metagRoot

F438856

General Info

Members	Datasets	Scaffolds	Average Seq Length
416	264	416	288

Family's Representative Sequence

Representative Sequence	3300035695\|Ga0373927_0013854\|Ga0373927_0013854_3493_4470
Length	325
Sequence	LPLDGTGAVLGLKYLPVVLQAPYKVLQESQSIMAMPRGLDHIVHAVRDLDAAADFYRRAGFTVGARNRHSWGTQNHLVQLPGFFMELLTVAEPEKLTGEGFAALFGVFNRQFLTQHEGLSFIMLESDDVPADAAQFRASNIARSDALTFERAGKGPDGSTVTVGFSLAFARDPRAPEVGFAVCRQHSPQFFWNPALQQHTNGATGVAGAVLVAENPTDHHIFLTAFSGVRELHAGSGVLTAPTPRGDIRIMDRAAFQTRFGLEPPDTLSGARLAAVRFTVRERKALHDALTAGGIAFSEHMGQTVVAPAAAMGATLVFEGPDFGG

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
5	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
6	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
7	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
8	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
9	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
10	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
11	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
12	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
14	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
17	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
29	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
30	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
33	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
34	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
35	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
36	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
37	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
38	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
39	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
40	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
41	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
42	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
43	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
44	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
45	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
46	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
47	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
48	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
49	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
52	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
53	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
54	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
55	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
56	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
57	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
58	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
59	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
60	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
61	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
64	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
66	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
67	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
77	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
81	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
82	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
86	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
87	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
88	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
89	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
90	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
91	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
92	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
93	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
127	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
130	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
131	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
132	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
133	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
134	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
135	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
136	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
137	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
138	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
139	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
140	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
141	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
142	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
143	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
144	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
145	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
146	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
147	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
148	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
149	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
150	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
151	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
152	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
153	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
154	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
155	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
156	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
157	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
158	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
159	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
160	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
161	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
162	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
163	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
164	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
165	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
166	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
167	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
168	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
169	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
170	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
171	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
172	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
173	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
174	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
175	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
176	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
177	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
178	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
179	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
180	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
181	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
182	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
183	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
184	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
185	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
186	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
187	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
188	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
189	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
190	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
191	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
192	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
193	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
194	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
195	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
196	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
197	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
198	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
199	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
200	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
201	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
202	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
203	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
204	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
205	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
206	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
207	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
208	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
209	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
210	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
211	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
212	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
242	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
246	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
247	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
248	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
249	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
252	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
253	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
254	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
255	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
256	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
257	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
258	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
259	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
260	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
261	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
262	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
263	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
264	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.81
Nodule	0
Rhizoplane	6.73
Rhizosphere	86.78
Stem	0
Stem Tuber	0
Unclassified	1.68

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214761881	2209111006	Bacteria	2937
2	ARcpr5oldR_c000454	3300000041	Bacteria	5432
3	ARSoilYngRDRAFT_c00416	3300000042	Bacteria	5440
4	ARcpr5yngRDRAFT_c000356	3300000043	Bacteria	6100
5	ARSoilOldRDRAFT_c000325	3300000044	Bacteria	6306
6	ARCol0oldRDRAFT_c00370	3300000045	Bacteria	4343
7	ARCol0yngRDRAFT_1000380	3300000652	Bacteria	6162
8	ARCol0yngRDRAFT_1000422	3300000652	Bacteria	5431
9	JGI25406J46586_10000029	3300003203	Bacteria	70143
10	JGI25406J46586_10000046	3300003203	Bacteria	55343
11	JGI25153J46596_10005621	3300003215	Bacteria	6553
12	JGI25404J52841_10001763	3300003659	Bacteria	3919
13	JGI25404J52841_10007954	3300003659	Bacteria	2250
14	Ga0065704_10086301	3300005289	Bacteria	3134
15	Ga0065715_10091447	3300005293	Bacteria	5788
16	Ga0065707_10103672	3300005295	Bacteria	2734
17	Ga0070690_100024699	3300005330	Bacteria	3696
18	Ga0070666_10140370	3300005335	Bacteria	1683
19	Ga0070680_100009626	3300005336	Bacteria	7430
20	Ga0070680_100175905	3300005336	Bacteria	1802
21	Ga0070680_100294013	3300005336	Bacteria	1377
22	Ga0070682_100147826	3300005337	Bacteria	1609
23	Ga0070689_100004817	3300005340	Bacteria	9156
24	Ga0070687_100026704	3300005343	Bacteria	2782
25	Ga0070668_100067299	3300005347	Bacteria	2782
26	Ga0070703_10092984	3300005406	Bacteria	1049
27	Ga0070709_10006444	3300005434	Bacteria	6400
28	Ga0070714_100125981	3300005435	Bacteria	2284
29	Ga0070714_100152502	3300005435	Bacteria	2084
30	Ga0070713_100004379	3300005436	Bacteria	9485
31	Ga0070713_100205365	3300005436	Bacteria	1781
32	Ga0070710_10000395	3300005437	Bacteria	20362
33	Ga0070711_100002765	3300005439	Bacteria	10064
34	Ga0070711_100111928	3300005439	Bacteria	2005
35	Ga0070705_100273186	3300005440	Bacteria	1198
36	Ga0070694_100159148	3300005444	Bacteria	1655
37	Ga0070663_100299784	3300005455	Unclassified	1286
38	Ga0070663_100379721	3300005455	Bacteria	1151
39	Ga0070662_100062035	3300005457	Bacteria	2730
40	Ga0068867_100021472	3300005459	Bacteria	4606
41	Ga0070698_100327957	3300005471	Bacteria	1462
42	Ga0070679_100219248	3300005530	Bacteria	1864
43	Ga0070679_100365663	3300005530	Bacteria	1390
44	Ga0070697_100032268	3300005536	Bacteria	4213
45	Ga0068853_100020739	3300005539	Bacteria	5466
46	Ga0068853_100318170	3300005539	Bacteria	1442
47	Ga0068855_100024338	3300005563	Bacteria	7247
48	Ga0068855_100063261	3300005563	Bacteria	4318
49	Ga0068855_100597804	3300005563	Bacteria	1190
50	Ga0068857_100017252	3300005577	Bacteria	6326
51	Ga0068857_100315663	3300005577	Bacteria	1442
52	Ga0068854_100059936	3300005578	Bacteria	2751
53	Ga0068854_100100181	3300005578	Bacteria	2171
54	Ga0068856_100005597	3300005614	Bacteria	12362
55	Ga0068856_100007904	3300005614	Bacteria	10390
56	Ga0068856_100161378	3300005614	Bacteria	2252
57	Ga0068856_100299381	3300005614	Bacteria	1626
58	Ga0070702_100240321	3300005615	Bacteria	1222
59	Ga0068859_100098574	3300005617	Bacteria	2977
60	Ga0068864_100310209	3300005618	Bacteria	1479
61	Ga0068851_10023270	3300005834	Bacteria	3027
62	Ga0068860_100297689	3300005843	Bacteria	1580
63	Ga0068862_100017409	3300005844	Bacteria	5985
64	Ga0081455_10001069	3300005937	Bacteria	34502
65	Ga0081455_10012384	3300005937	Bacteria	8511
66	Ga0081455_10054171	3300005937	Bacteria	3420
67	Ga0081455_10211460	3300005937	Bacteria	1445
68	Ga0081538_10026067	3300005981	Bacteria	4100
69	Ga0081540_1000092	3300005983	Bacteria	94188
70	Ga0081540_1002393	3300005983	Bacteria	15301
71	Ga0081540_1014797	3300005983	Bacteria	4972
72	Ga0081539_10000379	3300005985	Bacteria	97134
73	Ga0070717_10006490	3300006028	Bacteria	8610
74	Ga0070717_10069158	3300006028	Bacteria	2940
75	Ga0070717_10212860	3300006028	Bacteria	1697
76	Ga0075363_100027593	3300006048	Bacteria	2912
77	Ga0070715_10000129	3300006163	Bacteria	17779
78	Ga0070716_100042320	3300006173	Bacteria	2542
79	Ga0070712_100045419	3300006175	Bacteria	3033
80	Ga0070712_100111080	3300006175	Bacteria	2046
81	Ga0075362_10009809	3300006177	Bacteria	3716
82	Ga0075362_10112457	3300006177	Bacteria	1283
83	Ga0075367_10082812	3300006178	Bacteria	1943
84	Ga0075367_10353450	3300006178	Bacteria	927
85	Ga0075366_10036360	3300006195	Bacteria	2903
86	Ga0075428_100006018	3300006844	Bacteria	13474
87	Ga0075428_100316846	3300006844	Bacteria	1676
88	Ga0075430_100000026	3300006846	Bacteria	78833
89	Ga0075430_100182289	3300006846	Bacteria	1746
90	Ga0075431_100004659	3300006847	Bacteria	13474
91	Ga0075431_100370726	3300006847	Bacteria	1437
92	Ga0075433_10002454	3300006852	Bacteria	14106
93	Ga0075433_10050355	3300006852	Bacteria	3626
94	Ga0075433_10141232	3300006852	Bacteria	2140
95	Ga0075434_100007425	3300006871	Bacteria	10147
96	Ga0075434_100010735	3300006871	Bacteria	8601
97	Ga0075434_100087434	3300006871	Bacteria	3117
98	Ga0075429_100003174	3300006880	Bacteria	13973
99	Ga0097620_100098579	3300006931	Bacteria	2977
100	Ga0075435_100084722	3300007076	Bacteria	2608
101	Ga0099794_10071779	3300007265	Bacteria	1696
102	Ga0099794_10227771	3300007265	Bacteria	958
103	Ga0099795_10012034	3300007788	Bacteria	2610
104	Ga0099795_10057162	3300007788	Bacteria	1437
105	Ga0105240_10003456	3300009093	Bacteria	24510
106	Ga0105240_10012779	3300009093	Bacteria	11570
107	Ga0105240_10012909	3300009093	Bacteria	11506
108	Ga0111539_10001514	3300009094	Bacteria	31027
109	Ga0111539_10004795	3300009094	Bacteria	17642
110	Ga0111539_10053716	3300009094	Bacteria	4796
111	Ga0111539_10167605	3300009094	Bacteria	2567
112	Ga0105247_10003320	3300009101	Bacteria	10544
113	Ga0114129_10054899	3300009147	Bacteria	5584
114	Ga0114129_10057722	3300009147	Bacteria	5430
115	Ga0105243_10037512	3300009148	Bacteria	3768
116	Ga0105241_10026767	3300009174	Bacteria	4292
117	Ga0105242_10122413	3300009176	Bacteria	2235
118	Ga0105248_10010337	3300009177	Bacteria	10271
119	Ga0105237_10050255	3300009545	Bacteria	4189
120	Ga0105237_10122566	3300009545	Bacteria	2594
121	Ga0105237_10176765	3300009545	Bacteria	2135
122	Ga0105237_10203922	3300009545	Bacteria	1978
123	Ga0105237_10283950	3300009545	Bacteria	1658
124	Ga0105238_10009912	3300009551	Bacteria	9550
125	Ga0105238_10015239	3300009551	Bacteria	7783
126	Ga0105238_10069128	3300009551	Bacteria	3532
127	Ga0105238_10253587	3300009551	Bacteria	1738
128	Ga0105239_10028810	3300010375	Bacteria	6106
129	Ga0105239_10055535	3300010375	Bacteria	4343
130	Ga0105239_10121301	3300010375	Bacteria	2903
131	Ga0105246_10147407	3300011119	Bacteria	1777
132	Ga0157314_1003318	3300012500	Bacteria	1139
133	Ga0157338_1006007	3300012515	Bacteria	1111
134	Ga0157371_10136463	3300013102	Bacteria	1747
135	Ga0157369_10005789	3300013105	Bacteria	14369
136	Ga0157369_10156101	3300013105	Bacteria	2410
137	Ga0157369_10771704	3300013105	Unclassified	988
138	Ga0157374_10401137	3300013296	Bacteria	1368
139	Ga0163162_10031094	3300013306	Bacteria	5293
140	Ga0163162_10179305	3300013306	Bacteria	2244
141	Ga0157372_10073580	3300013307	Bacteria	3852
142	Ga0157372_10188165	3300013307	Bacteria	2391
143	Ga0157375_10082173	3300013308	Bacteria	3263
144	Ga0157375_10507018	3300013308	Bacteria	1370
145	Ga0163163_10000552	3300014325	Bacteria	32773
146	Ga0157380_10085345	3300014326	Bacteria	2591
147	Ga0157379_10113974	3300014968	Bacteria	2430
148	Ga0157376_10123813	3300014969	Bacteria	2296
149	Ga0213874_10000567	3300021377	Bacteria	7379
150	Ga0209758_1000385	3300025297	Bacteria	76280
151	Ga0207697_10030249	3300025315	Bacteria	2216
152	Ga0207656_10052123	3300025321	Bacteria	1771
153	Ga0207710_10016597	3300025900	Bacteria	3117
154	Ga0207647_10048628	3300025904	Bacteria	2633
155	Ga0207685_10000490	3300025905	Bacteria	6723
156	Ga0207654_10000344	3300025911	Bacteria	27758
157	Ga0207707_10282833	3300025912	Bacteria	1436
158	Ga0207695_10000402	3300025913	Bacteria	96771
159	Ga0207695_10013714	3300025913	Bacteria	9645
160	Ga0207671_10022329	3300025914	Bacteria	4786
161	Ga0207671_10333935	3300025914	Unclassified	1201
162	Ga0207671_10405995	3300025914	Bacteria	1083
163	Ga0207693_10003086	3300025915	Bacteria	14356
164	Ga0207693_10176059	3300025915	Bacteria	1683
165	Ga0207663_10001974	3300025916	Bacteria	9722
166	Ga0207660_10197237	3300025917	Bacteria	1571
167	Ga0207662_10007791	3300025918	Bacteria	5838
168	Ga0207652_10038928	3300025921	Bacteria	4033
169	Ga0207694_10000095	3300025924	Bacteria	99130
170	Ga0207694_10254022	3300025924	Bacteria	1439
171	Ga0207694_10333189	3300025924	Bacteria	1254
172	Ga0207659_10097602	3300025926	Bacteria	2208
173	Ga0207664_10043386	3300025929	Bacteria	3516
174	Ga0207664_10373622	3300025929	Bacteria	1265
175	Ga0207706_10019089	3300025933	Bacteria	6167
176	Ga0207670_10122785	3300025936	Bacteria	1891
177	Ga0207665_10000455	3300025939	Bacteria	28194
178	Ga0207667_10025159	3300025949	Bacteria	6523
179	Ga0207712_10152290	3300025961	Bacteria	1788
180	Ga0207640_10010573	3300025981	Bacteria	5205
181	Ga0207639_10010954	3300026041	Bacteria	6288
182	Ga0207639_10030216	3300026041	Bacteria	3972
183	Ga0207708_10015978	3300026075	Bacteria	5637
184	Ga0207708_10099214	3300026075	Bacteria	2252
185	Ga0207702_10000025	3300026078	Bacteria	186312
186	Ga0207702_10000075	3300026078	Bacteria	112303
187	Ga0207702_10161264	3300026078	Bacteria	2048
188	Ga0207641_10185345	3300026088	Bacteria	1909
189	Ga0207648_10157612	3300026089	Bacteria	2004
190	Ga0207676_10220680	3300026095	Bacteria	1688
191	Ga0207674_10038819	3300026116	Bacteria	4940
192	Ga0207674_10090885	3300026116	Bacteria	3044
193	Ga0207675_100301765	3300026118	Bacteria	1560
194	Ga0209998_10002333	3300027717	Bacteria	4381
195	Ga0209998_10035611	3300027717	Bacteria	1116
196	Ga0207428_10000140	3300027907	Bacteria	97818
197	Ga0207428_10000911	3300027907	Bacteria	33050
198	Ga0207428_10107141	3300027907	Bacteria	2153
199	Ga0268266_10343692	3300028379	Bacteria	1401
200	Ga0268264_10197073	3300028381	Bacteria	1840
201	Ga0265325_10001324	3300031241	Bacteria	17539
202	Ga0265325_10055552	3300031241	Bacteria	2024
203	Ga0265340_10015690	3300031247	Bacteria	3933
204	Ga0265339_10137539	3300031249	Bacteria	1245
205	Ga0265331_10083514	3300031250	Bacteria	1481
206	Ga0265314_10004396	3300031711	Bacteria	13094
207	Ga0265314_10048526	3300031711	Bacteria	2979
208	Ga0265314_10050028	3300031711	Bacteria	2922
209	Ga0265342_10002326	3300031712	Bacteria	16521
210	Ga0265342_10031762	3300031712	Bacteria	3261
211	Ga0373950_0000831	3300034818	Bacteria	3878
212	Ga0373958_0002463	3300034819	Bacteria	2597
213	Ga0373959_0001308	3300034820	Bacteria	3990
214	Ga0373938_0001543	3300034957	Bacteria	3697
215	Ga0373934_0071708	3300035086	Bacteria	1386
216	Ga0373940_0000089	3300035088	Bacteria	10906
217	Ga0373951_0000964	3300035091	Bacteria	7741
218	Ga0373952_0025653	3300035092	Bacteria	1274
219	Ga0373923_0069914	3300035111	Bacteria	1506
220	Ga0373936_0054480	3300035113	Bacteria	1623
221	Ga0373939_0038294	3300035114	Bacteria	1429
222	Ga0373941_0000195	3300035115	Bacteria	11536
223	Ga0373953_0083922	3300035117	Bacteria	1327
224	Ga0373954_0029314	3300035118	Bacteria	2534
225	Ga0373957_0097548	3300035120	Unclassified	1174
226	Ga0373960_0001230	3300035121	Bacteria	5606
227	Ga0373955_0039507	3300035172	Bacteria	2519
228	Ga0373955_0119765	3300035172	Bacteria	1529
229	Ga0373955_0159826	3300035172	Bacteria	1329
230	Ga0373942_0000043	3300035207	Bacteria	24360
231	Ga0373962_0010077	3300035242	Bacteria	2350
232	Ga0373931_0003696	3300035691	Bacteria	6922
233	Ga0373935_0115269	3300035692	Bacteria	1789
234	Ga0373927_0013854	3300035695	Bacteria	5351
235	Ga0373933_0000117	3300035724	Bacteria	51348
236	Ga0373933_0027590	3300035724	Bacteria	3271
237	Ga0373947_0079709	3300035725	Bacteria	2024
238	Ga0373937_0001453	3300036401	Bacteria	19818
239	Ga0373937_0006193	3300036401	Bacteria	10304
240	Ga0373937_0029734	3300036401	Bacteria	4949
241	Ga0373937_0261573	3300036401	Bacteria	1632
242	Ga0373937_0680157	3300036401	Bacteria	975
243	Ga0373925_0190472	3300037068	Bacteria	1627
244	Ga0395899_0362009	3300037312	Bacteria	968
245	Ga0395900_0045159	3300037418	Bacteria	4538
246	Ga0395900_0168173	3300037418	Bacteria	2233
247	Ga0395900_0313488	3300037418	Bacteria	1551
248	Ga0395898_0031296	3300037466	Bacteria	5318
249	Ga0395898_0115736	3300037466	Bacteria	2569
250	Ga0395898_0132567	3300037466	Bacteria	2386
251	Ga0395901_0081416	3300038443	Bacteria	3382
252	Ga0395901_0209024	3300038443	Bacteria	2043
253	Ga0242420_003428	3300038996	Bacteria	2340
254	Ga0436365_0505726	3300039437	Bacteria	2329
255	Ga0436363_1471794	3300039450	Bacteria	5160
256	Ga0451577_0096353	3300042876	Bacteria	2642
257	Ga0466966_0073546	3300044684	Bacteria	2137
258	Ga0466959_0059463	3300045049	Bacteria	2783
259	Ga0451576_0611550	3300045051	Bacteria	1145
260	Ga0495617_019649	3300046452	Bacteria	2284
261	Ga0495592_0022576	3300046454	Bacteria	4786
262	Ga0495603_0013152	3300046455	Bacteria	5003
263	Ga0495651_0009955	3300046462	Bacteria	7311
264	Ga0495651_0013189	3300046462	Bacteria	6388
265	Ga0495651_0122609	3300046462	Bacteria	1907
266	Ga0495653_0071471	3300046463	Bacteria	2594
267	Ga0495582_0013425	3300046473	Bacteria	4509
268	Ga0495664_0093589	3300046477	Bacteria	1808
269	Ga0495606_0005157	3300046507	Bacteria	12659
270	Ga0495608_0004291	3300046511	Bacteria	10207
271	Ga0495608_0234098	3300046511	Bacteria	1149
272	Ga0495628_0178306	3300046516	Bacteria	1608
273	Ga0495628_0447398	3300046516	Bacteria	939
274	Ga0495648_0000494	3300046524	Bacteria	42434
275	Ga0495652_0064518	3300046529	Bacteria	3079
276	Ga0495665_0202644	3300046531	Bacteria	1028
277	Ga0495587_0038401	3300046536	Bacteria	2871
278	Ga0495656_0003896	3300046615	Bacteria	5074
279	Ga0495656_0078006	3300046615	Unclassified	1488
280	Ga0495634_0131599	3300046642	Bacteria	1594
281	Ga0495657_0122429	3300046675	Bacteria	1637
282	Ga0495599_0010777	3300046678	Bacteria	5601
283	Ga0495599_0064228	3300046678	Bacteria	2293
284	Ga0495599_0141215	3300046678	Bacteria	1494
285	Ga0495623_0022661	3300046679	Bacteria	4054
286	Ga0495623_0144670	3300046679	Bacteria	1411
287	Ga0495646_0076741	3300046680	Bacteria	1956
288	Ga0495613_0285931	3300046689	Bacteria	1144
289	Ga0495600_0067080	3300046809	Bacteria	2345
290	Ga0495604_0160772	3300047317	Bacteria	1587
291	Ga0495604_0243035	3300047317	Bacteria	1230
292	Ga0495674_0091357	3300047319	Bacteria	2600
293	Ga0495680_0204271	3300047322	Bacteria	1416
294	Ga0495680_0326731	3300047322	Bacteria	1072
295	Ga0495675_0007264	3300047444	Bacteria	6825
296	Ga0495675_0046426	3300047444	Bacteria	2765
297	Ga0496100_0187713	3300048903	Bacteria	1499
298	Ga0496104_0061610	3300048907	Bacteria	3557
299	Ga0496104_0119262	3300048907	Bacteria	2533
300	Ga0496104_0134386	3300048907	Bacteria	2376
301	Ga0496104_0202042	3300048907	Bacteria	1899
302	Ga0496105_0057773	3300048908	Bacteria	3203
303	Ga0496106_0019163	3300048909	Bacteria	5073
304	Ga0496106_0055825	3300048909	Bacteria	2986
305	Ga0496107_0014946	3300048910	Bacteria	5436
306	Ga0496107_0015668	3300048910	Bacteria	5315
307	Ga0496108_0007772	3300048911	Bacteria	8685
308	Ga0496108_0022515	3300048911	Bacteria	5180
309	Ga0496108_0255783	3300048911	Bacteria	1524
310	Ga0496109_0002542	3300048912	Bacteria	15293
311	Ga0496109_0008251	3300048912	Bacteria	8845
312	Ga0496110_0018167	3300048913	Bacteria	5892
313	Ga0496110_0093036	3300048913	Bacteria	2698
314	Ga0496110_0325868	3300048913	Bacteria	1399
315	Ga0496111_0009058	3300048914	Bacteria	6626
316	Ga0496112_0000009	3300048915	Bacteria	299708
317	Ga0496112_0005502	3300048915	Bacteria	10965
318	Ga0496112_0059619	3300048915	Bacteria	3761
319	Ga0496112_0145526	3300048915	Bacteria	2338
320	Ga0496113_0010440	3300048916	Bacteria	6140
321	Ga0496114_0046004	3300048917	Bacteria	3626
322	Ga0496114_0092700	3300048917	Bacteria	2567
323	Ga0496115_0047079	3300048918	Bacteria	3448
324	Ga0496115_0141395	3300048918	Bacteria	1986
325	Ga0496126_0034222	3300048929	Bacteria	4774
326	Ga0496126_0068934	3300048929	Bacteria	3156
327	Ga0496126_0257728	3300048929	Bacteria	1451
328	Ga0496126_0334751	3300048929	Bacteria	1241
329	Ga0501031_0000253	3300049568	Bacteria	29955
330	Ga0501032_0000273	3300049569	Bacteria	43466
331	Ga0501033_0000098	3300049570	Bacteria	82803
332	Ga0501033_0016064	3300049570	Bacteria	5669
333	Ga0501034_0000175	3300049571	Bacteria	119465
334	Ga0501034_0071599	3300049571	Bacteria	3476
335	Ga0501034_0099314	3300049571	Bacteria	2906
336	Ga0501034_0276419	3300049571	Bacteria	1619
337	Ga0501036_0000049	3300049572	Bacteria	75400
338	Ga0501036_0124662	3300049572	Bacteria	2175
339	Ga0501037_0000069	3300049573	Bacteria	95277
340	Ga0501037_0007282	3300049573	Bacteria	8086
341	Ga0501038_0000034	3300049574	Bacteria	128854
342	Ga0501038_0040635	3300049574	Bacteria	4059
343	Ga0501039_0000090	3300049575	Bacteria	63919
344	Ga0501041_0159092	3300049577	Unclassified	1412
345	Ga0501042_0048223	3300049578	Bacteria	3037
346	Ga0501043_0000130	3300049579	Bacteria	69795
347	Ga0501046_0000213	3300049580	Bacteria	60602
348	Ga0501047_0000255	3300049581	Bacteria	62993
349	Ga0501047_0022474	3300049581	Bacteria	6057
350	Ga0501047_0306940	3300049581	Unclassified	1428
351	Ga0501048_0000252	3300049582	Bacteria	35941
352	Ga0501067_0005565	3300049583	Bacteria	6985
353	Ga0501068_0000197	3300049584	Bacteria	28590
354	Ga0501069_0000614	3300049585	Bacteria	16508
355	Ga0501070_0017034	3300049586	Bacteria	6098
356	Ga0501070_0217230	3300049586	Bacteria	1568
357	Ga0501071_0079809	3300049587	Bacteria	2393
358	Ga0501072_0000146	3300049588	Bacteria	52958
359	Ga0501072_0003615	3300049588	Bacteria	11638
360	Ga0501073_0000035	3300049589	Bacteria	94077
361	Ga0501074_0000512	3300049590	Bacteria	23801
362	Ga0501074_0184705	3300049590	Bacteria	1487
363	Ga0501076_0352398	3300049592	Bacteria	1209
364	Ga0501079_0006468	3300049741	Bacteria	8803
365	Ga0501079_0109366	3300049741	Bacteria	2147
366	Ga0501079_0495680	3300049741	Bacteria	960
367	Ga0501080_0000379	3300049742	Bacteria	34215
368	Ga0501083_0000740	3300049744	Bacteria	21322
369	Ga0501083_0014966	3300049744	Bacteria	5429
370	Ga0501035_0000894	3300049822	Bacteria	31549
371	Ga0501035_0041424	3300049822	Bacteria	4158
372	Ga0501044_0000461	3300049823	Bacteria	49470
373	Ga0501044_0068544	3300049823	Bacteria	3613
374	Ga0501044_0138446	3300049823	Bacteria	2424
375	Ga0501044_0487224	3300049823	Bacteria	1135
376	Ga0501045_0185132	3300049824	Bacteria	1551
377	nmdc:mga0k408_13880_c1	3300050493	Bacteria	4427
378	nmdc:mga06z11_280984_c1	3300050494	Bacteria	986
379	nmdc:mga05p37_34487_c1	3300050507	Bacteria	6200
380	nmdc:mga05p37_39609_c1	3300050507	Bacteria	5786
381	nmdc:mga05p37_46972_c1	3300050507	Bacteria	5310
382	nmdc:mga05p37_61015_c1	3300050507	Bacteria	4643
383	nmdc:mga09592_8882_c1	3300050508	Bacteria	8174
384	nmdc:mga0qj67_2731_c1	3300050509	Bacteria	12654
385	nmdc:mga06r32_14522_c1	3300050510	Bacteria	7147
386	nmdc:mga06r32_29152_c1	3300050510	Bacteria	5170
387	nmdc:mga08y16_10647_c1	3300050511	Bacteria	9652
388	nmdc:mga08y16_188801_c1	3300050511	Bacteria	2138
389	nmdc:mga08y16_253297_c1	3300050511	Bacteria	1819
390	nmdc:mga08y16_3328_c1	3300050511	Bacteria	16645
391	nmdc:mga0n895_1423_c1	3300050512	Bacteria	17899
392	nmdc:mga0n895_291694_c1	3300050512	Bacteria	1654
393	nmdc:mga0n895_65971_c1	3300050512	Bacteria	3584
394	nmdc:mga0rr50_43346_c1	3300050513	Bacteria	3292
395	nmdc:mga0a205_1897_c1	3300050515	Bacteria	18155
396	nmdc:mga0a205_36000_c1	3300050515	Bacteria	4755
397	nmdc:mga0a205_78511_c1	3300050515	Bacteria	3189
398	Ga0495601_0071609	3300053077	Bacteria	2214
399	Ga0495601_0230925	3300053077	Bacteria	1208
400	Ga0495612_0128068	3300053078	Bacteria	1095
401	Ga0495595_0005602	3300053084	Bacteria	5083
402	Ga0495595_0030759	3300053084	Bacteria	2409
403	Ga0500593_026055	3300053117	Bacteria	2604
404	Ga0500595_007567	3300053119	Bacteria	4497
405	Ga0500642_0023155	3300053130	Bacteria	2489
406	Ga0500568_0010046	3300053139	Bacteria	4460
407	Ga0500568_0012453	3300053139	Bacteria	3911
408	Ga0500603_001016	3300053150	Bacteria	6609
409	Ga0500616_0000045	3300053153	Bacteria	339292
410	Ga0500616_0037918	3300053153	Bacteria	2606
411	Ga0500637_0018847	3300053178	Bacteria	3713
412	Ga0500645_045935	3300053730	Bacteria	1282
413	Ga0501084_0001610	3300054114	Bacteria	17890
414	Ga0501084_0055775	3300054114	Bacteria	3306
415	Ga0501082_0154098	3300060353	Bacteria	1996
416	Ga0466962_0033026	3300061719	Bacteria	2476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046511	Ga0495608_0004291	Ga0495608_0004291_7006_7743	223
2	3300049823	Ga0501044_0487224	Ga0501044_0487224_360_1103	223
3	3300046678	Ga0495599_0141215	Ga0495599_0141215_728_1468	224
4	3300035117	Ga0373953_0083922	Ga0373953_0083922_13_759	226
5	3300046454	Ga0495592_0022576	Ga0495592_0022576_3993_4739	226
6	3300046516	Ga0495628_0447398	Ga0495628_0447398_44_790	226
7	3300005289	Ga0065704_10086301	Ga0065704_100863012	240
8	3300048929	Ga0496126_0334751	Ga0496126_0334751_34_825	241
9	3300006048	Ga0075363_100027593	Ga0075363_1000275933	247
10	3300006177	Ga0075362_10009809	Ga0075362_100098094	247
11	3300006178	Ga0075367_10082812	Ga0075367_100828122	247
12	3300031711	Ga0265314_10004396	Ga0265314_100043963	247
13	3300053117	Ga0500593_026055	Ga0500593_026055_214_1080	253
14	3300053153	Ga0500616_0037918	Ga0500616_0037918_661_1482	254
15	3300005336	Ga0070680_100175905	Ga0070680_1001759052	256
16	3300005530	Ga0070679_100219248	Ga0070679_1002192482	257
17	3300006178	Ga0075367_10353450	Ga0075367_103534501	257
18	3300025921	Ga0207652_10038928	Ga0207652_100389282	257
19	3300049588	Ga0501072_0003615	Ga0501072_0003615_8673_9512	257
20	3300050494	nmdc:mga06z11_280984_c1	nmdc:mga06z11_280984_c1_81_926	257
21	3300054114	Ga0501084_0055775	Ga0501084_0055775_1984_2823	257
22	3300021377	Ga0213874_10000567	Ga0213874_100005675	258
23	3300046680	Ga0495646_0076741	Ga0495646_0076741_1091_1933	258
24	3300048915	Ga0496112_0000009	Ga0496112_0000009_71580_72449	259
25	3300003203	JGI25406J46586_10000029	JGI25406J46586_100000298	261
26	3300003203	JGI25406J46586_10000046	JGI25406J46586_1000004638	261
27	3300003659	JGI25404J52841_10007954	JGI25404J52841_100079542	261
28	3300005563	Ga0068855_100597804	Ga0068855_1005978042	261
29	3300005983	Ga0081540_1002393	Ga0081540_100239310	261
30	3300005985	Ga0081539_10000379	Ga0081539_1000037930	261
31	3300025913	Ga0207695_10013714	Ga0207695_100137147	261
32	3300026078	Ga0207702_10161264	Ga0207702_101612641	261
33	3300046507	Ga0495606_0005157	Ga0495606_0005157_381_1256	261
34	3300049571	Ga0501034_0099314	Ga0501034_0099314_1054_1914	264
35	3300003215	JGI25153J46596_10005621	JGI25153J46596_100056214	265
36	3300003659	JGI25404J52841_10001763	JGI25404J52841_100017634	265
37	3300005439	Ga0070711_100111928	Ga0070711_1001119282	265
38	3300005539	Ga0068853_100318170	Ga0068853_1003181702	265
39	3300005843	Ga0068860_100297689	Ga0068860_1002976892	265
40	3300005983	Ga0081540_1000092	Ga0081540_100009279	265
41	3300006177	Ga0075362_10112457	Ga0075362_101124571	265
42	3300006195	Ga0075366_10036360	Ga0075366_100363604	265
43	3300025297	Ga0209758_1000385	Ga0209758_100038549	265
44	3300028381	Ga0268264_10197073	Ga0268264_101970731	265
45	3300031241	Ga0265325_10001324	Ga0265325_100013247	265
46	3300035172	Ga0373955_0159826	Ga0373955_0159826_88_960	265
47	3300036401	Ga0373937_0680157	Ga0373937_0680157_17_886	265
48	3300046462	Ga0495651_0009955	Ga0495651_0009955_3423_4295	265
49	3300046678	Ga0495599_0010777	Ga0495599_0010777_930_1802	265
50	3300048918	Ga0496115_0047079	Ga0496115_0047079_1107_1976	265
51	3300049741	Ga0501079_0495680	Ga0501079_0495680_68_937	265
52	3300050493	nmdc:mga0k408_13880_c1	nmdc:mga0k408_13880_c1_2522_3391	265
53	3300053130	Ga0500642_0023155	Ga0500642_0023155_1037_1906	265
54	3300005435	Ga0070714_100125981	Ga0070714_1001259812	266
55	3300005536	Ga0070697_100032268	Ga0070697_1000322683	266
56	3300005614	Ga0068856_100161378	Ga0068856_1001613783	266
57	3300005981	Ga0081538_10026067	Ga0081538_100260673	266
58	3300006175	Ga0070712_100111080	Ga0070712_1001110802	266
59	3300009545	Ga0105237_10203922	Ga0105237_102039222	266
60	3300011119	Ga0105246_10147407	Ga0105246_101474073	266
61	3300013102	Ga0157371_10136463	Ga0157371_101364633	266
62	3300013296	Ga0157374_10401137	Ga0157374_104011372	266
63	3300013306	Ga0163162_10179305	Ga0163162_101793053	266
64	3300013308	Ga0157375_10507018	Ga0157375_105070182	266
65	3300014969	Ga0157376_10123813	Ga0157376_101238132	266
66	3300025929	Ga0207664_10043386	Ga0207664_100433862	266
67	3300031241	Ga0265325_10055552	Ga0265325_100555522	266
68	3300031250	Ga0265331_10083514	Ga0265331_100835143	266
69	3300031711	Ga0265314_10048526	Ga0265314_100485263	266
70	3300031711	Ga0265314_10050028	Ga0265314_100500283	266
71	3300031712	Ga0265342_10002326	Ga0265342_100023265	266
72	3300031712	Ga0265342_10031762	Ga0265342_100317623	266
73	3300035111	Ga0373923_0069914	Ga0373923_0069914_132_998	266
74	3300035118	Ga0373954_0029314	Ga0373954_0029314_1279_2145	266
75	3300035120	Ga0373957_0097548	Ga0373957_0097548_82_954	266
76	3300035172	Ga0373955_0039507	Ga0373955_0039507_1409_2281	266
77	3300035692	Ga0373935_0115269	Ga0373935_0115269_503_1369	266
78	3300035724	Ga0373933_0027590	Ga0373933_0027590_229_1101	266
79	3300036401	Ga0373937_0006193	Ga0373937_0006193_2228_3100	266
80	3300036401	Ga0373937_0029734	Ga0373937_0029734_2912_3778	266
81	3300046462	Ga0495651_0013189	Ga0495651_0013189_653_1519	266
82	3300046462	Ga0495651_0122609	Ga0495651_0122609_147_1019	266
83	3300046463	Ga0495653_0071471	Ga0495653_0071471_660_1526	266
84	3300046477	Ga0495664_0093589	Ga0495664_0093589_819_1685	266
85	3300046511	Ga0495608_0234098	Ga0495608_0234098_135_1007	266
86	3300046516	Ga0495628_0178306	Ga0495628_0178306_565_1431	266
87	3300046529	Ga0495652_0064518	Ga0495652_0064518_96_962	266
88	3300046536	Ga0495587_0038401	Ga0495587_0038401_11_883	266
89	3300046642	Ga0495634_0131599	Ga0495634_0131599_542_1408	266
90	3300046675	Ga0495657_0122429	Ga0495657_0122429_610_1503	266
91	3300046678	Ga0495599_0064228	Ga0495599_0064228_1074_1940	266
92	3300046679	Ga0495623_0022661	Ga0495623_0022661_454_1320	266
93	3300046679	Ga0495623_0144670	Ga0495623_0144670_445_1317	266
94	3300046809	Ga0495600_0067080	Ga0495600_0067080_113_979	266
95	3300047317	Ga0495604_0160772	Ga0495604_0160772_77_943	266
96	3300047317	Ga0495604_0243035	Ga0495604_0243035_10_903	266
97	3300047319	Ga0495674_0091357	Ga0495674_0091357_65_931	266
98	3300047322	Ga0495680_0204271	Ga0495680_0204271_44_916	266
99	3300047322	Ga0495680_0326731	Ga0495680_0326731_113_979	266
100	3300047444	Ga0495675_0007264	Ga0495675_0007264_2684_3550	266
101	3300047444	Ga0495675_0046426	Ga0495675_0046426_124_996	266
102	3300048909	Ga0496106_0019163	Ga0496106_0019163_2084_2950	266
103	3300048911	Ga0496108_0022515	Ga0496108_0022515_2683_3549	266
104	3300048913	Ga0496110_0093036	Ga0496110_0093036_1684_2550	266
105	3300048915	Ga0496112_0059619	Ga0496112_0059619_55_921	266
106	3300048917	Ga0496114_0092700	Ga0496114_0092700_826_1692	266
107	3300048929	Ga0496126_0068934	Ga0496126_0068934_298_1164	266
108	3300049568	Ga0501031_0000253	Ga0501031_0000253_16293_17159	266
109	3300049569	Ga0501032_0000273	Ga0501032_0000273_2808_3674	266
110	3300049570	Ga0501033_0000098	Ga0501033_0000098_12616_13482	266
111	3300049571	Ga0501034_0000175	Ga0501034_0000175_9925_10791	266
112	3300049572	Ga0501036_0000049	Ga0501036_0000049_23636_24502	266
113	3300049573	Ga0501037_0000069	Ga0501037_0000069_17602_18468	266
114	3300049574	Ga0501038_0000034	Ga0501038_0000034_54242_55108	266
115	3300049575	Ga0501039_0000090	Ga0501039_0000090_11751_12617	266
116	3300049577	Ga0501041_0159092	Ga0501041_0159092_310_1167	266
117	3300049578	Ga0501042_0048223	Ga0501042_0048223_1498_2364	266
118	3300049579	Ga0501043_0000130	Ga0501043_0000130_5423_6289	266
119	3300049580	Ga0501046_0000213	Ga0501046_0000213_6103_6969	266
120	3300049581	Ga0501047_0000255	Ga0501047_0000255_43074_43940	266
121	3300049582	Ga0501048_0000252	Ga0501048_0000252_10065_10931	266
122	3300049583	Ga0501067_0005565	Ga0501067_0005565_1563_2429	266
123	3300049584	Ga0501068_0000197	Ga0501068_0000197_4918_5784	266
124	3300049585	Ga0501069_0000614	Ga0501069_0000614_7144_8010	266
125	3300049586	Ga0501070_0017034	Ga0501070_0017034_1112_1978	266
126	3300049588	Ga0501072_0000146	Ga0501072_0000146_39400_40266	266
127	3300049589	Ga0501073_0000035	Ga0501073_0000035_71852_72718	266
128	3300049590	Ga0501074_0000512	Ga0501074_0000512_9197_10063	266
129	3300049590	Ga0501074_0184705	Ga0501074_0184705_238_1095	266
130	3300049592	Ga0501076_0352398	Ga0501076_0352398_45_902	266
131	3300049741	Ga0501079_0006468	Ga0501079_0006468_6144_7010	266
132	3300049742	Ga0501080_0000379	Ga0501080_0000379_27358_28224	266
133	3300049744	Ga0501083_0000740	Ga0501083_0000740_9496_10362	266
134	3300049822	Ga0501035_0000894	Ga0501035_0000894_21360_22226	266
135	3300049823	Ga0501044_0000461	Ga0501044_0000461_19054_19920	266
136	3300049823	Ga0501044_0138446	Ga0501044_0138446_1494_2360	266
137	3300049824	Ga0501045_0185132	Ga0501045_0185132_191_1057	266
138	3300053077	Ga0495601_0230925	Ga0495601_0230925_197_1063	266
139	3300053078	Ga0495612_0128068	Ga0495612_0128068_196_1062	266
140	3300053084	Ga0495595_0005602	Ga0495595_0005602_2023_2895	266
141	3300054114	Ga0501084_0001610	Ga0501084_0001610_11149_12015	266
142	3300060353	Ga0501082_0154098	Ga0501082_0154098_832_1698	266
143	3300005435	Ga0070714_100152502	Ga0070714_1001525022	267
144	3300005563	Ga0068855_100024338	Ga0068855_1000243381	267
145	3300005577	Ga0068857_100315663	Ga0068857_1003156631	267
146	3300006028	Ga0070717_10006490	Ga0070717_100064904	267
147	3300007265	Ga0099794_10071779	Ga0099794_100717792	267
148	3300007265	Ga0099794_10227771	Ga0099794_102277711	267
149	3300007788	Ga0099795_10057162	Ga0099795_100571621	267
150	3300009093	Ga0105240_10012909	Ga0105240_100129092	267
151	3300009545	Ga0105237_10050255	Ga0105237_100502552	267
152	3300009545	Ga0105237_10176765	Ga0105237_101767652	267
153	3300009551	Ga0105238_10009912	Ga0105238_100099124	267
154	3300009551	Ga0105238_10069128	Ga0105238_100691285	267
155	3300009551	Ga0105238_10253587	Ga0105238_102535872	267
156	3300010375	Ga0105239_10028810	Ga0105239_100288103	267
157	3300013105	Ga0157369_10771704	Ga0157369_107717041	267
158	3300025912	Ga0207707_10282833	Ga0207707_102828332	267
159	3300025914	Ga0207671_10022329	Ga0207671_100223292	267
160	3300025924	Ga0207694_10333189	Ga0207694_103331892	267
161	3300026116	Ga0207674_10038819	Ga0207674_100388192	267
162	3300028379	Ga0268266_10343692	Ga0268266_103436922	267
163	3300031247	Ga0265340_10015690	Ga0265340_100156901	267
164	3300035724	Ga0373933_0000117	Ga0373933_0000117_46220_47089	267
165	3300006846	Ga0075430_100182289	Ga0075430_1001822892	268
166	3300025915	Ga0207693_10176059	Ga0207693_101760593	268
167	3300044684	Ga0466966_0073546	Ga0466966_0073546_353_1225	268
168	3300045049	Ga0466959_0059463	Ga0466959_0059463_1126_1998	268
169	3300049571	Ga0501034_0276419	Ga0501034_0276419_523_1413	268
170	3300049586	Ga0501070_0217230	Ga0501070_0217230_181_1071	268
171	3300049587	Ga0501071_0079809	Ga0501071_0079809_741_1631	268
172	3300050507	nmdc:mga05p37_39609_c1	nmdc:mga05p37_39609_c1_2156_3019	268
173	3300050510	nmdc:mga06r32_29152_c1	nmdc:mga06r32_29152_c1_2494_3357	268
174	3300005434	Ga0070709_10006444	Ga0070709_100064445	269
175	3300005436	Ga0070713_100004379	Ga0070713_1000043793	269
176	3300005437	Ga0070710_10000395	Ga0070710_1000039510	269
177	3300005439	Ga0070711_100002765	Ga0070711_1000027655	269
178	3300005539	Ga0068853_100020739	Ga0068853_1000207393	269
179	3300005563	Ga0068855_100063261	Ga0068855_1000632615	269
180	3300005577	Ga0068857_100017252	Ga0068857_1000172525	269
181	3300005578	Ga0068854_100059936	Ga0068854_1000599363	269
182	3300005578	Ga0068854_100100181	Ga0068854_1001001812	269
183	3300005614	Ga0068856_100005597	Ga0068856_10000559714	269
184	3300005614	Ga0068856_100007904	Ga0068856_10000790410	269
185	3300005614	Ga0068856_100299381	Ga0068856_1002993811	269
186	3300005615	Ga0070702_100240321	Ga0070702_1002403211	269
187	3300005834	Ga0068851_10023270	Ga0068851_100232703	269
188	3300005937	Ga0081455_10054171	Ga0081455_100541713	269
189	3300005937	Ga0081455_10211460	Ga0081455_102114602	269
190	3300005983	Ga0081540_1014797	Ga0081540_10147975	269
191	3300006028	Ga0070717_10069158	Ga0070717_100691582	269
192	3300006028	Ga0070717_10212860	Ga0070717_102128602	269
193	3300006163	Ga0070715_10000129	Ga0070715_1000012917	269
194	3300006173	Ga0070716_100042320	Ga0070716_1000423202	269
195	3300006175	Ga0070712_100045419	Ga0070712_1000454193	269
196	3300006847	Ga0075431_100370726	Ga0075431_1003707262	269
197	3300006852	Ga0075433_10050355	Ga0075433_100503552	269
198	3300006871	Ga0075434_100007425	Ga0075434_10000742511	269
199	3300009093	Ga0105240_10003456	Ga0105240_1000345622	269
200	3300009093	Ga0105240_10012779	Ga0105240_100127793	269
201	3300009094	Ga0111539_10167605	Ga0111539_101676053	269
202	3300009174	Ga0105241_10026767	Ga0105241_100267675	269
203	3300009545	Ga0105237_10122566	Ga0105237_101225662	269
204	3300009551	Ga0105238_10015239	Ga0105238_100152393	269
205	3300013105	Ga0157369_10005789	Ga0157369_100057893	269
206	3300013105	Ga0157369_10156101	Ga0157369_101561012	269
207	3300013307	Ga0157372_10073580	Ga0157372_100735803	269
208	3300025321	Ga0207656_10052123	Ga0207656_100521233	269
209	3300025905	Ga0207685_10000490	Ga0207685_100004906	269
210	3300025911	Ga0207654_10000344	Ga0207654_1000034418	269
211	3300025913	Ga0207695_10000402	Ga0207695_1000040227	269
212	3300025914	Ga0207671_10333935	Ga0207671_103339352	269
213	3300025914	Ga0207671_10405995	Ga0207671_104059951	269
214	3300025915	Ga0207693_10003086	Ga0207693_100030863	269
215	3300025916	Ga0207663_10001974	Ga0207663_100019742	269
216	3300025924	Ga0207694_10000095	Ga0207694_1000009578	269
217	3300025924	Ga0207694_10254022	Ga0207694_102540222	269
218	3300025929	Ga0207664_10373622	Ga0207664_103736222	269
219	3300025939	Ga0207665_10000455	Ga0207665_1000045511	269
220	3300025949	Ga0207667_10025159	Ga0207667_100251593	269
221	3300025981	Ga0207640_10010573	Ga0207640_100105733	269
222	3300026041	Ga0207639_10010954	Ga0207639_100109544	269
223	3300026075	Ga0207708_10099214	Ga0207708_100992142	269
224	3300026078	Ga0207702_10000025	Ga0207702_1000002577	269
225	3300026078	Ga0207702_10000075	Ga0207702_1000007577	269
226	3300026116	Ga0207674_10090885	Ga0207674_100908853	269
227	3300027907	Ga0207428_10107141	Ga0207428_101071413	269
228	3300031249	Ga0265339_10137539	Ga0265339_101375391	269
229	3300035086	Ga0373934_0071708	Ga0373934_0071708_419_1285	269
230	3300035172	Ga0373955_0119765	Ga0373955_0119765_508_1374	269
231	3300035695	Ga0373927_0013854	Ga0373927_0013854_3493_4470	269
232	3300035725	Ga0373947_0079709	Ga0373947_0079709_931_1908	269
233	3300036401	Ga0373937_0001453	Ga0373937_0001453_9298_10164	269
234	3300036401	Ga0373937_0261573	Ga0373937_0261573_351_1217	269
235	3300037068	Ga0373925_0190472	Ga0373925_0190472_636_1613	269
236	3300037312	Ga0395899_0362009	Ga0395899_0362009_26_901	269
237	3300037418	Ga0395900_0045159	Ga0395900_0045159_713_1579	269
238	3300037418	Ga0395900_0168173	Ga0395900_0168173_380_1255	269
239	3300037418	Ga0395900_0313488	Ga0395900_0313488_521_1396	269
240	3300037466	Ga0395898_0031296	Ga0395898_0031296_3542_4408	269
241	3300037466	Ga0395898_0115736	Ga0395898_0115736_1162_2037	269
242	3300037466	Ga0395898_0132567	Ga0395898_0132567_1301_2176	269
243	3300038443	Ga0395901_0081416	Ga0395901_0081416_1334_2206	269
244	3300038443	Ga0395901_0209024	Ga0395901_0209024_510_1376	269
245	3300039437	Ga0436365_0505726	Ga0436365_0505726_303_1178	269
246	3300039450	Ga0436363_1471794	Ga0436363_1471794_3307_4182	269
247	3300046455	Ga0495603_0013152	Ga0495603_0013152_40_915	269
248	3300046473	Ga0495582_0013425	Ga0495582_0013425_1860_2837	269
249	3300046524	Ga0495648_0000494	Ga0495648_0000494_16178_17053	269
250	3300046531	Ga0495665_0202644	Ga0495665_0202644_94_975	269
251	3300046689	Ga0495613_0285931	Ga0495613_0285931_186_1052	269
252	3300048907	Ga0496104_0119262	Ga0496104_0119262_1210_2097	269
253	3300048907	Ga0496104_0202042	Ga0496104_0202042_942_1817	269
254	3300048908	Ga0496105_0057773	Ga0496105_0057773_240_1127	269
255	3300048910	Ga0496107_0014946	Ga0496107_0014946_247_1134	269
256	3300048911	Ga0496108_0007772	Ga0496108_0007772_3534_4421	269
257	3300048912	Ga0496109_0002542	Ga0496109_0002542_1477_2364	269
258	3300048913	Ga0496110_0018167	Ga0496110_0018167_1200_2087	269
259	3300048915	Ga0496112_0145526	Ga0496112_0145526_1378_2265	269
260	3300048918	Ga0496115_0141395	Ga0496115_0141395_1014_1889	269
261	3300048929	Ga0496126_0034222	Ga0496126_0034222_2824_3699	269
262	3300048929	Ga0496126_0257728	Ga0496126_0257728_471_1352	269
263	3300049570	Ga0501033_0016064	Ga0501033_0016064_172_1050	269
264	3300049571	Ga0501034_0071599	Ga0501034_0071599_362_1237	269
265	3300049572	Ga0501036_0124662	Ga0501036_0124662_476_1351	269
266	3300049573	Ga0501037_0007282	Ga0501037_0007282_2322_3197	269
267	3300049574	Ga0501038_0040635	Ga0501038_0040635_428_1303	269
268	3300049581	Ga0501047_0022474	Ga0501047_0022474_3891_4766	269
269	3300049581	Ga0501047_0306940	Ga0501047_0306940_492_1376	269
270	3300049744	Ga0501083_0014966	Ga0501083_0014966_1655_2521	269
271	3300049822	Ga0501035_0041424	Ga0501035_0041424_52_930	269
272	3300049823	Ga0501044_0068544	Ga0501044_0068544_462_1340	269
273	3300050511	nmdc:mga08y16_188801_c1	nmdc:mga08y16_188801_c1_927_1808	269
274	3300050512	nmdc:mga0n895_291694_c1	nmdc:mga0n895_291694_c1_59_940	269
275	3300050515	nmdc:mga0a205_78511_c1	nmdc:mga0a205_78511_c1_247_1128	269
276	3300053119	Ga0500595_007567	Ga0500595_007567_1170_2045	269
277	3300053139	Ga0500568_0010046	Ga0500568_0010046_821_1696	269
278	3300053139	Ga0500568_0012453	Ga0500568_0012453_751_1620	269
279	3300053150	Ga0500603_001016	Ga0500603_001016_5314_6189	269
280	3300053153	Ga0500616_0000045	Ga0500616_0000045_90056_90934	269
281	3300053178	Ga0500637_0018847	Ga0500637_0018847_2416_3291	269
282	3300061719	Ga0466962_0033026	Ga0466962_0033026_503_1375	269
283	3300005436	Ga0070713_100205365	Ga0070713_1002053652	270
284	3300005455	Ga0070663_100299784	Ga0070663_1002997842	270
285	3300005618	Ga0068864_100310209	Ga0068864_1003102092	270
286	3300006844	Ga0075428_100316846	Ga0075428_1003168462	270
287	3300007076	Ga0075435_100084722	Ga0075435_1000847222	270
288	3300009094	Ga0111539_10053716	Ga0111539_100537165	270
289	3300009101	Ga0105247_10003320	Ga0105247_100033204	270
290	3300009147	Ga0114129_10057722	Ga0114129_100577222	270
291	3300009177	Ga0105248_10010337	Ga0105248_100103374	270
292	3300010375	Ga0105239_10121301	Ga0105239_101213012	270
293	3300014325	Ga0163163_10000552	Ga0163163_1000055212	270
294	3300014968	Ga0157379_10113974	Ga0157379_101139742	270
295	3300025900	Ga0207710_10016597	Ga0207710_100165972	270
296	3300026088	Ga0207641_10185345	Ga0207641_101853452	270
297	3300026095	Ga0207676_10220680	Ga0207676_102206802	270
298	3300035113	Ga0373936_0054480	Ga0373936_0054480_631_1509	270
299	3300046615	Ga0495656_0078006	Ga0495656_0078006_44_928	270
300	3300048907	Ga0496104_0061610	Ga0496104_0061610_2215_3081	270
301	3300048909	Ga0496106_0055825	Ga0496106_0055825_1532_2398	270
302	3300048912	Ga0496109_0008251	Ga0496109_0008251_3782_4648	270
303	3300048914	Ga0496111_0009058	Ga0496111_0009058_1776_2642	270
304	3300048915	Ga0496112_0005502	Ga0496112_0005502_704_1570	270
305	3300048916	Ga0496113_0010440	Ga0496113_0010440_5012_5878	270
306	3300050507	nmdc:mga05p37_61015_c1	nmdc:mga05p37_61015_c1_2614_3486	270
307	3300050511	nmdc:mga08y16_253297_c1	nmdc:mga08y16_253297_c1_505_1458	270
308	3300005937	Ga0081455_10001069	Ga0081455_100010699	271
309	3300007788	Ga0099795_10012034	Ga0099795_100120342	271
310	3300053730	Ga0500645_045935	Ga0500645_045935_260_1132	271
311	3300005844	Ga0068862_100017409	Ga0068862_1000174095	272
312	3300006844	Ga0075428_100006018	Ga0075428_1000060183	272
313	3300006846	Ga0075430_100000026	Ga0075430_10000002671	272
314	3300006847	Ga0075431_100004659	Ga0075431_1000046593	272
315	3300006852	Ga0075433_10002454	Ga0075433_1000245414	272
316	3300006871	Ga0075434_100010735	Ga0075434_1000107358	272
317	3300006880	Ga0075429_100003174	Ga0075429_10000317414	272
318	3300009094	Ga0111539_10004795	Ga0111539_100047953	272
319	3300009147	Ga0114129_10054899	Ga0114129_100548994	272
320	3300025315	Ga0207697_10030249	Ga0207697_100302493	272
321	3300025926	Ga0207659_10097602	Ga0207659_100976022	272
322	3300025961	Ga0207712_10152290	Ga0207712_101522902	272
323	3300027717	Ga0209998_10002333	Ga0209998_100023332	272
324	3300027717	Ga0209998_10035611	Ga0209998_100356112	272
325	3300027907	Ga0207428_10000140	Ga0207428_1000014035	272
326	3300042876	Ga0451577_0096353	Ga0451577_0096353_1081_1956	272
327	3300050507	nmdc:mga05p37_46972_c1	nmdc:mga05p37_46972_c1_2902_3777	272
328	3300050508	nmdc:mga09592_8882_c1	nmdc:mga09592_8882_c1_6336_7211	272
329	3300050509	nmdc:mga0qj67_2731_c1	nmdc:mga0qj67_2731_c1_6243_7118	272
330	3300050510	nmdc:mga06r32_14522_c1	nmdc:mga06r32_14522_c1_1650_2525	272
331	3300050511	nmdc:mga08y16_3328_c1	nmdc:mga08y16_3328_c1_9307_10182	272
332	3300050512	nmdc:mga0n895_1423_c1	nmdc:mga0n895_1423_c1_1650_2525	272
333	3300050515	nmdc:mga0a205_1897_c1	nmdc:mga0a205_1897_c1_11456_12331	272
334	2209111006	2214761881	2213777749	273
335	3300000041	ARcpr5oldR_c000454	ARcpr5oldR_0004544	273
336	3300000042	ARSoilYngRDRAFT_c00416	ARSoilYngRDRAFT_004163	273
337	3300000043	ARcpr5yngRDRAFT_c000356	ARcpr5yngRDRAFT_0003563	273
338	3300000044	ARSoilOldRDRAFT_c000325	ARSoilOldRDRAFT_0003256	273
339	3300000045	ARCol0oldRDRAFT_c00370	ARCol0oldRDRAFT_003703	273
340	3300000652	ARCol0yngRDRAFT_1000380	ARCol0yngRDRAFT_10003805	273
341	3300000652	ARCol0yngRDRAFT_1000422	ARCol0yngRDRAFT_10004223	273
342	3300005293	Ga0065715_10091447	Ga0065715_100914472	273
343	3300005295	Ga0065707_10103672	Ga0065707_101036721	273
344	3300005330	Ga0070690_100024699	Ga0070690_1000246992	273
345	3300005335	Ga0070666_10140370	Ga0070666_101403702	273
346	3300005336	Ga0070680_100009626	Ga0070680_1000096268	273
347	3300005336	Ga0070680_100294013	Ga0070680_1002940132	273
348	3300005337	Ga0070682_100147826	Ga0070682_1001478262	273
349	3300005340	Ga0070689_100004817	Ga0070689_1000048177	273
350	3300005343	Ga0070687_100026704	Ga0070687_1000267041	273
351	3300005347	Ga0070668_100067299	Ga0070668_1000672992	273
352	3300005406	Ga0070703_10092984	Ga0070703_100929841	273
353	3300005440	Ga0070705_100273186	Ga0070705_1002731862	273
354	3300005444	Ga0070694_100159148	Ga0070694_1001591482	273
355	3300005455	Ga0070663_100379721	Ga0070663_1003797211	273
356	3300005457	Ga0070662_100062035	Ga0070662_1000620351	273
357	3300005459	Ga0068867_100021472	Ga0068867_1000214725	273
358	3300005471	Ga0070698_100327957	Ga0070698_1003279572	273
359	3300005530	Ga0070679_100365663	Ga0070679_1003656632	273
360	3300005617	Ga0068859_100098574	Ga0068859_1000985743	273
361	3300005937	Ga0081455_10012384	Ga0081455_100123846	273
362	3300006852	Ga0075433_10141232	Ga0075433_101412322	273
363	3300006871	Ga0075434_100087434	Ga0075434_1000874342	273
364	3300006931	Ga0097620_100098579	Ga0097620_1000985793	273
365	3300009094	Ga0111539_10001514	Ga0111539_1000151420	273
366	3300009148	Ga0105243_10037512	Ga0105243_100375124	273
367	3300009176	Ga0105242_10122413	Ga0105242_101224132	273
368	3300009545	Ga0105237_10283950	Ga0105237_102839502	273
369	3300010375	Ga0105239_10055535	Ga0105239_100555352	273
370	3300012500	Ga0157314_1003318	Ga0157314_10033181	273
371	3300012515	Ga0157338_1006007	Ga0157338_10060072	273
372	3300013306	Ga0163162_10031094	Ga0163162_100310942	273
373	3300013307	Ga0157372_10188165	Ga0157372_101881652	273
374	3300013308	Ga0157375_10082173	Ga0157375_100821733	273
375	3300014326	Ga0157380_10085345	Ga0157380_100853452	273
376	3300025904	Ga0207647_10048628	Ga0207647_100486282	273
377	3300025917	Ga0207660_10197237	Ga0207660_101972372	273
378	3300025918	Ga0207662_10007791	Ga0207662_100077912	273
379	3300025933	Ga0207706_10019089	Ga0207706_100190897	273
380	3300025936	Ga0207670_10122785	Ga0207670_101227852	273
381	3300026041	Ga0207639_10030216	Ga0207639_100302162	273
382	3300026075	Ga0207708_10015978	Ga0207708_100159786	273
383	3300026089	Ga0207648_10157612	Ga0207648_101576122	273
384	3300026118	Ga0207675_100301765	Ga0207675_1003017652	273
385	3300027907	Ga0207428_10000911	Ga0207428_1000091112	273
386	3300034818	Ga0373950_0000831	Ga0373950_0000831_1212_2087	273
387	3300034819	Ga0373958_0002463	Ga0373958_0002463_206_1081	273
388	3300034820	Ga0373959_0001308	Ga0373959_0001308_1533_2408	273
389	3300034957	Ga0373938_0001543	Ga0373938_0001543_2679_3554	273
390	3300035088	Ga0373940_0000089	Ga0373940_0000089_6955_7830	273
391	3300035091	Ga0373951_0000964	Ga0373951_0000964_1584_2459	273
392	3300035092	Ga0373952_0025653	Ga0373952_0025653_343_1218	273
393	3300035114	Ga0373939_0038294	Ga0373939_0038294_343_1218	273
394	3300035115	Ga0373941_0000195	Ga0373941_0000195_2162_3037	273
395	3300035121	Ga0373960_0001230	Ga0373960_0001230_2812_3687	273
396	3300035207	Ga0373942_0000043	Ga0373942_0000043_14740_15615	273
397	3300035242	Ga0373962_0010077	Ga0373962_0010077_1352_2227	273
398	3300035691	Ga0373931_0003696	Ga0373931_0003696_1352_2227	273
399	3300038996	Ga0242420_003428	Ga0242420_003428_1097_1972	273
400	3300045051	Ga0451576_0611550	Ga0451576_0611550_136_1011	273
401	3300046452	Ga0495617_019649	Ga0495617_019649_1302_2186	273
402	3300046615	Ga0495656_0003896	Ga0495656_0003896_3842_4726	273
403	3300048903	Ga0496100_0187713	Ga0496100_0187713_530_1429	273
404	3300048907	Ga0496104_0134386	Ga0496104_0134386_517_1416	273
405	3300048910	Ga0496107_0015668	Ga0496107_0015668_2306_3181	273
406	3300048911	Ga0496108_0255783	Ga0496108_0255783_287_1186	273
407	3300048913	Ga0496110_0325868	Ga0496110_0325868_272_1147	273
408	3300048917	Ga0496114_0046004	Ga0496114_0046004_1939_2838	273
409	3300049741	Ga0501079_0109366	Ga0501079_0109366_404_1279	273
410	3300050507	nmdc:mga05p37_34487_c1	nmdc:mga05p37_34487_c1_123_998	273
411	3300050511	nmdc:mga08y16_10647_c1	nmdc:mga08y16_10647_c1_6071_6946	273
412	3300050512	nmdc:mga0n895_65971_c1	nmdc:mga0n895_65971_c1_1029_1904	273
413	3300050513	nmdc:mga0rr50_43346_c1	nmdc:mga0rr50_43346_c1_574_1449	273
414	3300050515	nmdc:mga0a205_36000_c1	nmdc:mga0a205_36000_c1_1544_2419	273
415	3300053077	Ga0495601_0071609	Ga0495601_0071609_1003_1902	273
416	3300053084	Ga0495595_0030759	Ga0495595_0030759_494_1393	273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13468

Glyoxalase_3

Glyoxalase-like domain

39

226

0.79 PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

174

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3oa4-assembly1.cif.gz_A-2	crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125	0.7872	5	150
6qh4-assembly1.cif.gz_A	crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant	0.7604	1	150
3rmu-assembly2.cif.gz_D	crystal structure of human methylmalonyl-coa epimerase, mcee	0.7581	1	150
6qh4-assembly2.cif.gz_B	crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant	0.7477	1	150
6qh4-assembly1.cif.gz_C	crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant	0.7471	1	150

ID	Description	Score	Start	End	Superfamily
af_Q8I1S1_156_284_3.30.479.30	Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain	0.8475	112	138	3.30.479.30
af_P34406_1_98_3.10.450.50	Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;	0.8289	112	138	3.10.450.50
3oa4A01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.7872	5	150	3.10.180.10
6qh4A00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.7604	1	150	3.10.180.10
3oa4A01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.7492	5	150	3.10.180.10

ID	Description	Score	Start	End
AF-A0A4Q3H897-F1-model_v4	VOC family protein	0.9788	1	62
AF-A0A258CSY1-F1-model_v4	VOC domain-containing protein	0.9415	1	106
AF-A0A258K920-F1-model_v4	Glyoxalase-like domain-containing protein	0.9358	1	106
AF-A0A6J4WYG8-F1-model_v4	Glyoxalase-like domain-containing protein	0.9346	1	97
AF-A0A6L5FQZ0-F1-model_v4	VOC family protein	0.9219	1	268

Feature Viewer

pLDDT	pTM	Quality
80.01	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438856

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13468

Glyoxalase_3

Glyoxalase-like domain

39

226

0.79

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

174

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map