821 3300035725 Bacteria 912
262 Ga0395899_0000106 3300037312 Bacteria 144668
263 Ga0395900_0000049 3300037418 Bacteria 226847
264 Ga0395898_0000110 3300037466 Bacteria 217100
265 Ga0395898_0000726 3300037466 Bacteria 57933
266 Ga0395898_0008275 3300037466 Bacteria 11001
267 Ga0395898_0938057 3300037466 Bacteria 803
268 Ga0395905_0029445 3300037471 Bacteria 5173
269 Ga0395901_0060307 3300038443 Bacteria 3947
270 Ga0395901_0196920 3300038443 Bacteria 2112
271 Ga0395901_0395675 3300038443 Bacteria 1420
272 Ga0436365_1076027 3300039437 Bacteria 2135
273 Ga0439436_0000007 3300041404 Bacteria 120812
274 Ga0439465_0001319 3300041413 Bacteria 7985
275 Ga0439465_0009790 3300041413 Bacteria 3019
276 Ga0451802_0710763 3300041460 Bacteria 4619
277 Ga0451843_0266507 3300041509 Bacteria 1585
278 Ga0439433_0064477 3300041999 Bacteria 877
279 Ga0439445_0006506 3300042004 Bacteria 2687
280 Ga0439448_0000884 3300042005 Bacteria 7352
281 Ga0439432_057623 3300042006 Bacteria 1202
282 Ga0439449_0006535 3300042007 Bacteria 4455
283 Ga0439449_0011093 3300042007 Bacteria 3396
284 Ga0450908_000033 3300042184 Bacteria 31285
285 Ga0439459_0000741 3300042438 Bacteria 4470
286 Ga0466969_0010569 3300044656 Bacteria 4891
287 Ga0466969_0048988 3300044656 Bacteria 2086
288 Ga0466972_0066913 3300044658 Bacteria 1717
289 Ga0466973_0041286 3300044659 Bacteria 4343
290 Ga0466982_0000083 3300044672 Bacteria 24784
291 Ga0466965_0001580 3300044683 Bacteria 9296
292 Ga0466966_0004499 3300044684 Bacteria 9196
293 Ga0466966_0089074 3300044684 Bacteria 1917
294 Ga0466961_0006166 3300044693 Bacteria 7610
295 Ga0466961_0008647 3300044693 Bacteria 6489
296 Ga0466963_0003669 3300044694 Bacteria 8833
297 Ga0453684_0077344 3300044712 Bacteria 4172
298 Ga0466970_0008744 3300044765 Bacteria 5102
299 Ga0466957_0004185 3300044842 Bacteria 7995
300 Ga0466960_0220089 3300044901 Bacteria 1044
301 Ga0466959_0000022 3300045049 Bacteria 125849
302 Ga0466959_0021834 3300045049 Bacteria 4725
303 Ga0466959_0048408 3300045049 Bacteria 3123
304 Ga0466958_0091081 3300045836 Bacteria 1887
305 Ga0466958_0107081 3300045836 Bacteria 1743
306 Ga0495638_0112687 3300046460 Bacteria 1614
307 Ga0495650_0015578 3300046471 Bacteria 3893
308 Ga0495607_0000061 3300046501 Bacteria 108427
309 Ga0495610_0000944 3300046512 Bacteria 26960
310 Ga0495616_0145263 3300046513 Bacteria 1077
311 Ga0495663_0000696 3300046525 Bacteria 11574
312 Ga0495656_0003555 3300046615 Bacteria 5278
313 Ga0495658_0319593 3300046683 Bacteria 984
314 Ga0495670_0000482 3300046691 Bacteria 18898
315 Ga0495649_0020759 3300046694 Bacteria 3681
316 Ga0495636_0004489 3300047318 Bacteria 5470
317 Ga0495681_0066314 3300047470 Bacteria 1648
318 Ga0496101_0274131 3300048904 Bacteria 1317
319 Ga0496104_0010693 3300048907 Bacteria 8204
320 Ga0496105_0002496 3300048908 Bacteria 13337
321 Ga0496107_0157471 3300048910 Bacteria 1682
322 Ga0496108_0125251 3300048911 Bacteria 2205
323 Ga0496108_0214614 3300048911 Bacteria 1671
324 Ga0496109_0036863 3300048912 Bacteria 4415
325 Ga0496114_0036165 3300048917 Bacteria 4081
326 Ga0496114_0498355 3300048917 Bacteria 1077
327 Ga0496115_0199593 3300048918 Bacteria 1652
328 Ga0496116_0098436 3300048919 Bacteria 1755
329 Ga0496117_0017770 3300048920 Bacteria 5927
330 Ga0496117_0038495 3300048920 Bacteria 3544
331 Ga0496118_0001013 3300048921 Bacteria 43722
332 Ga0496118_0012009 3300048921 Bacteria 8369
333 Ga0496121_0000109 3300048924 Bacteria 187307
334 Ga0496122_0000133 3300048925 Bacteria 171945
335 Ga0496122_0009488 3300048925 Bacteria 10244
336 Ga0496122_0051408 3300048925 Bacteria 3131
337 Ga0496123_0000199 3300048926 Bacteria 122489
338 Ga0496123_0011106 3300048926 Bacteria 7854
339 Ga0496123_0021372 3300048926 Bacteria 5032
340 Ga0496123_0027019 3300048926 Bacteria 4284
341 Ga0496124_0016949 3300048927 Bacteria 6899
342 Ga0496124_0019749 3300048927 Bacteria 6257
343 Ga0496124_0195061 3300048927 Bacteria 1546
344 Ga0496125_0007510 3300048928 Bacteria 11587
345 Ga0496125_0008720 3300048928 Bacteria 10550
346 Ga0496126_0007774 3300048929 Bacteria 11684
347 Ga0501032_0002036 3300049569 Bacteria 15952
348 Ga0501033_0022383 3300049570 Bacteria 4767
349 Ga0501034_0001904 3300049571 Bacteria 26429
350 Ga0501034_0003143 3300049571 Bacteria 18996
351 Ga0501036_0082697 3300049572 Bacteria 2714
352 Ga0501037_0000948 3300049573 Bacteria 21559
353 Ga0501038_0000712 3300049574 Bacteria 29729
354 Ga0501039_0007044 3300049575 Bacteria 8558
355 Ga0501043_0014565 3300049579 Bacteria 6157
356 Ga0501043_0025027 3300049579 Bacteria 4683
357 Ga0501046_0017496 3300049580 Bacteria 5979
358 Ga0501046_0022598 3300049580 Bacteria 5181
359 Ga0501047_0000492 3300049581 Bacteria 42926
360 Ga0501047_0125982 3300049581 Bacteria 2441
361 Ga0501070_0006453 3300049586 Bacteria 9986
362 Ga0501073_0023067 3300049589 Bacteria 4474
363 Ga0501074_0028997 3300049590 Bacteria 4009
364 Ga0501080_0000381 3300049742 Bacteria 34167
365 Ga0501080_0013444 3300049742 Bacteria 7530
366 Ga0501035_0001396 3300049822 Bacteria 24796
367 Ga0501035_0022978 3300049822 Bacteria 5724
368 Ga0501044_0076097 3300049823 Bacteria 3407
369 nmdc:mga0k408_167779_c1 3300050493 Bacteria 1308
370 nmdc:mga07m45_176973_c1 3300050496 Bacteria 1240
371 nmdc:mga09592_207554_c1 3300050508 Bacteria 1697
372 nmdc:mga09592_468436_c1 3300050508 Bacteria 1086
373 nmdc:mga06r32_132736_c1 3300050510 Bacteria 2463
374 Ga0500647_0033782 3300053091 Bacteria 2441
375 Ga0500583_0255843 3300053092 Bacteria 864
376 Ga0500556_0000655 3300053104 Bacteria 21604
377 Ga0500608_079178 3300053122 Bacteria 1553
378 Ga0500614_066609 3300053123 Bacteria 980
379 Ga0500568_0001853 3300053139 Bacteria 13012
380 Ga0500588_0003025 3300053146 Bacteria 3507
381 Ga0501084_0282121 3300054114 Bacteria 1403
382 Ga0501082_0613610 3300060353 Bacteria 952
383 Ga0466962_0018179 3300061719 Bacteria 3381
384 Ga0466962_0168925 3300061719 Bacteria 1065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1001596 Ga0055536_10015964 218
2 3300025292 Ga0209676_1000248 Ga0209676_100024847 218
3 iso_pu_bacteria 2818991440 2819566288 223
4 iso_pu_bacteria 2904463128 2904466564 223
5 iso_pu_bacteria 2593339238 2595447737 224
6 iso_pu_bacteria 2593339239 2595450298 224
7 iso_pu_bacteria 2842914999 2842917094 224
8 iso_pu_bacteria 2842918807 2842920651 224
9 iso_pu_bacteria 2919085039 2919086181 224
10 iso_pu_bacteria 2919404418 2919406844 224
11 iso_pu_bacteria 2941471342 2941471934 224
12 iso_pu_bacteria 2953994433 2953995930 224
13 iso_pu_bacteria 2987605356 2987605629 224
14 iso_pu_bacteria 2547132130 2547503307 225
15 iso_pu_bacteria 2576861471 2578460046 225
16 iso_pu_bacteria 2747842428 2747948393 225
17 iso_pu_bacteria 2765235840 2765577244 225
18 iso_pu_bacteria 2816332141 2816519886 225
19 iso_pu_bacteria 2842391507 2842394691 225
20 iso_pu_bacteria 2842757796 2842760848 225
21 iso_pu_bacteria 2852649853 2852652599 225
22 iso_pu_bacteria 2857442823 2857445628 225
23 iso_pu_bacteria 2874220319 2874223842 225
24 iso_pu_bacteria 2919089067 2919090236 225
25 iso_pu_bacteria 2919134579 2919138388 225
26 iso_pu_bacteria 2919675420 2919677586 225
27 iso_pu_bacteria 2928496128 2928498186 225
28 iso_pu_bacteria 2931380184 2931382467 225
29 iso_pu_bacteria 2937610967 2937613685 225
30 iso_pu_bacteria 2939622612 2939626279 225
31 iso_pu_bacteria 2939626828 2939627866 225
32 iso_pu_bacteria 2941475908 2941479603 225
33 iso_pu_bacteria 2961047084 2961050606 225
34 iso_pu_bacteria 2961064222 2961068161 225
35 iso_pu_bacteria 2585428057 2587729230 226
36 iso_pu_bacteria 2894414249 2894414267 226
37 iso_pu_bacteria 2941489479 2941494456 226
38 iso_pu_bacteria 2995948881 2995949642 226
39 iso_pu_bacteria 8002869464 8002870957 226
40 iso_pu_bacteria 8003014200 8003015454 226
41 iso_pu_bacteria 2515154123 2515690099 227
42 3300002075 JGI24738J21930_10000426 JGI24738J21930_100004263 228
43 3300002741 JGI25157J39369_1001047 JGI25157J39369_10010475 228
44 3300003578 Ga0006562J51391_1030224 Ga0006562J51391_10302242 228
45 3300003578 Ga0006562J51391_1030226 Ga0006562J51391_10302263 228
46 3300003752 Ga0055539_1000353 Ga0055539_100035314 228
47 3300003752 Ga0055539_1003201 Ga0055539_10032012 228
48 3300003756 Ga0055533_1000011 Ga0055533_1000011271 228
49 3300003756 Ga0055533_1003406 Ga0055533_10034062 228
50 3300003756 Ga0055533_1010271 Ga0055533_10102712 228
51 3300003759 Ga0055525_1000055 Ga0055525_100005591 228
52 3300003759 Ga0055525_1000845 Ga0055525_10008452 228
53 3300003760 Ga0055527_1000137 Ga0055527_100013727 228
54 3300003760 Ga0055527_1000145 Ga0055527_100014514 228
55 3300003761 Ga0055535_1000112 Ga0055535_100011225 228
56 3300003761 Ga0055535_1000301 Ga0055535_100030114 228
57 3300003761 Ga0055535_1000656 Ga0055535_100065621 228
58 3300003762 Ga0055542_1000154 Ga0055542_100015425 228
59 3300003762 Ga0055542_1000279 Ga0055542_100027937 228
60 3300003762 Ga0055542_1000332 Ga0055542_100033214 228
61 3300003763 Ga0055529_1000244 Ga0055529_100024449 228
62 3300003763 Ga0055529_1000389 Ga0055529_100038921 228
63 3300005262 Ga0065165_1000913 Ga0065165_100091325 228
64 3300005339 Ga0070660_100123475 Ga0070660_1001234753 228
65 3300005614 Ga0068856_100004925 Ga0068856_10000492512 228
66 3300006353 Ga0075370_10035154 Ga0075370_100351543 228
67 3300006880 Ga0075429_100208513 Ga0075429_1002085132 228
68 3300009093 Ga0105240_10023924 Ga0105240_100239249 228
69 3300009094 Ga0111539_10121968 Ga0111539_101219683 228
70 3300009551 Ga0105238_10183543 Ga0105238_101835432 228
71 3300010375 Ga0105239_10020796 Ga0105239_100207963 228
72 3300010375 Ga0105239_10351587 Ga0105239_103515871 228
73 3300013104 Ga0157370_10000045 Ga0157370_1000004580 228
74 3300013104 Ga0157370_10091842 Ga0157370_100918422 228
75 3300013105 Ga0157369_10006716 Ga0157369_100067168 228
76 3300014497 Ga0182008_10052770 Ga0182008_100527702 228
77 3300014497 Ga0182008_10068194 Ga0182008_100681942 228
78 3300015261 Ga0182006_1083378 Ga0182006_10833782 228
79 3300015265 Ga0182005_1000113 Ga0182005_100011328 228
80 3300015265 Ga0182005_1077191 Ga0182005_10771912 228
81 3300025225 Ga0209566_111243 Ga0209566_1112432 228
82 3300025226 Ga0209674_100003 Ga0209674_100003570 228
83 3300025226 Ga0209674_100077 Ga0209674_100077196 228
84 3300025226 Ga0209674_100556 Ga0209674_10055611 228
85 3300025228 Ga0209672_100004 Ga0209672_1000041075 228
86 3300025228 Ga0209672_100022 Ga0209672_100022182 228
87 3300025230 Ga0209563_100010 Ga0209563_100010300 228
88 3300025230 Ga0209563_100076 Ga0209563_10007691 228
89 3300025231 Ga0207427_102846 Ga0207427_1028465 228
90 3300025242 Ga0209258_100003 Ga0209258_1000031075 228
91 3300025242 Ga0209258_100004 Ga0209258_100004198 228
92 3300025242 Ga0209258_100158 Ga0209258_100158117 228
93 3300025250 Ga0209026_1000087 Ga0209026_100008799 228
94 3300025253 Ga0209677_100044 Ga0209677_1000445 228
95 3300025253 Ga0209677_103496 Ga0209677_1034962 228
96 3300025254 Ga0209148_1000025 Ga0209148_1000025379 228
97 3300025254 Ga0209148_1000083 Ga0209148_100008358 228
98 3300025254 Ga0209148_1000362 Ga0209148_100036233 228
99 3300025256 Ga0209759_1000503 Ga0209759_100050326 228
100 3300025258 Ga0209129_1000697 Ga0209129_10006978 228
101 3300025272 Ga0209455_1000004 Ga0209455_10000041075 228
102 3300025272 Ga0209455_1000084 Ga0209455_100008458 228
103 3300025272 Ga0209455_1002956 Ga0209455_10029562 228
104 3300025297 Ga0209758_1005359 Ga0209758_10053594 228
105 3300025302 Ga0207426_1023974 Ga0207426_10239742 228
106 3300025303 Ga0209051_1004509 Ga0209051_10045095 228
107 3300025904 Ga0207647_10000015 Ga0207647_1000001585 228
108 3300025925 Ga0207650_10095678 Ga0207650_100956782 228
109 3300025960 Ga0207651_10021204 Ga0207651_100212042 228
110 3300031251 Ga0265327_10000574 Ga0265327_1000057426 228
111 3300031727 Ga0316576_10052369 Ga0316576_100523692 228
112 3300031727 Ga0316576_10065563 Ga0316576_100655632 228
113 3300031911 Ga0307412_10006311 Ga0307412_100063115 228
114 3300035114 Ga0373939_0052136 Ga0373939_0052136_139_825 228
115 3300035398 Ga0316574_0006413 Ga0316574_0006413_4616_5320 228
116 3300035398 Ga0316574_0234010 Ga0316574_0234010_440_1141 228
117 3300035695 Ga0373927_0311128 Ga0373927_0311128_140_865 228
118 3300037312 Ga0395899_0000106 Ga0395899_0000106_71193_71879 228
119 3300037418 Ga0395900_0000049 Ga0395900_0000049_54169_54855 228
120 3300037466 Ga0395898_0000110 Ga0395898_0000110_170542_171228 228
121 3300037471 Ga0395905_0029445 Ga0395905_0029445_2269_2955 228
122 3300038443 Ga0395901_0060307 Ga0395901_0060307_505_1191 228
123 3300038443 Ga0395901_0196920 Ga0395901_0196920_184_870 228
124 3300041404 Ga0439436_0000007 Ga0439436_0000007_67393_68079 228
125 3300041413 Ga0439465_0001319 Ga0439465_0001319_244_930 228
126 3300042184 Ga0450908_000033 Ga0450908_000033_4652_5338 228
127 3300042438 Ga0439459_0000741 Ga0439459_0000741_711_1397 228
128 3300044656 Ga0466969_0010569 Ga0466969_0010569_125_811 228
129 3300044656 Ga0466969_0048988 Ga0466969_0048988_125_811 228
130 3300044672 Ga0466982_0000083 Ga0466982_0000083_2729_3415 228
131 3300044684 Ga0466966_0004499 Ga0466966_0004499_8342_9028 228
132 3300044693 Ga0466961_0006166 Ga0466961_0006166_5967_6653 228
133 3300044765 Ga0466970_0008744 Ga0466970_0008744_4024_4710 228
134 3300044842 Ga0466957_0004185 Ga0466957_0004185_3089_3775 228
135 3300045049 Ga0466959_0000022 Ga0466959_0000022_69314_70000 228
136 3300045049 Ga0466959_0048408 Ga0466959_0048408_551_1237 228
137 3300045836 Ga0466958_0091081 Ga0466958_0091081_639_1325 228
138 3300046471 Ga0495650_0015578 Ga0495650_0015578_2241_2927 228
139 3300046501 Ga0495607_0000061 Ga0495607_0000061_17171_17857 228
140 3300046512 Ga0495610_0000944 Ga0495610_0000944_14270_14956 228
141 3300046691 Ga0495670_0000482 Ga0495670_0000482_13317_14003 228
142 3300046694 Ga0495649_0020759 Ga0495649_0020759_170_856 228
143 3300048911 Ga0496108_0214614 Ga0496108_0214614_246_932 228
144 3300048919 Ga0496116_0098436 Ga0496116_0098436_95_781 228
145 3300048920 Ga0496117_0038495 Ga0496117_0038495_348_1034 228
146 3300048921 Ga0496118_0001013 Ga0496118_0001013_6390_7076 228
147 3300048924 Ga0496121_0000109 Ga0496121_0000109_41565_42251 228
148 3300048925 Ga0496122_0000133 Ga0496122_0000133_111021_111707 228
149 3300048925 Ga0496122_0009488 Ga0496122_0009488_2028_2714 228
150 3300048925 Ga0496122_0051408 Ga0496122_0051408_1370_2056 228
151 3300048926 Ga0496123_0000199 Ga0496123_0000199_28989_29675 228
152 3300048926 Ga0496123_0011106 Ga0496123_0011106_1479_2165 228
153 3300048926 Ga0496123_0021372 Ga0496123_0021372_2798_3484 228
154 3300048926 Ga0496123_0027019 Ga0496123_0027019_2675_3361 228
155 3300048927 Ga0496124_0016949 Ga0496124_0016949_3276_3962 228
156 3300048927 Ga0496124_0019749 Ga0496124_0019749_984_1670 228
157 3300048928 Ga0496125_0007510 Ga0496125_0007510_3348_4034 228
158 3300048928 Ga0496125_0008720 Ga0496125_0008720_1581_2267 228
159 3300048929 Ga0496126_0007774 Ga0496126_0007774_7639_8325 228
160 3300050493 nmdc:mga0k408_167779_c1 nmdc:mga0k408_167779_c1_238_924 228
161 3300050496 nmdc:mga07m45_176973_c1 nmdc:mga07m45_176973_c1_382_1068 228
162 3300050508 nmdc:mga09592_207554_c1 nmdc:mga09592_207554_c1_243_938 228
163 3300053122 Ga0500608_079178 Ga0500608_079178_114_839 228
164 3300003856 Ga0058692_1000005 Ga0058692_100000546 229
165 3300005338 Ga0068868_100069689 Ga0068868_1000696892 229
166 3300005347 Ga0070668_100037451 Ga0070668_1000374513 229
167 3300005355 Ga0070671_100087908 Ga0070671_1000879083 229
168 3300005455 Ga0070663_100020804 Ga0070663_1000208044 229
169 3300005539 Ga0068853_100001130 Ga0068853_10000113016 229
170 3300005548 Ga0070665_100046608 Ga0070665_1000466083 229
171 3300005548 Ga0070665_100980570 Ga0070665_1009805701 229
172 3300005563 Ga0068855_100062851 Ga0068855_1000628512 229
173 3300005563 Ga0068855_100084433 Ga0068855_1000844333 229
174 3300005841 Ga0068863_100032164 Ga0068863_1000321642 229
175 3300005841 Ga0068863_100040304 Ga0068863_1000403042 229
176 3300005843 Ga0068860_100224448 Ga0068860_1002244482 229
177 3300005985 Ga0081539_10015515 Ga0081539_100155154 229
178 3300006051 Ga0075364_10059492 Ga0075364_100594924 229
179 3300006186 Ga0075369_10077472 Ga0075369_100774722 229
180 3300006844 Ga0075428_100123671 Ga0075428_1001236712 229
181 3300006880 Ga0075429_100213663 Ga0075429_1002136631 229
182 3300007265 Ga0099794_10084849 Ga0099794_100848491 229
183 3300007788 Ga0099795_10006102 Ga0099795_100061022 229
184 3300009036 Ga0105244_10043669 Ga0105244_100436692 229
185 3300009092 Ga0105250_10023366 Ga0105250_100233662 229
186 3300009545 Ga0105237_10199372 Ga0105237_101993722 229
187 3300009553 Ga0105249_10045465 Ga0105249_100454655 229
188 3300010375 Ga0105239_10009641 Ga0105239_1000964111 229
189 3300013104 Ga0157370_10013551 Ga0157370_100135515 229
190 3300013105 Ga0157369_10084798 Ga0157369_100847983 229
191 3300013297 Ga0157378_10089011 Ga0157378_100890112 229
192 3300014325 Ga0163163_10049740 Ga0163163_100497402 229
193 3300014968 Ga0157379_10192046 Ga0157379_101920462 229
194 3300025303 Ga0209051_1028908 Ga0209051_10289082 229
195 3300025728 Ga0207655_1079326 Ga0207655_10793261 229
196 3300025931 Ga0207644_10099281 Ga0207644_100992811 229
197 3300025945 Ga0207679_10097219 Ga0207679_100972192 229
198 3300025949 Ga0207667_10009556 Ga0207667_1000955611 229
199 3300025949 Ga0207667_10154287 Ga0207667_101542871 229
200 3300025961 Ga0207712_10161895 Ga0207712_101618952 229
201 3300025972 Ga0207668_10002794 Ga0207668_100027947 229
202 3300025986 Ga0207658_10202625 Ga0207658_102026252 229
203 3300026041 Ga0207639_10001429 Ga0207639_100014299 229
204 3300026041 Ga0207639_10006186 Ga0207639_100061863 229
205 3300026067 Ga0207678_10074092 Ga0207678_100740922 229
206 3300026067 Ga0207678_10205041 Ga0207678_102050412 229
207 3300026088 Ga0207641_10951150 Ga0207641_109511501 229
208 3300027312 Ga0209371_1000031 Ga0209371_100003145 229
209 3300028379 Ga0268266_10068238 Ga0268266_100682382 229
210 3300028379 Ga0268266_10235666 Ga0268266_102356662 229
211 3300028794 Ga0307515_10030444 Ga0307515_100304445 229
212 3300028800 Ga0265338_10537609 Ga0265338_105376091 229
213 3300030500 Ga0268256_1000034 Ga0268256_1000034307 229
214 3300030731 Ga0316177_1026408 Ga0316177_10264084 229
215 3300030878 Ga0265770_1000095 Ga0265770_10000953 229
216 3300031090 Ga0265760_10000864 Ga0265760_100008647 229
217 3300031249 Ga0265339_10175929 Ga0265339_101759291 229
218 3300031507 Ga0307509_10053951 Ga0307509_100539514 229
219 3300031507 Ga0307509_10088696 Ga0307509_100886963 229
220 3300031507 Ga0307509_10109579 Ga0307509_101095792 229
221 3300031616 Ga0307508_10001558 Ga0307508_100015588 229
222 3300031616 Ga0307508_10002562 Ga0307508_100025622 229
223 3300031649 Ga0307514_10160368 Ga0307514_101603681 229
224 3300031911 Ga0307412_10214411 Ga0307412_102144112 229
225 3300033179 Ga0307507_10096462 Ga0307507_100964622 229
226 3300033180 Ga0307510_10114203 Ga0307510_101142031 229
227 3300033180 Ga0307510_10169986 Ga0307510_101699862 229
228 3300039437 Ga0436365_1076027 Ga0436365_1076027_875_1564 229
229 3300041460 Ga0451802_0710763 Ga0451802_0710763_2647_3336 229
230 3300042006 Ga0439432_057623 Ga0439432_057623_271_960 229
231 3300046683 Ga0495658_0319593 Ga0495658_0319593_188_877 229
232 3300047470 Ga0495681_0066314 Ga0495681_0066314_228_917 229
233 3300048920 Ga0496117_0017770 Ga0496117_0017770_566_1255 229
234 3300048921 Ga0496118_0012009 Ga0496118_0012009_4857_5546 229
235 3300049571 Ga0501034_0003143 Ga0501034_0003143_3365_4054 229
236 3300049572 Ga0501036_0082697 Ga0501036_0082697_1409_2098 229
237 3300049579 Ga0501043_0025027 Ga0501043_0025027_1116_1805 229
238 3300049580 Ga0501046_0022598 Ga0501046_0022598_3628_4317 229
239 3300049581 Ga0501047_0000492 Ga0501047_0000492_3102_3791 229
240 3300049586 Ga0501070_0006453 Ga0501070_0006453_7171_7860 229
241 3300049590 Ga0501074_0028997 Ga0501074_0028997_1517_2206 229
242 3300049742 Ga0501080_0000381 Ga0501080_0000381_7348_8037 229
243 3300049822 Ga0501035_0022978 Ga0501035_0022978_3789_4478 229
244 3300050508 nmdc:mga09592_468436_c1 nmdc:mga09592_468436_c1_299_1000 229
245 3300050510 nmdc:mga06r32_132736_c1 nmdc:mga06r32_132736_c1_376_1077 229
246 3300053092 Ga0500583_0255843 Ga0500583_0255843_18_707 229
247 3300053139 Ga0500568_0001853 Ga0500568_0001853_3888_4577 229
248 3300054114 Ga0501084_0282121 Ga0501084_0282121_253_942 229
249 3300002773 JGI25152J39213_1002091 JGI25152J39213_10020913 230
250 3300002774 JGI25150J39212_1002735 JGI25150J39212_10027353 230
251 3300003215 JGI25153J46596_10008334 JGI25153J46596_100083341 230
252 3300003771 Ga0055526_1006034 Ga0055526_10060344 230
253 3300003781 Ga0055536_1000126 Ga0055536_100012635 230
254 3300003791 Ga0055530_10000132 Ga0055530_1000013235 230
255 3300003794 Ga0055531_10000296 Ga0055531_1000029621 230
256 3300005354 Ga0070675_100520030 Ga0070675_1005200302 230
257 3300005355 Ga0070671_100297360 Ga0070671_1002973601 230
258 3300005367 Ga0070667_100000011 Ga0070667_100000011257 230
259 3300005367 Ga0070667_100607601 Ga0070667_1006076011 230
260 3300005436 Ga0070713_100226778 Ga0070713_1002267782 230
261 3300005439 Ga0070711_100002966 Ga0070711_1000029662 230
262 3300005459 Ga0068867_100300574 Ga0068867_1003005742 230
263 3300005547 Ga0070693_100346853 Ga0070693_1003468531 230
264 3300005548 Ga0070665_100017522 Ga0070665_1000175221 230
265 3300005616 Ga0068852_100115729 Ga0068852_1001157293 230
266 3300005841 Ga0068863_100103892 Ga0068863_1001038922 230
267 3300006051 Ga0075364_10031922 Ga0075364_100319223 230
268 3300006175 Ga0070712_100143525 Ga0070712_1001435252 230
269 3300009177 Ga0105248_11030088 Ga0105248_110300881 230
270 3300012508 Ga0157315_1003300 Ga0157315_10033002 230
271 3300013307 Ga0157372_10820897 Ga0157372_108208972 230
272 3300025245 Ga0207425_1000168 Ga0207425_100016836 230
273 3300025258 Ga0209129_1000215 Ga0209129_100021519 230
274 3300025273 Ga0209673_1010977 Ga0209673_10109772 230
275 3300025292 Ga0209676_1000011 Ga0209676_1000011347 230
276 3300025295 Ga0209564_1000057 Ga0209564_1000057225 230
277 3300025297 Ga0209758_1000174 Ga0209758_100017453 230
278 3300025298 Ga0209050_1000032 Ga0209050_1000032226 230
279 3300025298 Ga0209050_1033906 Ga0209050_10339062 230
280 3300025303 Ga0209051_1000382 Ga0209051_10003826 230
281 3300025304 Ga0209257_1000014 Ga0209257_1000014406 230
282 3300025304 Ga0209257_1000147 Ga0209257_1000147178 230
283 3300025903 Ga0207680_10361100 Ga0207680_103611001 230
284 3300025916 Ga0207663_10004170 Ga0207663_100041704 230
285 3300025919 Ga0207657_10639184 Ga0207657_106391842 230
286 3300025921 Ga0207652_10148367 Ga0207652_101483671 230
287 3300025926 Ga0207659_10200384 Ga0207659_102003841 230
288 3300025926 Ga0207659_10463508 Ga0207659_104635082 230
289 3300025940 Ga0207691_10187989 Ga0207691_101879892 230
290 3300025942 Ga0207689_10589486 Ga0207689_105894861 230
291 3300025960 Ga0207651_10406943 Ga0207651_104069431 230
292 3300025986 Ga0207658_10000046 Ga0207658_10000046117 230
293 3300026035 Ga0207703_10804893 Ga0207703_108048932 230
294 3300026088 Ga0207641_10009763 Ga0207641_100097633 230
295 3300026089 Ga0207648_10246617 Ga0207648_102466172 230
296 3300026116 Ga0207674_10276900 Ga0207674_102769002 230
297 3300027424 Ga0209984_1012384 Ga0209984_10123842 230
298 3300027471 Ga0209995_1028887 Ga0209995_10288871 230
299 3300027543 Ga0209999_1000340 Ga0209999_10003402 230
300 3300027552 Ga0209982_1010234 Ga0209982_10102342 230
301 3300027682 Ga0209971_1001679 Ga0209971_10016794 230
302 3300027876 Ga0209974_10020661 Ga0209974_100206612 230
303 3300028017 Ga0265356_1001733 Ga0265356_10017332 230
304 3300028379 Ga0268266_10035205 Ga0268266_100352052 230
305 3300028800 Ga0265338_10030722 Ga0265338_100307224 230
306 3300031456 Ga0307513_10261017 Ga0307513_102610172 230
307 3300031595 Ga0265313_10028339 Ga0265313_100283393 230
308 3300031824 Ga0307413_10278610 Ga0307413_102786102 230
309 3300032004 Ga0307414_10049277 Ga0307414_100492772 230
310 3300035724 Ga0373933_0444606 Ga0373933_0444606_99_797 230
311 3300035725 Ga0373947_0412821 Ga0373947_0412821_156_854 230
312 3300041413 Ga0439465_0009790 Ga0439465_0009790_24_722 230
313 3300041509 Ga0451843_0266507 Ga0451843_0266507_641_1333 230
314 3300041999 Ga0439433_0064477 Ga0439433_0064477_91_792 230
315 3300042004 Ga0439445_0006506 Ga0439445_0006506_59_751 230
316 3300042007 Ga0439449_0006535 Ga0439449_0006535_1739_2431 230
317 3300042007 Ga0439449_0011093 Ga0439449_0011093_796_1611 230
318 3300044712 Ga0453684_0077344 Ga0453684_0077344_3243_3935 230
319 3300046460 Ga0495638_0112687 Ga0495638_0112687_168_860 230
320 3300046513 Ga0495616_0145263 Ga0495616_0145263_204_896 230
321 3300046525 Ga0495663_0000696 Ga0495663_0000696_7354_8046 230
322 3300046615 Ga0495656_0003555 Ga0495656_0003555_3283_3978 230
323 3300047318 Ga0495636_0004489 Ga0495636_0004489_4280_4975 230
324 3300048904 Ga0496101_0274131 Ga0496101_0274131_159_854 230
325 3300048907 Ga0496104_0010693 Ga0496104_0010693_5602_6300 230
326 3300048908 Ga0496105_0002496 Ga0496105_0002496_3718_4416 230
327 3300048910 Ga0496107_0157471 Ga0496107_0157471_783_1481 230
328 3300048911 Ga0496108_0125251 Ga0496108_0125251_1310_2005 230
329 3300048912 Ga0496109_0036863 Ga0496109_0036863_2549_3244 230
330 3300048917 Ga0496114_0036165 Ga0496114_0036165_2223_2921 230
331 3300048917 Ga0496114_0498355 Ga0496114_0498355_306_1001 230
332 3300048918 Ga0496115_0199593 Ga0496115_0199593_143_841 230
333 3300048927 Ga0496124_0195061 Ga0496124_0195061_549_1244 230
334 3300049569 Ga0501032_0002036 Ga0501032_0002036_12447_13172 230
335 3300049570 Ga0501033_0022383 Ga0501033_0022383_675_1400 230
336 3300049571 Ga0501034_0001904 Ga0501034_0001904_22967_23692 230
337 3300049573 Ga0501037_0000948 Ga0501037_0000948_4852_5577 230
338 3300049574 Ga0501038_0000712 Ga0501038_0000712_25302_26027 230
339 3300049575 Ga0501039_0007044 Ga0501039_0007044_165_890 230
340 3300049579 Ga0501043_0014565 Ga0501043_0014565_3425_4150 230
341 3300049580 Ga0501046_0017496 Ga0501046_0017496_2264_2989 230
342 3300049581 Ga0501047_0125982 Ga0501047_0125982_1170_1895 230
343 3300049589 Ga0501073_0023067 Ga0501073_0023067_2697_3422 230
344 3300049742 Ga0501080_0013444 Ga0501080_0013444_578_1303 230
345 3300049822 Ga0501035_0001396 Ga0501035_0001396_22030_22755 230
346 3300049823 Ga0501044_0076097 Ga0501044_0076097_2136_2861 230
347 3300002067 JGI24735J21928_10000688 JGI24735J21928_100006885 231
348 3300005295 Ga0065707_10081942 Ga0065707_1008194210 231
349 3300005327 Ga0070658_10008464 Ga0070658_100084644 231
350 3300005327 Ga0070658_10013977 Ga0070658_100139772 231
351 3300005334 Ga0068869_100233234 Ga0068869_1002332342 231
352 3300005339 Ga0070660_100041900 Ga0070660_1000419002 231
353 3300005354 Ga0070675_100179864 Ga0070675_1001798641 231
354 3300005366 Ga0070659_100017323 Ga0070659_1000173233 231
355 3300005366 Ga0070659_100170958 Ga0070659_1001709582 231
356 3300005563 Ga0068855_100016092 Ga0068855_1000160928 231
357 3300005563 Ga0068855_100103024 Ga0068855_1001030244 231
358 3300005614 Ga0068856_100393958 Ga0068856_1003939582 231
359 3300005844 Ga0068862_100055919 Ga0068862_1000559192 231
360 3300005937 Ga0081455_10000494 Ga0081455_1000049429 231
361 3300005985 Ga0081539_10000055 Ga0081539_1000005587 231
362 3300006358 Ga0068871_100085744 Ga0068871_1000857441 231
363 3300009093 Ga0105240_10008496 Ga0105240_100084969 231
364 3300009093 Ga0105240_10050022 Ga0105240_100500224 231
365 3300009093 Ga0105240_10078277 Ga0105240_100782773 231
366 3300009093 Ga0105240_10196940 Ga0105240_101969402 231
367 3300009177 Ga0105248_10020266 Ga0105248_100202667 231
368 3300009553 Ga0105249_10064634 Ga0105249_100646343 231
369 3300009553 Ga0105249_10223163 Ga0105249_102231632 231
370 3300010375 Ga0105239_10006011 Ga0105239_1000601113 231
371 3300013100 Ga0157373_10002328 Ga0157373_1000232813 231
372 3300013104 Ga0157370_10000414 Ga0157370_1000041419 231
373 3300013104 Ga0157370_10005004 Ga0157370_1000500411 231
374 3300013104 Ga0157370_10021424 Ga0157370_100214245 231
375 3300013105 Ga0157369_10001321 Ga0157369_1000132117 231
376 3300013105 Ga0157369_10006093 Ga0157369_1000609311 231
377 3300013296 Ga0157374_10000139 Ga0157374_1000013931 231
378 3300013307 Ga0157372_10083723 Ga0157372_100837232 231
379 3300014497 Ga0182008_10026119 Ga0182008_100261192 231
380 3300020070 Ga0206356_11052409 Ga0206356_110524092 231
381 3300020082 Ga0206353_11764899 Ga0206353_117648991 231
382 3300022467 Ga0224712_10000435 Ga0224712_100004353 231
383 3300025228 Ga0209672_100817 Ga0209672_1008179 231
384 3300025256 Ga0209759_1005936 Ga0209759_10059363 231
385 3300025904 Ga0207647_10000987 Ga0207647_1000098710 231
386 3300025909 Ga0207705_10005083 Ga0207705_100050835 231
387 3300025909 Ga0207705_10010381 Ga0207705_100103816 231
388 3300025913 Ga0207695_10075092 Ga0207695_100750923 231
389 3300025913 Ga0207695_10079435 Ga0207695_100794353 231
390 3300025919 Ga0207657_10002768 Ga0207657_1000276810 231
391 3300025932 Ga0207690_10050289 Ga0207690_100502892 231
392 3300025942 Ga0207689_10393869 Ga0207689_103938692 231
393 3300025949 Ga0207667_10007773 Ga0207667_1000777312 231
394 3300025949 Ga0207667_10014879 Ga0207667_100148794 231
395 3300025961 Ga0207712_10057520 Ga0207712_100575202 231
396 3300025961 Ga0207712_10077885 Ga0207712_100778853 231
397 3300025961 Ga0207712_10211356 Ga0207712_102113562 231
398 3300026078 Ga0207702_10209941 Ga0207702_102099412 231
399 3300026088 Ga0207641_10007559 Ga0207641_100075593 231
400 3300026118 Ga0207675_100062666 Ga0207675_1000626662 231
401 3300028380 Ga0268265_10311169 Ga0268265_103111692 231
402 3300031456 Ga0307513_10342178 Ga0307513_103421781 231
403 3300037466 Ga0395898_0000726 Ga0395898_0000726_13215_13910 231
404 3300037466 Ga0395898_0008275 Ga0395898_0008275_4024_4719 231
405 3300037466 Ga0395898_0938057 Ga0395898_0938057_49_747 231
406 3300038443 Ga0395901_0395675 Ga0395901_0395675_541_1239 231
407 3300042005 Ga0439448_0000884 Ga0439448_0000884_3868_4563 231
408 3300044658 Ga0466972_0066913 Ga0466972_0066913_245_940 231
409 3300044659 Ga0466973_0041286 Ga0466973_0041286_973_1707 231
410 3300044683 Ga0466965_0001580 Ga0466965_0001580_8287_9021 231
411 3300044684 Ga0466966_0089074 Ga0466966_0089074_130_864 231
412 3300044693 Ga0466961_0008647 Ga0466961_0008647_4117_4851 231
413 3300044694 Ga0466963_0003669 Ga0466963_0003669_2593_3327 231
414 3300044901 Ga0466960_0220089 Ga0466960_0220089_318_1013 231
415 3300045049 Ga0466959_0021834 Ga0466959_0021834_2931_3665 231
416 3300045836 Ga0466958_0107081 Ga0466958_0107081_856_1590 231
417 3300053091 Ga0500647_0033782 Ga0500647_0033782_387_1082 231
418 3300053104 Ga0500556_0000655 Ga0500556_0000655_33_728 231
419 3300053123 Ga0500614_066609 Ga0500614_066609_87_782 231
420 3300053146 Ga0500588_0003025 Ga0500588_0003025_678_1373 231
421 3300060353 Ga0501082_0613610 Ga0501082_0613610_189_884 231
422 3300061719 Ga0466962_0018179 Ga0466962_0018179_1616_2350 231
423 3300061719 Ga0466962_0168925 Ga0466962_0168925_175_870 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

24

162

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9837 2 224
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9794 2 224
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9699 4 224
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9698 2 224
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9673 5 224
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9837 2 224 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.98 4 224 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9734 31 224 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 1 224 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9701 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-H8FG51-F1-model_v4 deleted 0.9937 1 204
AF-A0A4P5VZ20-F1-model_v4 ABC transporter ATP-binding protein 0.9866 1 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A843EBV0-F1-model_v4 ABC transporter ATP-binding protein 0.9848 28 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7J0BSF2-F1-model_v4 ABC transporter ATP-binding protein 0.9833 3 224 GO:0005524
GO:0016887
AF-A0A4U0PR55-F1-model_v4 ABC transporter ATP-binding protein 0.9819 2 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.49 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map