F433112

General Info

Members Datasets Scaffolds Average Seq Length
395 273 340 461

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10082218|Ga0065707_1008221814
Length 514
Sequence MYSQRSEKVPADSGSAGHCRQSFNASSASAAFESELPFAGDKRTIALAMNEMSALFLSRIQFGFVISFHIIFPAFTIGLGSWLAFLAGMYLKTHRTLWRELYLFWLKIFAVSFALGVVSGLVMSFQFGTNWSELSARAGNILGPLLAYEVLTAFFLEATFLGVMLFGWKRVSPGVHFFASCMVAVGTLISTFWILAANSWMHTPAGYAIVEGVFEPRDWAKIVFNPSFPYRLVHMTLGAFITTCFVIGGISATYLLRSRHVEAAQLMLKLAIGFAAITVPLQIFVGDLHGLEVREYQPMKLAAIEGHWETRRSAPLVLFAVPDEKNEINRYEVAIPKLGSLILTHDVNGEIKGLKSKPASERPPVVPVFFAFRAMVGIGMLMLLLVAWSALSWRRHRLQQSKAMLRAWMMMTPAGFIAVLAGWYTTEIGRQPYVIYGLMRTADAGSAVDASSVLTSLIVFATVYLFVFISGTYYLLKLLRKGPQPVADDMRHPNDKTSLRPLSLPDDSLEGNHG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
6 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221573 Lysobacter sp. Root604 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
19 2818991457 Xanthomonas translucens 569 Isolate Unclassified
20 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
21 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
22 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
23 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
24 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
25 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
26 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
27 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
28 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
29 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
30 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
31 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
32 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
33 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
34 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
35 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
36 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
37 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
38 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
39 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
43 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
44 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
45 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
46 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
47 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
48 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
49 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
223 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
268 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
269 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
270 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
271 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
272 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
273 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0
Isolates 13.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 16.46
Nodule 1.01
Rhizoplane 0.51
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3837291 2162886007 Bacteria 2774
2 JGI25152J39213_1000525 3300002773 Bacteria 21286
3 JGI25151J46595_10000693 3300003187 Bacteria 28389
4 JGI25153J46596_10009809 3300003215 Bacteria 4399
5 rootL2_10279950 3300003322 Bacteria 3969
6 Ga0055526_1000003 3300003771 Bacteria 413092
7 Ga0055526_1007078 3300003771 Bacteria 5927
8 Ga0055526_1016361 3300003771 Bacteria 2909
9 Ga0055537_1000287 3300003773 Bacteria 35894
10 Ga0055524_1000002 3300003775 Bacteria 459550
11 Ga0055524_1001701 3300003775 Bacteria 12261
12 Ga0055536_1003360 3300003781 Bacteria 8642
13 Ga0055534_1000050 3300003784 Bacteria 92561
14 Ga0055528_1000001 3300003790 Bacteria 402384
15 Ga0055528_1000295 3300003790 Bacteria 42305
16 Ga0055530_10002961 3300003791 Bacteria 10232
17 Ga0055531_10018707 3300003794 Bacteria 2845
18 Ga0055531_10020960 3300003794 Bacteria 2559
19 Ga0058692_1000062 3300003856 Bacteria 93121
20 Ga0065704_10004123 3300005289 Bacteria 5103
21 Ga0065712_10071340 3300005290 Bacteria 5329
22 Ga0065715_10091476 3300005293 Bacteria 5765
23 Ga0065707_10082218 3300005295 Bacteria 18935
24 Ga0070676_10004058 3300005328 Bacteria 7694
25 Ga0070683_100015340 3300005329 Bacteria 6726
26 Ga0070670_100000524 3300005331 Bacteria 30806
27 Ga0068869_100001869 3300005334 Bacteria 12650
28 Ga0070666_10057790 3300005335 Bacteria 2622
29 Ga0070680_100000968 3300005336 Bacteria 20318
30 Ga0070680_100007296 3300005336 Bacteria 8427
31 Ga0070680_100046383 3300005336 Bacteria 3535
32 Ga0070689_100000298 3300005340 Bacteria 28844
33 Ga0070692_10053527 3300005345 Bacteria 2105
34 Ga0070668_100002342 3300005347 Bacteria 13925
35 Ga0070668_100007940 3300005347 Bacteria 7880
36 Ga0070668_100015901 3300005347 Bacteria 5629
37 Ga0070668_100048514 3300005347 Bacteria 3266
38 Ga0070668_100068660 3300005347 Bacteria 2756
39 Ga0070669_100097911 3300005353 Bacteria 2209
40 Ga0070674_100030977 3300005356 Bacteria 3540
41 Ga0070673_100003142 3300005364 Bacteria 10229
42 Ga0070688_100000861 3300005365 Bacteria 15075
43 Ga0070667_100023050 3300005367 Bacteria 5164
44 Ga0070710_10055102 3300005437 Bacteria 2245
45 Ga0070701_10032265 3300005438 Bacteria 2607
46 Ga0070694_100062696 3300005444 Bacteria 2541
47 Ga0070678_100043867 3300005456 Bacteria 3189
48 Ga0070678_100080499 3300005456 Bacteria 2467
49 Ga0070684_100000398 3300005535 Bacteria 29681
50 Ga0070684_100118882 3300005535 Bacteria 2376
51 Ga0070672_100069883 3300005543 Bacteria 2789
52 Ga0070665_100020598 3300005548 Bacteria 6626
53 Ga0068855_100000777 3300005563 Bacteria 39367
54 Ga0070664_100000454 3300005564 Bacteria 31058
55 Ga0070664_100024678 3300005564 Bacteria 4976
56 Ga0068859_100001621 3300005617 Bacteria 22990
57 Ga0068859_100008320 3300005617 Bacteria 10513
58 Ga0068864_100001211 3300005618 Bacteria 21438
59 Ga0068861_100000504 3300005719 Bacteria 22770
60 Ga0068861_100011288 3300005719 Bacteria 6203
61 Ga0068861_100014140 3300005719 Bacteria 5597
62 Ga0068870_10007617 3300005840 Bacteria 4839
63 Ga0068863_100001906 3300005841 Bacteria 20711
64 Ga0068863_100174926 3300005841 Bacteria 2060
65 Ga0068858_100042701 3300005842 Bacteria 4204
66 Ga0068860_100000327 3300005843 Bacteria 64590
67 Ga0068860_100020350 3300005843 Bacteria 6427
68 Ga0068862_100000325 3300005844 Bacteria 51933
69 Ga0068862_100004822 3300005844 Bacteria 11359
70 Ga0068862_100063473 3300005844 Bacteria 3178
71 Ga0081538_10019337 3300005981 Bacteria 5067
72 Ga0081540_1000195 3300005983 Bacteria 62863
73 Ga0081539_10023824 3300005985 Bacteria 3994
74 Ga0075428_100000933 3300006844 Bacteria 30902
75 Ga0075428_100006725 3300006844 Bacteria 12792
76 Ga0075430_100007262 3300006846 Bacteria 9355
77 Ga0075430_100123565 3300006846 Bacteria 2157
78 Ga0075431_100000094 3300006847 Bacteria 54906
79 Ga0075431_100000503 3300006847 Bacteria 32649
80 Ga0075431_100027276 3300006847 Bacteria 5859
81 Ga0075434_100082032 3300006871 Bacteria 3222
82 Ga0075429_100000147 3300006880 Bacteria 43414
83 Ga0075429_100001370 3300006880 Bacteria 19935
84 Ga0097620_100001621 3300006931 Bacteria 22990
85 Ga0097620_100008320 3300006931 Bacteria 10513
86 Ga0099795_10002447 3300007788 Bacteria 4369
87 Ga0105251_10000008 3300009011 Bacteria 213669
88 Ga0105251_10002377 3300009011 Bacteria 14882
89 Ga0105240_10020714 3300009093 Bacteria 8762
90 Ga0105240_10130635 3300009093 Bacteria 3013
91 Ga0105240_10218970 3300009093 Bacteria 2219
92 Ga0111539_10005666 3300009094 Bacteria 16156
93 Ga0111539_10020050 3300009094 Bacteria 8237
94 Ga0111539_10039841 3300009094 Bacteria 5659
95 Ga0111539_10043891 3300009094 Bacteria 5358
96 Ga0105247_10046509 3300009101 Bacteria 2664
97 Ga0114129_10003130 3300009147 Bacteria 23215
98 Ga0114129_10076014 3300009147 Bacteria 4676
99 Ga0105243_10001525 3300009148 Bacteria 20239
100 Ga0105237_10074509 3300009545 Bacteria 3386
101 Ga0105249_10021708 3300009553 Bacteria 5747
102 Ga0099796_10001955 3300010159 Bacteria 4371
103 Ga0099796_10009379 3300010159 Bacteria 2647
104 Ga0105239_10027054 3300010375 Bacteria 6314
105 Ga0157371_10000158 3300013102 Bacteria 99529
106 Ga0157371_10047472 3300013102 Bacteria 3053
107 Ga0157371_10186963 3300013102 Bacteria 1482
108 Ga0157370_10008312 3300013104 Bacteria 11198
109 Ga0157370_10027830 3300013104 Bacteria 5571
110 Ga0157369_10033905 3300013105 Bacteria 5606
111 Ga0157369_10081817 3300013105 Bacteria 3455
112 Ga0157374_10122287 3300013296 Bacteria 2513
113 Ga0163162_10323866 3300013306 Bacteria 1674
114 Ga0157375_10056084 3300013308 Bacteria 3888
115 Ga0163163_10001204 3300014325 Bacteria 21896
116 Ga0157380_10000208 3300014326 Bacteria 34802
117 Ga0182008_10000360 3300014497 Bacteria 35424
118 Ga0157377_10005233 3300014745 Bacteria 6074
119 Ga0182006_1008606 3300015261 Bacteria 4623
120 Ga0182007_10000019 3300015262 Bacteria 194770
121 Ga0182005_1000048 3300015265 Bacteria 123394
122 Ga0182005_1000088 3300015265 Bacteria 69427
123 Ga0182005_1004813 3300015265 Bacteria 4298
124 Ga0183360_10003 3300015689 Bacteria 713221
125 Ga0163161_10010242 3300017792 Bacteria 6492
126 Ga0163161_10028148 3300017792 Bacteria 3989
127 Ga0213876_10105278 3300021384 Bacteria 1497
128 Ga0207425_1015747 3300025245 Bacteria 1690
129 Ga0209677_101544 3300025253 Bacteria 9817
130 Ga0209148_1009148 3300025254 Bacteria 1948
131 Ga0209129_1000153 3300025258 Bacteria 110699
132 Ga0209565_1000002 3300025263 Bacteria 1423083
133 Ga0209673_1000002 3300025273 Bacteria 1423083
134 Ga0209673_1000317 3300025273 Bacteria 88898
135 Ga0209673_1004512 3300025273 Bacteria 7416
136 Ga0209673_1008538 3300025273 Bacteria 4548
137 Ga0209130_1002935 3300025284 Bacteria 7792
138 Ga0209675_1000002 3300025291 Bacteria 1423083
139 Ga0209676_1000143 3300025292 Bacteria 175267
140 Ga0209676_1001178 3300025292 Bacteria 28316
141 Ga0209676_1001205 3300025292 Bacteria 27639
142 Ga0209676_1003335 3300025292 Bacteria 10027
143 Ga0209676_1006683 3300025292 Bacteria 5618
144 Ga0209676_1008522 3300025292 Bacteria 4560
145 Ga0209676_1014702 3300025292 Bacteria 2928
146 Ga0209676_1016599 3300025292 Bacteria 2648
147 Ga0209025_1000134 3300025294 Bacteria 194505
148 Ga0209025_1001827 3300025294 Bacteria 25060
149 Ga0209025_1012945 3300025294 Bacteria 5290
150 Ga0209025_1053508 3300025294 Bacteria 1582
151 Ga0209564_1000004 3300025295 Bacteria 1424639
152 Ga0209564_1001398 3300025295 Bacteria 25072
153 Ga0209564_1007086 3300025295 Bacteria 5864
154 Ga0209758_1000153 3300025297 Bacteria 161668
155 Ga0209758_1008037 3300025297 Bacteria 6967
156 Ga0209758_1024943 3300025297 Bacteria 2643
157 Ga0209050_1000109 3300025298 Bacteria 219706
158 Ga0209050_1001299 3300025298 Bacteria 28212
159 Ga0209050_1015645 3300025298 Bacteria 3167
160 Ga0209050_1021635 3300025298 Bacteria 2337
161 Ga0209256_1000004 3300025299 Bacteria 1424643
162 Ga0209256_1000624 3300025299 Bacteria 48696
163 Ga0209256_1005891 3300025299 Bacteria 6785
164 Ga0209256_1009412 3300025299 Bacteria 4290
165 Ga0209256_1013227 3300025299 Bacteria 3078
166 Ga0207426_1000390 3300025302 Bacteria 74933
167 Ga0209051_1003796 3300025303 Bacteria 9670
168 Ga0209051_1025885 3300025303 Bacteria 2377
169 Ga0209257_1000474 3300025304 Bacteria 73194
170 Ga0209257_1000751 3300025304 Bacteria 48987
171 Ga0209257_1000965 3300025304 Bacteria 39472
172 Ga0209257_1001919 3300025304 Bacteria 22458
173 Ga0209257_1002607 3300025304 Bacteria 17450
174 Ga0207713_1000170 3300025735 Bacteria 94864
175 Ga0207713_1023310 3300025735 Bacteria 2915
176 Ga0207692_10016934 3300025898 Bacteria 3240
177 Ga0207710_10023692 3300025900 Bacteria 2639
178 Ga0207645_10010680 3300025907 Bacteria 6298
179 Ga0207695_10013943 3300025913 Bacteria 9554
180 Ga0207695_10099494 3300025913 Bacteria 2905
181 Ga0207693_10073883 3300025915 Bacteria 2669
182 Ga0207660_10013689 3300025917 Bacteria 5322
183 Ga0207657_10063230 3300025919 Bacteria 3165
184 Ga0207652_10078742 3300025921 Bacteria 2878
185 Ga0207681_10001316 3300025923 Bacteria 16023
186 Ga0207694_10005212 3300025924 Bacteria 10037
187 Ga0207650_10001091 3300025925 Bacteria 20063
188 Ga0207650_10050005 3300025925 Bacteria 3089
189 Ga0207659_10002663 3300025926 Bacteria 10638
190 Ga0207644_10009249 3300025931 Bacteria 6464
191 Ga0207706_10007038 3300025933 Bacteria 10397
192 Ga0207709_10001660 3300025935 Bacteria 15022
193 Ga0207709_10018566 3300025935 Bacteria 3896
194 Ga0207670_10001483 3300025936 Bacteria 12327
195 Ga0207669_10031127 3300025937 Bacteria 2977
196 Ga0207691_10020769 3300025940 Bacteria 6209
197 Ga0207711_10013463 3300025941 Bacteria 6794
198 Ga0207689_10006588 3300025942 Bacteria 10238
199 Ga0207679_10040795 3300025945 Bacteria 3325
200 Ga0207679_10106360 3300025945 Bacteria 2205
201 Ga0207651_10050726 3300025960 Bacteria 2819
202 Ga0207712_10006532 3300025961 Bacteria 7355
203 Ga0207668_10011503 3300025972 Bacteria 5381
204 Ga0207668_10046700 3300025972 Bacteria 2960
205 Ga0207668_10107140 3300025972 Bacteria 2089
206 Ga0207668_10133386 3300025972 Bacteria 1899
207 Ga0207658_10009878 3300025986 Bacteria 6483
208 Ga0207703_10026308 3300026035 Bacteria 4578
209 Ga0207678_10102697 3300026067 Bacteria 2441
210 Ga0207641_10009957 3300026088 Bacteria 7825
211 Ga0207641_10018507 3300026088 Bacteria 5712
212 Ga0207648_10004231 3300026089 Bacteria 14834
213 Ga0207676_10011655 3300026095 Bacteria 6288
214 Ga0207676_10088550 3300026095 Bacteria 2534
215 Ga0207675_100000845 3300026118 Bacteria 30452
216 Ga0207675_100033721 3300026118 Bacteria 4770
217 Ga0207683_10067123 3300026121 Bacteria 3164
218 Ga0209371_1000159 3300027312 Bacteria 105294
219 Ga0209970_1002174 3300027614 Bacteria 3363
220 Ga0209974_10005586 3300027876 Bacteria 4415
221 Ga0207428_10011022 3300027907 Bacteria 8035
222 Ga0207428_10024743 3300027907 Bacteria 5039
223 Ga0207428_10028452 3300027907 Bacteria 4644
224 Ga0268266_10122875 3300028379 Bacteria 2312
225 Ga0268265_10001485 3300028380 Bacteria 19646
226 Ga0268265_10001835 3300028380 Bacteria 16951
227 Ga0268265_10048942 3300028380 Bacteria 3176
228 Ga0268264_10012786 3300028381 Bacteria 6908
229 Ga0307517_10140190 3300028786 Bacteria 1701
230 Ga0265338_10017990 3300028800 Bacteria 7588
231 Ga0268256_1000131 3300030500 Bacteria 105216
232 Ga0265340_10043169 3300031247 Bacteria 2211
233 Ga0307513_10007804 3300031456 Bacteria 13802
234 Ga0307509_10000062 3300031507 Bacteria 143809
235 Ga0307408_100011744 3300031548 Bacteria 5791
236 Ga0316575_10020212 3300031665 Bacteria 2554
237 Ga0316575_10049225 3300031665 Bacteria 1677
238 Ga0316576_10014193 3300031727 Bacteria 5317
239 Ga0316578_10014058 3300031728 Bacteria 4263
240 Ga0307405_10026940 3300031731 Bacteria 3325
241 Ga0316577_10022144 3300031733 Bacteria 3528
242 Ga0307406_10002823 3300031901 Bacteria 9465
243 Ga0307406_10041349 3300031901 Bacteria 2872
244 Ga0307412_10012405 3300031911 Bacteria 4968
245 Ga0307416_100022586 3300032002 Bacteria 4544
246 Ga0307416_100047110 3300032002 Bacteria 3409
247 Ga0307416_100225918 3300032002 Bacteria 1800
248 Ga0307414_10001711 3300032004 Bacteria 11427
249 Ga0307414_10012928 3300032004 Bacteria 4956
250 Ga0307411_10065193 3300032005 Bacteria 2442
251 Ga0316580_10001134 3300032139 Bacteria 6736
252 Ga0307510_10000122 3300033180 Bacteria 62024
253 Ga0373955_0067777 3300035172 Bacteria 1987
254 Ga0316574_0001748 3300035398 Bacteria 10518
255 Ga0316574_0005517 3300035398 Bacteria 6751
256 Ga0316574_0008906 3300035398 Bacteria 5600
257 Ga0373937_0011717 3300036401 Bacteria 7690
258 Ga0316582_0148181 3300036647 Bacteria 1585
259 Ga0316584_0003954 3300036712 Bacteria 9742
260 Ga0395901_0202013 3300038443 Bacteria 2083
261 Ga0436365_0535738 3300039437 Bacteria 1904
262 Ga0436360_0303267 3300039438 Bacteria 2205
263 Ga0436363_0198659 3300039450 Bacteria 7739
264 Ga0439436_0004920 3300041404 Bacteria 4098
265 Ga0439447_002973 3300041407 Bacteria 6076
266 Ga0439465_0005576 3300041413 Bacteria 4010
267 Ga0439449_0006669 3300042007 Bacteria 4413
268 Ga0439449_0020631 3300042007 Bacteria 2469
269 Ga0450914_001523 3300042118 Bacteria 1476
270 Ga0451577_0035692 3300042876 Bacteria 4478
271 Ga0466972_0000242 3300044658 Bacteria 37309
272 Ga0453684_0077570 3300044712 Bacteria 4162
273 Ga0451576_0046763 3300045051 Bacteria 4555
274 Ga0451576_0058765 3300045051 Bacteria 4016
275 Ga0495638_0003743 3300046460 Bacteria 11835
276 Ga0495638_0040693 3300046460 Bacteria 2944
277 Ga0495638_0065073 3300046460 Bacteria 2245
278 Ga0495650_0009517 3300046471 Bacteria 5518
279 Ga0495616_0064510 3300046513 Bacteria 1787
280 Ga0495642_0005810 3300046528 Bacteria 4731
281 Ga0495656_0019493 3300046615 Bacteria 2618
282 Ga0495668_0000500 3300046616 Bacteria 48965
283 Ga0495625_0007324 3300046660 Bacteria 9636
284 Ga0495636_0008944 3300047318 Bacteria 3944
285 Ga0495672_0051818 3300047320 Bacteria 2415
286 Ga0495673_0007087 3300047469 Bacteria 6496
287 Ga0495602_0075749 3300048088 Bacteria 2855
288 Ga0496106_0019370 3300048909 Bacteria 5047
289 Ga0496109_0167169 3300048912 Bacteria 2063
290 Ga0496116_0022585 3300048919 Bacteria 4710
291 Ga0496116_0033341 3300048919 Bacteria 3656
292 Ga0496117_0000176 3300048920 Bacteria 131822
293 Ga0496117_0001903 3300048920 Bacteria 27999
294 Ga0496117_0004441 3300048920 Bacteria 15465
295 Ga0496118_0002382 3300048921 Bacteria 25392
296 Ga0496118_0012199 3300048921 Bacteria 8281
297 Ga0496118_0062466 3300048921 Bacteria 2749
298 Ga0496118_0066819 3300048921 Bacteria 2623
299 Ga0496119_0000587 3300048922 Bacteria 49190
300 Ga0496119_0000626 3300048922 Bacteria 47693
301 Ga0496120_0000377 3300048923 Bacteria 72242
302 Ga0496121_0000562 3300048924 Bacteria 69996
303 Ga0496121_0003187 3300048924 Bacteria 23648
304 Ga0496121_0027105 3300048924 Bacteria 5372
305 Ga0496121_0052761 3300048924 Bacteria 3411
306 Ga0496122_0000424 3300048925 Bacteria 89287
307 Ga0496122_0133513 3300048925 Bacteria 1570
308 Ga0496123_0000282 3300048926 Bacteria 99907
309 Ga0496123_0009582 3300048926 Bacteria 8698
310 Ga0496123_0010164 3300048926 Bacteria 8355
311 Ga0496124_0000823 3300048927 Bacteria 50544
312 Ga0496124_0002068 3300048927 Bacteria 27193
313 Ga0496124_0009765 3300048927 Bacteria 9820
314 Ga0496125_0000486 3300048928 Bacteria 69727
315 Ga0496125_0004219 3300048928 Bacteria 16745
316 Ga0496125_0023558 3300048928 Bacteria 5680
317 Ga0496126_0004671 3300048929 Bacteria 16196
318 Ga0496126_0011473 3300048929 Bacteria 9167
319 Ga0496126_0057488 3300048929 Bacteria 3511
320 Ga0501299_006083 3300049522 Bacteria 1881
321 Ga0501043_0004118 3300049579 Bacteria 11874
322 Ga0501079_0043934 3300049741 Bacteria 3449
323 Ga0501081_0004812 3300049743 Bacteria 8675
324 Ga0501279_006375 3300049775 Bacteria 1557
325 nmdc:mga05p37_26657_c1 3300050507 Bacteria 7028
326 nmdc:mga05p37_59776_c1 3300050507 Bacteria 4693
327 nmdc:mga09592_15972_c1 3300050508 Bacteria 6135
328 nmdc:mga09592_593_c1 3300050508 Bacteria 27434
329 nmdc:mga0qj67_37220_c1 3300050509 Bacteria 3811
330 nmdc:mga0qj67_714_c1 3300050509 Bacteria 22593
331 nmdc:mga06r32_740_c1 3300050510 Bacteria 28652
332 nmdc:mga06r32_88_c1 3300050510 Bacteria 63377
333 nmdc:mga08y16_38327_c1 3300050511 Bacteria 5034
334 nmdc:mga08y16_42890_c1 3300050511 Bacteria 4739
335 nmdc:mga08y16_77_c1 3300050511 Bacteria 82433
336 nmdc:mga0n895_8861_c1 3300050512 Bacteria 8756
337 Ga0495601_0009446 3300053077 Bacteria 5769
338 Ga0500643_000097 3300053087 Bacteria 92120
339 Ga0500573_0014869 3300053140 Bacteria 4408
340 Ga0500645_010179 3300053730 Bacteria 3125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0005810 Ga0495642_0005810_13_1143 340
2 3300007788 Ga0099795_10002447 Ga0099795_100024472 391
3 3300010159 Ga0099796_10009379 Ga0099796_100093792 391
4 3300033180 Ga0307510_10000122 Ga0307510_1000012225 392
5 3300048088 Ga0495602_0075749 Ga0495602_0075749_596_1975 394
6 3300047469 Ga0495673_0007087 Ga0495673_0007087_2401_3813 395
7 3300048929 Ga0496126_0004671 Ga0496126_0004671_176_1588 395
8 3300048929 Ga0496126_0011473 Ga0496126_0011473_1411_2823 395
9 3300035172 Ga0373955_0067777 Ga0373955_0067777_207_1598 396
10 3300036401 Ga0373937_0011717 Ga0373937_0011717_613_2004 396
11 3300038443 Ga0395901_0202013 Ga0395901_0202013_131_1516 396
12 3300009093 Ga0105240_10218970 Ga0105240_102189702 401
13 3300013296 Ga0157374_10122287 Ga0157374_101222872 403
14 3300048909 Ga0496106_0019370 Ga0496106_0019370_3207_4619 403
15 3300025924 Ga0207694_10005212 Ga0207694_100052126 405
16 3300003771 Ga0055526_1000003 Ga0055526_1000003305 409
17 3300003773 Ga0055537_1000287 Ga0055537_100028711 409
18 3300003775 Ga0055524_1000002 Ga0055524_100000261 409
19 3300003784 Ga0055534_1000050 Ga0055534_100005021 409
20 3300003790 Ga0055528_1000001 Ga0055528_100000161 409
21 3300009094 Ga0111539_10020050 Ga0111539_100200503 409
22 3300010159 Ga0099796_10001955 Ga0099796_100019552 409
23 3300025263 Ga0209565_1000002 Ga0209565_1000002517 409
24 3300025273 Ga0209673_1000002 Ga0209673_1000002517 409
25 3300025291 Ga0209675_1000002 Ga0209675_1000002517 409
26 3300025295 Ga0209564_1000004 Ga0209564_1000004518 409
27 3300025299 Ga0209256_1000004 Ga0209256_1000004518 409
28 3300025898 Ga0207692_10016934 Ga0207692_100169344 410
29 3300028786 Ga0307517_10140190 Ga0307517_101401902 410
30 3300031901 Ga0307406_10002823 Ga0307406_100028232 410
31 3300046513 Ga0495616_0064510 Ga0495616_0064510_358_1767 410
32 3300053730 Ga0500645_010179 Ga0500645_010179_502_1908 410
33 3300042007 Ga0439449_0020631 Ga0439449_0020631_1106_2449 411
34 3300026067 Ga0207678_10102697 Ga0207678_101026971 413
35 3300031247 Ga0265340_10043169 Ga0265340_100431692 413
36 3300039438 Ga0436360_0303267 Ga0436360_0303267_739_2151 413
37 3300047320 Ga0495672_0051818 Ga0495672_0051818_349_1692 413
38 3300049741 Ga0501079_0043934 Ga0501079_0043934_1513_2907 413
39 3300049743 Ga0501081_0004812 Ga0501081_0004812_1128_2522 413
40 3300003791 Ga0055530_10002961 Ga0055530_100029616 415
41 3300009101 Ga0105247_10046509 Ga0105247_100465092 415
42 3300015265 Ga0182005_1000048 Ga0182005_100004885 415
43 3300025284 Ga0209130_1002935 Ga0209130_10029354 415
44 3300025298 Ga0209050_1001299 Ga0209050_100129915 415
45 3300025299 Ga0209256_1005891 Ga0209256_10058914 415
46 3300025303 Ga0209051_1025885 Ga0209051_10258852 415
47 3300025304 Ga0209257_1000751 Ga0209257_10007517 415
48 3300025304 Ga0209257_1001919 Ga0209257_10019198 415
49 3300025900 Ga0207710_10023692 Ga0207710_100236921 415
50 3300048924 Ga0496121_0052761 Ga0496121_0052761_22_1374 415
51 3300003771 Ga0055526_1007078 Ga0055526_10070784 416
52 3300025292 Ga0209676_1001178 Ga0209676_100117810 416
53 3300025292 Ga0209676_1003335 Ga0209676_10033353 416
54 3300025295 Ga0209564_1007086 Ga0209564_10070864 416
55 3300009093 Ga0105240_10130635 Ga0105240_101306352 417
56 3300025913 Ga0207695_10099494 Ga0207695_100994942 417
57 3300041404 Ga0439436_0004920 Ga0439436_0004920_463_1863 417
58 3300025254 Ga0209148_1009148 Ga0209148_10091482 422
59 3300028800 Ga0265338_10017990 Ga0265338_100179902 422
60 3300031665 Ga0316575_10049225 Ga0316575_100492251 422
61 3300003771 Ga0055526_1016361 Ga0055526_10163612 423
62 3300003775 Ga0055524_1001701 Ga0055524_100170110 423
63 3300003790 Ga0055528_1000295 Ga0055528_100029513 423
64 3300005983 Ga0081540_1000195 Ga0081540_100019542 423
65 3300010375 Ga0105239_10027054 Ga0105239_100270545 423
66 3300025253 Ga0209677_101544 Ga0209677_1015442 423
67 3300025273 Ga0209673_1000317 Ga0209673_100031748 423
68 3300025294 Ga0209025_1012945 Ga0209025_10129453 423
69 3300025295 Ga0209564_1001398 Ga0209564_100139826 423
70 3300025299 Ga0209256_1000624 Ga0209256_100062416 423
71 3300025931 Ga0207644_10009249 Ga0207644_100092495 423
72 3300053077 Ga0495601_0009446 Ga0495601_0009446_4153_5547 423
73 iso_pu_bacteria 2582581294 2585204815 423
74 3300009093 Ga0105240_10020714 Ga0105240_100207146 424
75 3300009545 Ga0105237_10074509 Ga0105237_100745093 424
76 3300025913 Ga0207695_10013943 Ga0207695_1001394310 424
77 3300032002 Ga0307416_100022586 Ga0307416_1000225863 424
78 3300048912 Ga0496109_0167169 Ga0496109_0167169_290_1678 424
79 iso_pu_bacteria 2953994433 2953994911 424
80 3300005329 Ga0070683_100015340 Ga0070683_1000153402 425
81 3300005336 Ga0070680_100000968 Ga0070680_1000009683 425
82 3300005336 Ga0070680_100007296 Ga0070680_1000072966 425
83 3300005535 Ga0070684_100118882 Ga0070684_1001188821 425
84 3300003322 rootL2_10279950 rootL2_102799503 426
85 3300005347 Ga0070668_100048514 Ga0070668_1000485141 426
86 3300005367 Ga0070667_100023050 Ga0070667_1000230505 426
87 3300005617 Ga0068859_100008320 Ga0068859_1000083206 426
88 3300005719 Ga0068861_100011288 Ga0068861_1000112883 426
89 3300005841 Ga0068863_100174926 Ga0068863_1001749263 426
90 3300005842 Ga0068858_100042701 Ga0068858_1000427016 426
91 3300005843 Ga0068860_100020350 Ga0068860_1000203506 426
92 3300005844 Ga0068862_100063473 Ga0068862_1000634731 426
93 3300006931 Ga0097620_100008320 Ga0097620_1000083206 426
94 3300025972 Ga0207668_10046700 Ga0207668_100467004 426
95 3300025986 Ga0207658_10009878 Ga0207658_100098787 426
96 3300026035 Ga0207703_10026308 Ga0207703_100263086 426
97 3300026088 Ga0207641_10009957 Ga0207641_100099576 426
98 3300026095 Ga0207676_10011655 Ga0207676_100116554 426
99 3300028380 Ga0268265_10048942 Ga0268265_100489425 426
100 3300028381 Ga0268264_10012786 Ga0268264_100127868 426
101 3300031507 Ga0307509_10000062 Ga0307509_1000006225 426
102 3300031665 Ga0316575_10020212 Ga0316575_100202122 426
103 3300031727 Ga0316576_10014193 Ga0316576_100141932 426
104 3300031728 Ga0316578_10014058 Ga0316578_100140582 426
105 3300031733 Ga0316577_10022144 Ga0316577_100221442 426
106 3300032004 Ga0307414_10001711 Ga0307414_100017113 426
107 3300032139 Ga0316580_10001134 Ga0316580_100011345 426
108 3300035398 Ga0316574_0005517 Ga0316574_0005517_3605_5017 426
109 3300036647 Ga0316582_0148181 Ga0316582_0148181_143_1555 426
110 iso_pu_bacteria 2989771324 2989775138 426
111 iso_pu_bacteria 8019648815 8019659093 426
112 iso_pu_bacteria 8024486573 8024492729 426
113 3300005328 Ga0070676_10004058 Ga0070676_100040582 427
114 3300005336 Ga0070680_100046383 Ga0070680_1000463832 427
115 3300005345 Ga0070692_10053527 Ga0070692_100535272 427
116 3300005347 Ga0070668_100002342 Ga0070668_1000023426 427
117 3300005347 Ga0070668_100015901 Ga0070668_1000159017 427
118 3300005347 Ga0070668_100068660 Ga0070668_1000686602 427
119 3300005353 Ga0070669_100097911 Ga0070669_1000979112 427
120 3300005719 Ga0068861_100000504 Ga0068861_10000050414 427
121 3300005843 Ga0068860_100000327 Ga0068860_1000003276 427
122 3300005844 Ga0068862_100000325 Ga0068862_1000003255 427
123 3300009094 Ga0111539_10043891 Ga0111539_100438912 427
124 3300009553 Ga0105249_10021708 Ga0105249_100217083 427
125 3300021384 Ga0213876_10105278 Ga0213876_101052781 427
126 3300025907 Ga0207645_10010680 Ga0207645_100106804 427
127 3300025917 Ga0207660_10013689 Ga0207660_100136892 427
128 3300025933 Ga0207706_10007038 Ga0207706_100070385 427
129 3300025935 Ga0207709_10018566 Ga0207709_100185662 427
130 3300025961 Ga0207712_10006532 Ga0207712_100065323 427
131 3300025972 Ga0207668_10133386 Ga0207668_101333862 427
132 3300026118 Ga0207675_100000845 Ga0207675_10000084516 427
133 3300027907 Ga0207428_10028452 Ga0207428_100284523 427
134 3300028380 Ga0268265_10001485 Ga0268265_100014856 427
135 3300035398 Ga0316574_0001748 Ga0316574_0001748_106_1524 427
136 3300035398 Ga0316574_0008906 Ga0316574_0008906_1217_2650 427
137 3300036712 Ga0316584_0003954 Ga0316584_0003954_1975_3387 427
138 3300039437 Ga0436365_0535738 Ga0436365_0535738_461_1873 427
139 3300046471 Ga0495650_0009517 Ga0495650_0009517_37_1431 427
140 3300046615 Ga0495656_0019493 Ga0495656_0019493_481_1908 427
141 3300047318 Ga0495636_0008944 Ga0495636_0008944_1167_2594 427
142 3300048924 Ga0496121_0000562 Ga0496121_0000562_12415_13824 427
143 3300050511 nmdc:mga08y16_42890_c1 nmdc:mga08y16_42890_c1_1128_2645 427
144 iso_pu_bacteria 2513237094 2513642452 427
145 iso_pu_bacteria 2595698237 2596374815 427
146 iso_pu_bacteria 2928125067 2928125525 427
147 iso_pu_bacteria 2937610967 2937612512 427
148 3300002773 JGI25152J39213_1000525 JGI25152J39213_100052521 428
149 3300003215 JGI25153J46596_10009809 JGI25153J46596_100098093 428
150 3300005290 Ga0065712_10071340 Ga0065712_100713402 428
151 3300005293 Ga0065715_10091476 Ga0065715_100914761 428
152 3300005295 Ga0065707_10082218 Ga0065707_1008221814 428
153 3300005334 Ga0068869_100001869 Ga0068869_1000018692 428
154 3300005335 Ga0070666_10057790 Ga0070666_100577902 428
155 3300005340 Ga0070689_100000298 Ga0070689_10000029810 428
156 3300005347 Ga0070668_100007940 Ga0070668_1000079405 428
157 3300005356 Ga0070674_100030977 Ga0070674_1000309773 428
158 3300005364 Ga0070673_100003142 Ga0070673_1000031427 428
159 3300005365 Ga0070688_100000861 Ga0070688_1000008614 428
160 3300005438 Ga0070701_10032265 Ga0070701_100322652 428
161 3300005444 Ga0070694_100062696 Ga0070694_1000626962 428
162 3300005456 Ga0070678_100043867 Ga0070678_1000438672 428
163 3300005535 Ga0070684_100000398 Ga0070684_1000003986 428
164 3300005543 Ga0070672_100069883 Ga0070672_1000698832 428
165 3300005548 Ga0070665_100020598 Ga0070665_1000205985 428
166 3300005564 Ga0070664_100000454 Ga0070664_10000045410 428
167 3300005617 Ga0068859_100001621 Ga0068859_10000162116 428
168 3300005618 Ga0068864_100001211 Ga0068864_10000121110 428
169 3300005719 Ga0068861_100014140 Ga0068861_1000141403 428
170 3300005840 Ga0068870_10007617 Ga0068870_100076172 428
171 3300005841 Ga0068863_100001906 Ga0068863_10000190615 428
172 3300005844 Ga0068862_100004822 Ga0068862_1000048223 428
173 3300005981 Ga0081538_10019337 Ga0081538_100193374 428
174 3300006844 Ga0075428_100000933 Ga0075428_1000009333 428
175 3300006844 Ga0075428_100006725 Ga0075428_1000067253 428
176 3300006846 Ga0075430_100007262 Ga0075430_1000072627 428
177 3300006846 Ga0075430_100123565 Ga0075430_1001235652 428
178 3300006847 Ga0075431_100000094 Ga0075431_10000009425 428
179 3300006847 Ga0075431_100000503 Ga0075431_10000050315 428
180 3300006847 Ga0075431_100027276 Ga0075431_1000272764 428
181 3300006880 Ga0075429_100000147 Ga0075429_1000001478 428
182 3300006880 Ga0075429_100001370 Ga0075429_10000137015 428
183 3300006931 Ga0097620_100001621 Ga0097620_1000016214 428
184 3300009094 Ga0111539_10005666 Ga0111539_100056664 428
185 3300009094 Ga0111539_10039841 Ga0111539_100398415 428
186 3300009147 Ga0114129_10003130 Ga0114129_1000313020 428
187 3300009147 Ga0114129_10076014 Ga0114129_100760143 428
188 3300013306 Ga0163162_10323866 Ga0163162_103238662 428
189 3300013308 Ga0157375_10056084 Ga0157375_100560842 428
190 3300014325 Ga0163163_10001204 Ga0163163_1000120420 428
191 3300014326 Ga0157380_10000208 Ga0157380_1000020811 428
192 3300014745 Ga0157377_10005233 Ga0157377_100052332 428
193 3300017792 Ga0163161_10028148 Ga0163161_100281482 428
194 3300025258 Ga0209129_1000153 Ga0209129_10001535 428
195 3300025273 Ga0209673_1004512 Ga0209673_10045124 428
196 3300025273 Ga0209673_1008538 Ga0209673_10085384 428
197 3300025297 Ga0209758_1000153 Ga0209758_100015360 428
198 3300025302 Ga0207426_1000390 Ga0207426_100039068 428
199 3300025303 Ga0209051_1003796 Ga0209051_10037964 428
200 3300025925 Ga0207650_10050005 Ga0207650_100500052 428
201 3300025926 Ga0207659_10002663 Ga0207659_100026636 428
202 3300025936 Ga0207670_10001483 Ga0207670_100014833 428
203 3300025937 Ga0207669_10031127 Ga0207669_100311272 428
204 3300025940 Ga0207691_10020769 Ga0207691_100207695 428
205 3300025941 Ga0207711_10013463 Ga0207711_100134636 428
206 3300025942 Ga0207689_10006588 Ga0207689_100065886 428
207 3300025945 Ga0207679_10040795 Ga0207679_100407951 428
208 3300025960 Ga0207651_10050726 Ga0207651_100507262 428
209 3300025972 Ga0207668_10011503 Ga0207668_100115035 428
210 3300026088 Ga0207641_10018507 Ga0207641_100185073 428
211 3300026089 Ga0207648_10004231 Ga0207648_100042317 428
212 3300026095 Ga0207676_10088550 Ga0207676_100885502 428
213 3300026118 Ga0207675_100033721 Ga0207675_1000337212 428
214 3300026121 Ga0207683_10067123 Ga0207683_100671232 428
215 3300027907 Ga0207428_10011022 Ga0207428_100110222 428
216 3300027907 Ga0207428_10024743 Ga0207428_100247435 428
217 3300028379 Ga0268266_10122875 Ga0268266_101228752 428
218 3300028380 Ga0268265_10001835 Ga0268265_1000183510 428
219 3300031548 Ga0307408_100011744 Ga0307408_1000117444 428
220 3300031731 Ga0307405_10026940 Ga0307405_100269403 428
221 3300032002 Ga0307416_100047110 Ga0307416_1000471102 428
222 3300032002 Ga0307416_100225918 Ga0307416_1002259181 428
223 3300042118 Ga0450914_001523 Ga0450914_001523_56_1453 428
224 3300045051 Ga0451576_0058765 Ga0451576_0058765_2439_3860 428
225 3300046460 Ga0495638_0040693 Ga0495638_0040693_647_2086 428
226 3300046660 Ga0495625_0007324 Ga0495625_0007324_5448_6887 428
227 3300048927 Ga0496124_0009765 Ga0496124_0009765_1295_2701 428
228 3300049522 Ga0501299_006083 Ga0501299_006083_108_1529 428
229 3300050507 nmdc:mga05p37_26657_c1 nmdc:mga05p37_26657_c1_1843_3240 428
230 3300050507 nmdc:mga05p37_59776_c1 nmdc:mga05p37_59776_c1_1621_3057 428
231 3300050508 nmdc:mga09592_15972_c1 nmdc:mga09592_15972_c1_2049_3446 428
232 3300050508 nmdc:mga09592_593_c1 nmdc:mga09592_593_c1_2603_4039 428
233 3300050509 nmdc:mga0qj67_37220_c1 nmdc:mga0qj67_37220_c1_1408_2805 428
234 3300050509 nmdc:mga0qj67_714_c1 nmdc:mga0qj67_714_c1_13023_14423 428
235 3300050510 nmdc:mga06r32_740_c1 nmdc:mga06r32_740_c1_10513_11913 428
236 3300050510 nmdc:mga06r32_88_c1 nmdc:mga06r32_88_c1_16062_17498 428
237 3300050511 nmdc:mga08y16_38327_c1 nmdc:mga08y16_38327_c1_3605_5002 428
238 3300050511 nmdc:mga08y16_77_c1 nmdc:mga08y16_77_c1_44280_45716 428
239 3300053087 Ga0500643_000097 Ga0500643_000097_57315_58724 428
240 3300053140 Ga0500573_0014869 Ga0500573_0014869_2671_4077 428
241 iso_pu_bacteria 2643221559 2643818051 428
242 iso_pu_bacteria 2643221573 2643880204 428
243 iso_pu_bacteria 2643221586 2643937710 428
244 iso_pu_bacteria 2643221612 2644078623 428
245 iso_pu_bacteria 2643221720 2644662248 428
246 iso_pu_bacteria 2643221727 2644693400 428
247 iso_pu_bacteria 2643221728 2644698861 428
248 iso_pu_bacteria 2894414249 2894415945 428
249 iso_pu_bacteria 2939631187 2939634855 428
250 iso_pu_bacteria 8003014200 8003017818 428
251 3300003781 Ga0055536_1003360 Ga0055536_10033606 429
252 3300005437 Ga0070710_10055102 Ga0070710_100551022 429
253 3300006871 Ga0075434_100082032 Ga0075434_1000820323 429
254 3300025292 Ga0209676_1001205 Ga0209676_10012057 429
255 3300025915 Ga0207693_10073883 Ga0207693_100738831 429
256 3300039450 Ga0436363_0198659 Ga0436363_0198659_5062_6486 429
257 3300042876 Ga0451577_0035692 Ga0451577_0035692_2282_3697 429
258 3300044658 Ga0466972_0000242 Ga0466972_0000242_18905_20314 429
259 3300044712 Ga0453684_0077570 Ga0453684_0077570_2587_4002 429
260 3300045051 Ga0451576_0046763 Ga0451576_0046763_903_2318 429
261 3300050512 nmdc:mga0n895_8861_c1 nmdc:mga0n895_8861_c1_3488_4888 429
262 3300025298 Ga0209050_1015645 Ga0209050_10156452 430
263 3300025304 Ga0209257_1000474 Ga0209257_100047464 430
264 3300025304 Ga0209257_1002607 Ga0209257_10026076 430
265 3300041413 Ga0439465_0005576 Ga0439465_0005576_1686_3089 430
266 3300042007 Ga0439449_0006669 Ga0439449_0006669_1090_2493 430
267 3300049579 Ga0501043_0004118 Ga0501043_0004118_2260_3663 430
268 iso_pu_bacteria 2547132130 2547502002 430
269 iso_pu_bacteria 2576861471 2578456440 430
270 iso_pu_bacteria 2747842428 2747950113 430
271 iso_pu_bacteria 2747842501 2748018153 430
272 iso_pu_bacteria 2765235840 2765581062 430
273 iso_pu_bacteria 2816332141 2816517942 430
274 iso_pu_bacteria 2842391507 2842394097 430
275 iso_pu_bacteria 2842757796 2842761268 430
276 iso_pu_bacteria 2852649853 2852651685 430
277 iso_pu_bacteria 2857442823 2857444576 430
278 iso_pu_bacteria 2874220319 2874223713 430
279 iso_pu_bacteria 2919089067 2919089264 430
280 iso_pu_bacteria 2919130084 2919134187 430
281 iso_pu_bacteria 2919134579 2919136491 430
282 iso_pu_bacteria 2923516293 2923516322 430
283 iso_pu_bacteria 2928496128 2928499354 430
284 iso_pu_bacteria 2931380184 2931382885 430
285 iso_pu_bacteria 2939589442 2939590320 430
286 iso_pu_bacteria 2939622612 2939626718 430
287 iso_pu_bacteria 2939626828 2939628524 430
288 iso_pu_bacteria 2941475908 2941479403 430
289 iso_pu_bacteria 2961047084 2961050477 430
290 iso_pu_bacteria 2961064222 2961064369 430
291 iso_pu_bacteria 2977247770 2977247843 430
292 iso_pu_bacteria 8054563764 8054566673 430
293 3300003794 Ga0055531_10020960 Ga0055531_100209601 431
294 3300005563 Ga0068855_100000777 Ga0068855_1000007772 431
295 3300025292 Ga0209676_1006683 Ga0209676_10066832 431
296 3300025292 Ga0209676_1008522 Ga0209676_10085222 431
297 3300025292 Ga0209676_1016599 Ga0209676_10165991 431
298 3300025299 Ga0209256_1013227 Ga0209256_10132272 431
299 3300025304 Ga0209257_1000965 Ga0209257_100096529 431
300 3300032004 Ga0307414_10012928 Ga0307414_100129282 431
301 3300046460 Ga0495638_0065073 Ga0495638_0065073_98_1528 431
302 iso_pu_bacteria 2818991457 2819661767 431
303 iso_pu_bacteria 2852684882 2852688416 431
304 iso_pu_bacteria 2929195423 2929199771 431
305 iso_pu_bacteria 8021622325 8021626182 431
306 iso_pu_bacteria 8021626552 8021627203 431
307 iso_pu_bacteria 8021648035 8021651171 431
308 3300003187 JGI25151J46595_10000693 JGI25151J46595_1000069320 432
309 3300003794 Ga0055531_10018707 Ga0055531_100187072 432
310 3300015689 Ga0183360_10003 Ga0183360_10003500 432
311 3300025245 Ga0207425_1015747 Ga0207425_10157471 432
312 3300025292 Ga0209676_1014702 Ga0209676_10147023 432
313 3300025294 Ga0209025_1000134 Ga0209025_1000134143 432
314 3300025294 Ga0209025_1001827 Ga0209025_100182711 432
315 3300025294 Ga0209025_1053508 Ga0209025_10535082 432
316 3300025297 Ga0209758_1008037 Ga0209758_10080371 432
317 3300025297 Ga0209758_1024943 Ga0209758_10249431 432
318 3300027876 Ga0209974_10005586 Ga0209974_100055862 432
319 3300031456 Ga0307513_10007804 Ga0307513_100078045 432
320 3300031901 Ga0307406_10041349 Ga0307406_100413492 432
321 3300041407 Ga0439447_002973 Ga0439447_002973_554_1960 432
322 3300046616 Ga0495668_0000500 Ga0495668_0000500_1048_2463 432
323 3300048924 Ga0496121_0003187 Ga0496121_0003187_3038_4579 432
324 iso_pu_bacteria 2643221593 2643975336 432
325 iso_pu_bacteria 2941489479 2941493129 432
326 iso_pu_bacteria 2995948881 2995949215 432
327 3300013102 Ga0157371_10047472 Ga0157371_100474722 433
328 3300013104 Ga0157370_10027830 Ga0157370_100278304 433
329 3300013105 Ga0157369_10081817 Ga0157369_100818172 433
330 3300025919 Ga0207657_10063230 Ga0207657_100632302 433
331 3300025921 Ga0207652_10078742 Ga0207652_100787422 433
332 3300025945 Ga0207679_10106360 Ga0207679_101063602 433
333 3300032005 Ga0307411_10065193 Ga0307411_100651932 433
334 3300005456 Ga0070678_100080499 Ga0070678_1000804991 434
335 3300005564 Ga0070664_100024678 Ga0070664_1000246784 434
336 3300005985 Ga0081539_10023824 Ga0081539_100238245 434
337 3300009011 Ga0105251_10002377 Ga0105251_1000237715 434
338 3300013102 Ga0157371_10000158 Ga0157371_1000015821 434
339 3300013102 Ga0157371_10186963 Ga0157371_101869631 434
340 3300013104 Ga0157370_10008312 Ga0157370_1000831211 434
341 3300013105 Ga0157369_10033905 Ga0157369_100339051 434
342 3300014497 Ga0182008_10000360 Ga0182008_1000036025 434
343 3300015261 Ga0182006_1008606 Ga0182006_10086063 434
344 3300015262 Ga0182007_10000019 Ga0182007_1000001939 434
345 3300015265 Ga0182005_1000088 Ga0182005_100008830 434
346 3300017792 Ga0163161_10010242 Ga0163161_100102427 434
347 3300025292 Ga0209676_1000143 Ga0209676_1000143113 434
348 3300025298 Ga0209050_1000109 Ga0209050_1000109178 434
349 3300025298 Ga0209050_1021635 Ga0209050_10216351 434
350 3300025299 Ga0209256_1009412 Ga0209256_10094122 434
351 3300025735 Ga0207713_1023310 Ga0207713_10233102 434
352 3300025923 Ga0207681_10001316 Ga0207681_100013164 434
353 3300025972 Ga0207668_10107140 Ga0207668_101071401 434
354 3300027614 Ga0209970_1002174 Ga0209970_10021742 434
355 3300031911 Ga0307412_10012405 Ga0307412_100124055 434
356 3300046460 Ga0495638_0003743 Ga0495638_0003743_8415_9812 434
357 3300048919 Ga0496116_0022585 Ga0496116_0022585_81_1478 434
358 3300048919 Ga0496116_0033341 Ga0496116_0033341_1965_3362 434
359 3300048920 Ga0496117_0000176 Ga0496117_0000176_123630_125027 434
360 3300048920 Ga0496117_0001903 Ga0496117_0001903_9981_11378 434
361 3300048921 Ga0496118_0002382 Ga0496118_0002382_17200_18597 434
362 3300048921 Ga0496118_0012199 Ga0496118_0012199_2513_3910 434
363 3300048922 Ga0496119_0000587 Ga0496119_0000587_47686_49083 434
364 3300048924 Ga0496121_0027105 Ga0496121_0027105_2259_3656 434
365 3300048925 Ga0496122_0133513 Ga0496122_0133513_66_1463 434
366 3300048926 Ga0496123_0009582 Ga0496123_0009582_3999_5396 434
367 3300048926 Ga0496123_0010164 Ga0496123_0010164_2732_4129 434
368 3300048927 Ga0496124_0002068 Ga0496124_0002068_21899_23296 434
369 3300048928 Ga0496125_0000486 Ga0496125_0000486_31359_32756 434
370 3300048928 Ga0496125_0004219 Ga0496125_0004219_10387_11784 434
371 3300048928 Ga0496125_0023558 Ga0496125_0023558_41_1438 434
372 iso_pu_bacteria 2974307012 2974307098 434
373 iso_pu_bacteria 2984514374 2984517701 434
374 2162886007 SwRhRL2b_contig_3837291 SwRhRL2b_0311.00005780 435
375 3300003856 Ga0058692_1000062 Ga0058692_100006224 435
376 3300005289 Ga0065704_10004123 Ga0065704_100041232 435
377 3300005331 Ga0070670_100000524 Ga0070670_1000005246 435
378 3300009011 Ga0105251_10000008 Ga0105251_10000008121 435
379 3300009148 Ga0105243_10001525 Ga0105243_1000152513 435
380 3300015265 Ga0182005_1004813 Ga0182005_10048132 435
381 3300025735 Ga0207713_1000170 Ga0207713_100017010 435
382 3300025925 Ga0207650_10001091 Ga0207650_1000109117 435
383 3300025935 Ga0207709_10001660 Ga0207709_100016609 435
384 3300027312 Ga0209371_1000159 Ga0209371_100015924 435
385 3300030500 Ga0268256_1000131 Ga0268256_100013124 435
386 3300048920 Ga0496117_0004441 Ga0496117_0004441_6802_8202 435
387 3300048921 Ga0496118_0062466 Ga0496118_0062466_168_1568 435
388 3300048921 Ga0496118_0066819 Ga0496118_0066819_1099_2499 435
389 3300048922 Ga0496119_0000626 Ga0496119_0000626_44227_45627 435
390 3300048923 Ga0496120_0000377 Ga0496120_0000377_2129_3529 435
391 3300048925 Ga0496122_0000424 Ga0496122_0000424_54273_55673 435
392 3300048926 Ga0496123_0000282 Ga0496123_0000282_36729_38129 435
393 3300048927 Ga0496124_0000823 Ga0496124_0000823_15550_16950 435
394 3300048929 Ga0496126_0057488 Ga0496126_0057488_1966_3366 435
395 3300049775 Ga0501279_006375 Ga0501279_006375_74_1513 435

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

57

483

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.891 1 402
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8882 1 404
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.8725 2 404
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8253 1 404
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8239 1 402
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5123 14 364 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.4898 14 364 1.20.1630.10
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4755 22 149 1.10.10.1740
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.4698 12 150 1.20.120.80
af_O80854_5_217_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4655 1 146 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A0K6IUC4-F1-model_v4 Bacterial Cytochrome Ubiquinol Oxidase 0.9894 141 254 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A2S3VW54-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9868 1 197 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A3C1NGB6-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9837 1 202 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A8B4PMX7-F1-model_v4 deleted 0.9835 1 258
AF-A0A2X3EXR3-F1-model_v4 Cytochrome oxidase bd-II, subunit I (EC 1.10.3.-) 0.983 1 244 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Feature Viewer

pLDDT pTM Quality
74.49 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map