F428863

General Info

Members Datasets Scaffolds Average Seq Length
381 245 760 71

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100253669|Ga0070683_1002536692
Length 85
Sequence MASASSQILRQAVTMKYLVIIEKGPSSFGAYVPDLPGCVAVGDTTDEVKELIREAIDLHIEDMRNRGEVVPTPTAASEYVEARVA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 2.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.1
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 33.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100253669 3300005329 Bacteria 1673
2 rootL2_10048126 3300003322 Unclassified 1001
3 Ga0070658_10479156 3300005327 Bacteria 1074
4 Ga0070676_10611361 3300005328 Bacteria 787
5 Ga0070690_100222481 3300005330 Bacteria 1323
6 Ga0070690_100547449 3300005330 Unclassified 872
7 Ga0070670_100481934 3300005331 Bacteria 1102
8 Ga0070670_101229423 3300005331 Unclassified 685
9 Ga0070670_101939461 3300005331 Bacteria 542
10 Ga0070677_10338841 3300005333 Bacteria 776
11 Ga0070677_10682402 3300005333 Unclassified 577
12 Ga0068868_101134237 3300005338 Unclassified 720
13 Ga0070660_100124623 3300005339 Bacteria 2058
14 Ga0070661_101250819 3300005344 Unclassified 622
15 Ga0070668_100116031 3300005347 Unclassified 2135
16 Ga0070668_101391196 3300005347 Unclassified 640
17 Ga0070669_100044427 3300005353 Bacteria 3237
18 Ga0070675_100088498 3300005354 Bacteria 2591
19 Ga0070675_100201972 3300005354 Bacteria 1725
20 Ga0070675_101642634 3300005354 Bacteria 593
21 Ga0070674_100016461 3300005356 Unclassified 4635
22 Ga0070674_101122961 3300005356 Bacteria 695
23 Ga0070673_100034420 3300005364 Bacteria 3834
24 Ga0070673_101912993 3300005364 Unclassified 563
25 Ga0070667_100809312 3300005367 Bacteria 870
26 Ga0070667_101234169 3300005367 Unclassified 700
27 Ga0070709_11007535 3300005434 Unclassified 663
28 Ga0070709_11176146 3300005434 Bacteria 616
29 Ga0070714_100009628 3300005435 Bacteria 7606
30 Ga0070714_100364957 3300005435 Bacteria 1358
31 Ga0070714_101355006 3300005435 Unclassified 695
32 Ga0070713_101205680 3300005436 Bacteria 733
33 Ga0070701_10945752 3300005438 Unclassified 598
34 Ga0070705_100263742 3300005440 Bacteria 1216
35 Ga0070705_101105054 3300005440 Bacteria 649
36 Ga0070700_100133874 3300005441 Bacteria 1676
37 Ga0070708_100111980 3300005445 Bacteria 2509
38 Ga0070708_100190723 3300005445 Bacteria 1917
39 Ga0070708_101538786 3300005445 Unclassified 619
40 Ga0070708_101617541 3300005445 Unclassified 603
41 Ga0070663_100408721 3300005455 Bacteria 1111
42 Ga0070678_100228303 3300005456 Bacteria 1551
43 Ga0070678_100293191 3300005456 Bacteria 1380
44 Ga0070662_100507804 3300005457 Unclassified 1006
45 Ga0070662_101246684 3300005457 Unclassified 640
46 Ga0068867_102094817 3300005459 Unclassified 536
47 Ga0070685_10016324 3300005466 Bacteria 3955
48 Ga0070706_100074917 3300005467 Bacteria 3132
49 Ga0070707_100021995 3300005468 Bacteria 6029
50 Ga0070707_100223843 3300005468 Unclassified 1832
51 Ga0070707_100456010 3300005468 Unclassified 1239
52 Ga0070707_100608400 3300005468 Unclassified 1055
53 Ga0070698_100109807 3300005471 Bacteria 2724
54 Ga0070699_100162893 3300005518 Bacteria 1974
55 Ga0070699_100208437 3300005518 Bacteria 1739
56 Ga0070679_100597536 3300005530 Unclassified 1047
57 Ga0070684_100258759 3300005535 Bacteria 1592
58 Ga0070684_100422263 3300005535 Bacteria 1231
59 Ga0068853_100157977 3300005539 Bacteria 2044
60 Ga0068853_100414635 3300005539 Bacteria 1262
61 Ga0070672_100430474 3300005543 Bacteria 1134
62 Ga0070672_101056596 3300005543 Bacteria 721
63 Ga0070686_101858387 3300005544 Unclassified 513
64 Ga0070696_100224801 3300005546 Bacteria 1410
65 Ga0070665_100000182 3300005548 Bacteria 111555
66 Ga0068855_100243253 3300005563 Bacteria 2010
67 Ga0068855_100302846 3300005563 Bacteria 1770
68 Ga0068855_101803361 3300005563 Bacteria 622
69 Ga0070664_100476316 3300005564 Bacteria 1148
70 Ga0070664_101084902 3300005564 Bacteria 754
71 Ga0068857_100000861 3300005577 Bacteria 22765
72 Ga0070702_100628806 3300005615 Unclassified 809
73 Ga0068852_102105528 3300005616 Unclassified 586
74 Ga0068859_100715035 3300005617 Unclassified 1092
75 Ga0068864_100633674 3300005618 Bacteria 1040
76 Ga0068864_100808560 3300005618 Bacteria 922
77 Ga0068861_100630621 3300005719 Bacteria 988
78 Ga0068861_101318266 3300005719 Unclassified 702
79 Ga0068861_101952546 3300005719 Unclassified 585
80 Ga0068870_10151466 3300005840 Bacteria 1367
81 Ga0068870_10193749 3300005840 Bacteria 1228
82 Ga0068870_10702215 3300005840 Unclassified 698
83 Ga0068870_10839517 3300005840 Bacteria 645
84 Ga0068863_100021482 3300005841 Bacteria 6159
85 Ga0068860_100202472 3300005843 Bacteria 1924
86 Ga0068862_100067346 3300005844 Bacteria 3087
87 Ga0081455_10005913 3300005937 Bacteria 13276
88 Ga0097621_100258279 3300006237 Bacteria 1528
89 Ga0097621_100484322 3300006237 Unclassified 1118
90 Ga0068871_100163817 3300006358 Bacteria 1903
91 Ga0068871_100494723 3300006358 Bacteria 1101
92 Ga0075428_100004833 3300006844 Bacteria 14952
93 Ga0075430_100012942 3300006846 Bacteria 7111
94 Ga0075430_100018356 3300006846 Bacteria 5953
95 Ga0075430_100112896 3300006846 Bacteria 2265
96 Ga0075431_100121584 3300006847 Bacteria 2694
97 Ga0075431_100175986 3300006847 Bacteria 2198
98 Ga0075431_100301847 3300006847 Bacteria 1617
99 Ga0075433_10056152 3300006852 Bacteria 3439
100 Ga0075434_100071019 3300006871 Bacteria 3473
101 Ga0075429_100003087 3300006880 Bacteria 14128
102 Ga0075429_100527424 3300006880 Unclassified 1035
103 Ga0068865_100098866 3300006881 Bacteria 2132
104 Ga0068865_100497047 3300006881 Bacteria 1016
105 Ga0075436_101203470 3300006914 Unclassified 572
106 Ga0097620_100715054 3300006931 Bacteria 1092
107 Ga0075435_100412587 3300007076 Bacteria 1162
108 Ga0075435_100737290 3300007076 Unclassified 857
109 Ga0099794_10054845 3300007265 Unclassified 1925
110 Ga0099795_10003220 3300007788 Bacteria 4013
111 Ga0099795_10605462 3300007788 Unclassified 522
112 Ga0105240_10168047 3300009093 Bacteria 2600
113 Ga0105240_10330272 3300009093 Bacteria 1735
114 Ga0111539_10019385 3300009094 Bacteria 8397
115 Ga0111539_10156092 3300009094 Bacteria 2670
116 Ga0111539_11583850 3300009094 Unclassified 760
117 Ga0111539_13255700 3300009094 Unclassified 523
118 Ga0105245_13059749 3300009098 Bacteria 518
119 Ga0114129_10082325 3300009147 Bacteria 4472
120 Ga0105243_11559853 3300009148 Unclassified 686
121 Ga0105243_11952340 3300009148 Bacteria 620
122 Ga0105241_10118037 3300009174 Bacteria 2132
123 Ga0105241_10437140 3300009174 Bacteria 1155
124 Ga0105241_11034127 3300009174 Bacteria 770
125 Ga0105242_10188485 3300009176 Bacteria 1824
126 Ga0105242_13264123 3300009176 Bacteria 504
127 Ga0105248_10063794 3300009177 Bacteria 4135
128 Ga0105248_10134641 3300009177 Bacteria 2788
129 Ga0105237_10310584 3300009545 Bacteria 1580
130 Ga0105238_10272742 3300009551 Bacteria 1672
131 Ga0105238_10913469 3300009551 Bacteria 897
132 Ga0105249_10115232 3300009553 Bacteria 2546
133 Ga0099796_10000385 3300010159 Bacteria 7226
134 Ga0105239_10053515 3300010375 Bacteria 4428
135 Ga0105246_11012701 3300011119 Bacteria 753
136 Ga0157373_11157746 3300013100 Bacteria 582
137 Ga0157370_10287438 3300013104 Bacteria 1519
138 Ga0157370_10727118 3300013104 Bacteria 905
139 Ga0157370_10932253 3300013104 Bacteria 787
140 Ga0157370_11034546 3300013104 Bacteria 743
141 Ga0157369_10240150 3300013105 Bacteria 1893
142 Ga0157369_10485853 3300013105 Unclassified 1278
143 Ga0157369_10835415 3300013105 Unclassified 946
144 Ga0157378_10393996 3300013297 Unclassified 1363
145 Ga0163162_10315608 3300013306 Bacteria 1696
146 Ga0163162_13303039 3300013306 Bacteria 516
147 Ga0157372_10207272 3300013307 Bacteria 2271
148 Ga0157372_10312398 3300013307 Bacteria 1829
149 Ga0157372_10805622 3300013307 Unclassified 1091
150 Ga0157372_12078932 3300013307 Bacteria 653
151 Ga0157375_10188435 3300013308 Unclassified 2217
152 Ga0157375_11089366 3300013308 Bacteria 935
153 Ga0163163_10135847 3300014325 Unclassified 2501
154 Ga0163163_10398668 3300014325 Bacteria 1434
155 Ga0157380_10030209 3300014326 Bacteria 4148
156 Ga0157380_11117854 3300014326 Bacteria 828
157 Ga0157380_11206067 3300014326 Unclassified 800
158 Ga0157380_13077560 3300014326 Unclassified 532
159 Ga0157377_11580859 3300014745 Unclassified 524
160 Ga0157377_11596655 3300014745 Unclassified 522
161 Ga0157376_10035939 3300014969 Bacteria 4010
162 Ga0157376_11125053 3300014969 Bacteria 812
163 Ga0157376_11341918 3300014969 Unclassified 746
164 Ga0163161_10371204 3300017792 Bacteria 1141
165 Ga0206349_1129739 3300020075 Bacteria 1652
166 Ga0206352_10802353 3300020078 Unclassified 563
167 Ga0206350_11337452 3300020080 Unclassified 599
168 Ga0213872_10000198 3300021361 Bacteria 53480
169 Ga0213872_10035740 3300021361 Unclassified 2271
170 Ga0213872_10369409 3300021361 Unclassified 586
171 Ga0224712_10034990 3300022467 Bacteria 1851
172 Ga0228598_1077053 3300024227 Unclassified 668
173 Ga0207697_10117709 3300025315 Bacteria 1142
174 Ga0207682_10007538 3300025893 Bacteria 4331
175 Ga0207682_10175452 3300025893 Bacteria 977
176 Ga0207682_10337926 3300025893 Unclassified 709
177 Ga0207688_10929939 3300025901 Bacteria 550
178 Ga0207645_10380884 3300025907 Bacteria 947
179 Ga0207643_10018152 3300025908 Bacteria 3854
180 Ga0207643_10264450 3300025908 Bacteria 1063
181 Ga0207643_10556408 3300025908 Bacteria 736
182 Ga0207705_10745910 3300025909 Unclassified 761
183 Ga0207684_10002130 3300025910 Bacteria 20282
184 Ga0207654_10352208 3300025911 Bacteria 1014
185 Ga0207707_11658254 3300025912 Unclassified 502
186 Ga0207695_10091593 3300025913 Bacteria 3054
187 Ga0207695_10258270 3300025913 Unclassified 1640
188 Ga0207695_10387659 3300025913 Bacteria 1282
189 Ga0207695_10450147 3300025913 Bacteria 1171
190 Ga0207671_10150273 3300025914 Bacteria 1799
191 Ga0207663_11429411 3300025916 Bacteria 557
192 Ga0207662_10427495 3300025918 Unclassified 902
193 Ga0207657_10129493 3300025919 Bacteria 2070
194 Ga0207649_10322148 3300025920 Bacteria 1136
195 Ga0207646_10013144 3300025922 Bacteria 7924
196 Ga0207646_10675168 3300025922 Unclassified 925
197 Ga0207646_10813099 3300025922 Bacteria 832
198 Ga0207681_10084768 3300025923 Unclassified 2247
199 Ga0207694_10208906 3300025924 Bacteria 1590
200 Ga0207694_11678910 3300025924 Bacteria 535
201 Ga0207659_10032340 3300025926 Bacteria 3589
202 Ga0207659_10411822 3300025926 Bacteria 1132
203 Ga0207664_10299655 3300025929 Bacteria 1414
204 Ga0207664_11507185 3300025929 Unclassified 594
205 Ga0207686_10930972 3300025934 Unclassified 702
206 Ga0207709_10641542 3300025935 Unclassified 845
207 Ga0207669_10099540 3300025937 Bacteria 1917
208 Ga0207669_11775282 3300025937 Unclassified 527
209 Ga0207704_10178125 3300025938 Unclassified 1533
210 Ga0207691_10035494 3300025940 Bacteria 4626
211 Ga0207691_10810796 3300025940 Bacteria 786
212 Ga0207691_10941634 3300025940 Bacteria 722
213 Ga0207711_10057074 3300025941 Bacteria 3356
214 Ga0207711_11314628 3300025941 Unclassified 665
215 Ga0207689_10114631 3300025942 Bacteria 2215
216 Ga0207689_11653552 3300025942 Unclassified 532
217 Ga0207661_10189063 3300025944 Bacteria 1804
218 Ga0207661_10293227 3300025944 Bacteria 1456
219 Ga0207661_11255148 3300025944 Unclassified 681
220 Ga0207679_10238582 3300025945 Bacteria 1539
221 Ga0207667_10055687 3300025949 Bacteria 4157
222 Ga0207667_10261414 3300025949 Bacteria 1770
223 Ga0207651_10344968 3300025960 Bacteria 1252
224 Ga0207651_10705036 3300025960 Unclassified 889
225 Ga0207712_11369456 3300025961 Unclassified 633
226 Ga0207668_10035902 3300025972 Bacteria 3306
227 Ga0207640_11728871 3300025981 Bacteria 565
228 Ga0207658_10006197 3300025986 Bacteria 8167
229 Ga0207658_10286031 3300025986 Bacteria 1415
230 Ga0207677_12045503 3300026023 Unclassified 532
231 Ga0207639_10094653 3300026041 Bacteria 2399
232 Ga0207708_10109604 3300026075 Bacteria 2142
233 Ga0207641_10038274 3300026088 Bacteria 4009
234 Ga0207676_11132800 3300026095 Bacteria 774
235 Ga0207676_11329554 3300026095 Bacteria 714
236 Ga0207674_10000222 3300026116 Bacteria 70839
237 Ga0207674_10248913 3300026116 Bacteria 1724
238 Ga0207675_100745051 3300026118 Unclassified 991
239 Ga0207683_10226364 3300026121 Bacteria 1705
240 Ga0207683_10306548 3300026121 Bacteria 1453
241 Ga0209179_1000037 3300027512 Bacteria 30658
242 Ga0209588_1113179 3300027671 Unclassified 871
243 Ga0209998_10019224 3300027717 Unclassified 1454
244 Ga0209974_10000747 3300027876 Bacteria 11125
245 Ga0207428_10002585 3300027907 Bacteria 18073
246 Ga0207428_10177992 3300027907 Bacteria 1608
247 Ga0268266_10000001 3300028379 Bacteria 4040580
248 Ga0268266_10054894 3300028379 Bacteria 3424
249 Ga0268266_10232672 3300028379 Bacteria 1698
250 Ga0268265_10107939 3300028380 Bacteria 2265
251 Ga0268265_12253604 3300028380 Unclassified 552
252 Ga0268264_11355830 3300028381 Bacteria 722
253 Ga0265319_1002297 3300028563 Bacteria 10552
254 Ga0265319_1010232 3300028563 Bacteria 3926
255 Ga0265318_10027051 3300028577 Bacteria 2256
256 Ga0307517_10075046 3300028786 Bacteria 2972
257 Ga0307515_10092935 3300028794 Bacteria 3747
258 Ga0265320_10003029 3300031240 Bacteria 11424
259 Ga0265320_10026361 3300031240 Bacteria 3043
260 Ga0265320_10050018 3300031240 Bacteria 2033
261 Ga0265327_10002147 3300031251 Bacteria 21772
262 Ga0265316_10206610 3300031344 Bacteria 1454
263 Ga0307513_10188051 3300031456 Unclassified 1920
264 Ga0316579_10000089 3300031691 Bacteria 23718
265 Ga0316579_10304005 3300031691 Unclassified 771
266 Ga0316576_10002784 3300031727 Bacteria 10048
267 Ga0316578_10004565 3300031728 Bacteria 6561
268 Ga0307516_10011669 3300031730 Bacteria 9534
269 Ga0307405_10384921 3300031731 Unclassified 1093
270 Ga0316577_10000123 3300031733 Bacteria 22566
271 Ga0307410_10162475 3300031852 Bacteria 1675
272 Ga0307407_10288381 3300031903 Unclassified 1140
273 Ga0307409_100727108 3300031995 Unclassified 994
274 Ga0307416_102269491 3300032002 Unclassified 643
275 Ga0307411_10684497 3300032005 Unclassified 891
276 Ga0307411_10690988 3300032005 Bacteria 888
277 Ga0307415_102488753 3300032126 Unclassified 510
278 Ga0316583_10017232 3300032133 Bacteria 2597
279 Ga0316585_10000003 3300032137 Bacteria 34303
280 Ga0316580_10000158 3300032139 Bacteria 13286
281 Ga0316593_10173635 3300032168 Unclassified 791
282 Ga0316592_1025783 3300033524 Bacteria 1268
283 Ga0316588_1216182 3300033528 Unclassified 504
284 Ga0316587_1118249 3300033529 Unclassified 518
285 Ga0316596_1148690 3300033541 Bacteria 643
286 Ga0373934_0000505 3300035086 Bacteria 13698
287 Ga0373953_0428780 3300035117 Unclassified 583
288 Ga0373954_0152396 3300035118 Unclassified 1129
289 Ga0373956_0000714 3300035119 Bacteria 13664
290 Ga0373956_0263228 3300035119 Unclassified 820
291 Ga0373957_0053917 3300035120 Bacteria 1543
292 Ga0373955_0020377 3300035172 Bacteria 3333
293 Ga0373955_0310826 3300035172 Unclassified 951
294 Ga0373955_0864605 3300035172 Unclassified 556
295 Ga0316574_0000235 3300035398 Bacteria 20023
296 Ga0373935_1280602 3300035692 Bacteria 547
297 Ga0373933_0001085 3300035724 Bacteria 16282
298 Ga0373937_0009066 3300036401 Bacteria 8633
299 Ga0373937_0228630 3300036401 Unclassified 1751
300 Ga0316582_0000039 3300036647 Bacteria 30882
301 Ga0316582_1029977 3300036647 Unclassified 562
302 Ga0316584_0008168 3300036712 Bacteria 7196
303 Ga0395900_0466708 3300037418 Unclassified 1216
304 Ga0395905_0097496 3300037471 Unclassified 2760
305 Ga0395905_0796295 3300037471 Bacteria 848
306 Ga0395901_0166662 3300038443 Bacteria 2313
307 Ga0436361_0145339 3300039447 Bacteria 855
308 Ga0436361_0489507 3300039447 Unclassified 2981
309 Ga0436361_0692684 3300039447 Bacteria 133303
310 Ga0436361_0995722 3300039447 Unclassified 755
311 Ga0436363_1397264 3300039450 Bacteria 771
312 Ga0436362_0689483 3300039453 Unclassified 608
313 Ga0451793_0055725 3300041452 Bacteria 915
314 Ga0451802_1378827 3300041460 Unclassified 622
315 Ga0451804_1150957 3300041463 Unclassified 540
316 Ga0451807_0820953 3300041486 Bacteria 1782
317 Ga0451837_1015958 3300041494 Bacteria 1039
318 Ga0451843_0244435 3300041509 Bacteria 533
319 Ga0451843_0531498 3300041509 Unclassified 599
320 Ga0451853_3026828 3300041512 Unclassified 775
321 Ga0453683_0371880 3300044673 Unclassified 919
322 Ga0453684_0413560 3300044712 Bacteria 1508
323 Ga0453684_1161611 3300044712 Bacteria 812
324 Ga0495592_0089458 3300046454 Bacteria 2211
325 Ga0495592_0114627 3300046454 Unclassified 1903
326 Ga0495638_0028827 3300046460 Bacteria 3582
327 Ga0495651_0011710 3300046462 Bacteria 6740
328 Ga0495651_0208743 3300046462 Unclassified 1361
329 Ga0495651_0848888 3300046462 Unclassified 561
330 Ga0495653_0138313 3300046463 Unclassified 1716
331 Ga0495596_0169966 3300046500 Unclassified 847
332 Ga0495628_0030075 3300046516 Bacteria 4400
333 Ga0495628_0459219 3300046516 Unclassified 924
334 Ga0495642_0304743 3300046528 Unclassified 698
335 Ga0495652_0020710 3300046529 Bacteria 5846
336 Ga0495652_0481404 3300046529 Unclassified 864
337 Ga0495587_0068190 3300046536 Unclassified 2072
338 Ga0495587_0584604 3300046536 Unclassified 615
339 Ga0495621_0121005 3300046539 Bacteria 1011
340 Ga0495645_0002551 3300046543 Bacteria 12363
341 Ga0495645_0075603 3300046543 Unclassified 2424
342 Ga0495625_0263635 3300046660 Unclassified 1114
343 Ga0495635_0226193 3300046663 Unclassified 1264
344 Ga0495599_0032345 3300046678 Bacteria 3284
345 Ga0495599_0188020 3300046678 Unclassified 1271
346 Ga0495623_0175191 3300046679 Unclassified 1250
347 Ga0495604_0298287 3300047317 Unclassified 1083
348 Ga0495602_0304372 3300048088 Unclassified 1165
349 Ga0495615_0090895 3300048090 Bacteria 850
350 Ga0496106_0827203 3300048909 Bacteria 734
351 Ga0496114_0747965 3300048917 Bacteria 855
352 Ga0496114_1371636 3300048917 Bacteria 594
353 Ga0496115_0000014 3300048918 Bacteria 204935
354 Ga0496126_0000047 3300048929 Bacteria 322212
355 Ga0501036_1329353 3300049572 Bacteria 584
356 Ga0501039_1195600 3300049575 Bacteria 588
357 Ga0501067_0312747 3300049583 Bacteria 875
358 Ga0501068_1061571 3300049584 Unclassified 535
359 Ga0501075_1288307 3300049591 Bacteria 554
360 Ga0501076_0815971 3300049592 Bacteria 770
361 Ga0501079_0662559 3300049741 Bacteria 822
362 nmdc:mga05p37_2520_c1 3300050507 Bacteria 21282
363 nmdc:mga09592_207_c1 3300050508 Bacteria 42260
364 nmdc:mga09592_838436_c1 3300050508 Unclassified 776
365 nmdc:mga09592_932319_c1 3300050508 Unclassified 729
366 nmdc:mga0qj67_1195529_c1 3300050509 Bacteria 592
367 nmdc:mga0qj67_65087_c2 3300050509 Bacteria 2596
368 nmdc:mga0qj67_7555_c1 3300050509 Bacteria 8034
369 nmdc:mga06r32_166373_c1 3300050510 Bacteria 2188
370 nmdc:mga06r32_519_c1 3300050510 Bacteria 33190
371 nmdc:mga06r32_644993_c1 3300050510 Unclassified 1027
372 nmdc:mga08y16_41344_c1 3300050511 Bacteria 4829
373 nmdc:mga08y16_4144_c1 3300050511 Bacteria 15133
374 nmdc:mga0n895_75384_c1 3300050512 Bacteria 3353
375 nmdc:mga08x19_8127_c1 3300050514 Bacteria 6235
376 nmdc:mga0a205_29586_c1 3300050515 Bacteria 5242
377 Ga0495601_0126717 3300053077 Bacteria 1661
378 Ga0495619_0079780 3300053085 Bacteria 2202
379 Ga0500628_092806 3300053129 Unclassified 789
380 Ga0500645_054298 3300053730 Bacteria 1166
381 Ga0070683_100253669
382 rootL2_10048126
383 Ga0070658_10479156
384 Ga0070676_10611361
385 Ga0070690_100222481
386 Ga0070690_100547449
387 Ga0070670_100481934
388 Ga0070670_101229423
389 Ga0070670_101939461
390 Ga0070677_10338841
391 Ga0070677_10682402
392 Ga0068868_101134237
393 Ga0070660_100124623
394 Ga0070661_101250819
395 Ga0070668_100116031
396 Ga0070668_101391196
397 Ga0070669_100044427
398 Ga0070675_100088498
399 Ga0070675_100201972
400 Ga0070675_101642634
401 Ga0070674_100016461
402 Ga0070674_101122961
403 Ga0070673_100034420
404 Ga0070673_101912993
405 Ga0070667_100809312
406 Ga0070667_101234169
407 Ga0070709_11007535
408 Ga0070709_11176146
409 Ga0070714_100009628
410 Ga0070714_100364957
411 Ga0070714_101355006
412 Ga0070713_101205680
413 Ga0070701_10945752
414 Ga0070705_100263742
415 Ga0070705_101105054
416 Ga0070700_100133874
417 Ga0070708_100111980
418 Ga0070708_100190723
419 Ga0070708_101538786
420 Ga0070708_101617541
421 Ga0070663_100408721
422 Ga0070678_100228303
423 Ga0070678_100293191
424 Ga0070662_100507804
425 Ga0070662_101246684
426 Ga0068867_102094817
427 Ga0070685_10016324
428 Ga0070706_100074917
429 Ga0070707_100021995
430 Ga0070707_100223843
431 Ga0070707_100456010
432 Ga0070707_100608400
433 Ga0070698_100109807
434 Ga0070699_100162893
435 Ga0070699_100208437
436 Ga0070679_100597536
437 Ga0070684_100258759
438 Ga0070684_100422263
439 Ga0068853_100157977
440 Ga0068853_100414635
441 Ga0070672_100430474
442 Ga0070672_101056596
443 Ga0070686_101858387
444 Ga0070696_100224801
445 Ga0070665_100000182
446 Ga0068855_100243253
447 Ga0068855_100302846
448 Ga0068855_101803361
449 Ga0070664_100476316
450 Ga0070664_101084902
451 Ga0068857_100000861
452 Ga0070702_100628806
453 Ga0068852_102105528
454 Ga0068859_100715035
455 Ga0068864_100633674
456 Ga0068864_100808560
457 Ga0068861_100630621
458 Ga0068861_101318266
459 Ga0068861_101952546
460 Ga0068870_10151466
461 Ga0068870_10193749
462 Ga0068870_10702215
463 Ga0068870_10839517
464 Ga0068863_100021482
465 Ga0068860_100202472
466 Ga0068862_100067346
467 Ga0081455_10005913
468 Ga0097621_100258279
469 Ga0097621_100484322
470 Ga0068871_100163817
471 Ga0068871_100494723
472 Ga0075428_100004833
473 Ga0075430_100012942
474 Ga0075430_100018356
475 Ga0075430_100112896
476 Ga0075431_100121584
477 Ga0075431_100175986
478 Ga0075431_100301847
479 Ga0075433_10056152
480 Ga0075434_100071019
481 Ga0075429_100003087
482 Ga0075429_100527424
483 Ga0068865_100098866
484 Ga0068865_100497047
485 Ga0075436_101203470
486 Ga0097620_100715054
487 Ga0075435_100412587
488 Ga0075435_100737290
489 Ga0099794_10054845
490 Ga0099795_10003220
491 Ga0099795_10605462
492 Ga0105240_10168047
493 Ga0105240_10330272
494 Ga0111539_10019385
495 Ga0111539_10156092
496 Ga0111539_11583850
497 Ga0111539_13255700
498 Ga0105245_13059749
499 Ga0114129_10082325
500 Ga0105243_11559853
501 Ga0105243_11952340
502 Ga0105241_10118037
503 Ga0105241_10437140
504 Ga0105241_11034127
505 Ga0105242_10188485
506 Ga0105242_13264123
507 Ga0105248_10063794
508 Ga0105248_10134641
509 Ga0105237_10310584
510 Ga0105238_10272742
511 Ga0105238_10913469
512 Ga0105249_10115232
513 Ga0099796_10000385
514 Ga0105239_10053515
515 Ga0105246_11012701
516 Ga0157373_11157746
517 Ga0157370_10287438
518 Ga0157370_10727118
519 Ga0157370_10932253
520 Ga0157370_11034546
521 Ga0157369_10240150
522 Ga0157369_10485853
523 Ga0157369_10835415
524 Ga0157378_10393996
525 Ga0163162_10315608
526 Ga0163162_13303039
527 Ga0157372_10207272
528 Ga0157372_10312398
529 Ga0157372_10805622
530 Ga0157372_12078932
531 Ga0157375_10188435
532 Ga0157375_11089366
533 Ga0163163_10135847
534 Ga0163163_10398668
535 Ga0157380_10030209
536 Ga0157380_11117854
537 Ga0157380_11206067
538 Ga0157380_13077560
539 Ga0157377_11580859
540 Ga0157377_11596655
541 Ga0157376_10035939
542 Ga0157376_11125053
543 Ga0157376_11341918
544 Ga0163161_10371204
545 Ga0206349_1129739
546 Ga0206352_10802353
547 Ga0206350_11337452
548 Ga0213872_10000198
549 Ga0213872_10035740
550 Ga0213872_10369409
551 Ga0224712_10034990
552 Ga0228598_1077053
553 Ga0207697_10117709
554 Ga0207682_10007538
555 Ga0207682_10175452
556 Ga0207682_10337926
557 Ga0207688_10929939
558 Ga0207645_10380884
559 Ga0207643_10018152
560 Ga0207643_10264450
561 Ga0207643_10556408
562 Ga0207705_10745910
563 Ga0207684_10002130
564 Ga0207654_10352208
565 Ga0207707_11658254
566 Ga0207695_10091593
567 Ga0207695_10258270
568 Ga0207695_10387659
569 Ga0207695_10450147
570 Ga0207671_10150273
571 Ga0207663_11429411
572 Ga0207662_10427495
573 Ga0207657_10129493
574 Ga0207649_10322148
575 Ga0207646_10013144
576 Ga0207646_10675168
577 Ga0207646_10813099
578 Ga0207681_10084768
579 Ga0207694_10208906
580 Ga0207694_11678910
581 Ga0207659_10032340
582 Ga0207659_10411822
583 Ga0207664_10299655
584 Ga0207664_11507185
585 Ga0207686_10930972
586 Ga0207709_10641542
587 Ga0207669_10099540
588 Ga0207669_11775282
589 Ga0207704_10178125
590 Ga0207691_10035494
591 Ga0207691_10810796
592 Ga0207691_10941634
593 Ga0207711_10057074
594 Ga0207711_11314628
595 Ga0207689_10114631
596 Ga0207689_11653552
597 Ga0207661_10189063
598 Ga0207661_10293227
599 Ga0207661_11255148
600 Ga0207679_10238582
601 Ga0207667_10055687
602 Ga0207667_10261414
603 Ga0207651_10344968
604 Ga0207651_10705036
605 Ga0207712_11369456
606 Ga0207668_10035902
607 Ga0207640_11728871
608 Ga0207658_10006197
609 Ga0207658_10286031
610 Ga0207677_12045503
611 Ga0207639_10094653
612 Ga0207708_10109604
613 Ga0207641_10038274
614 Ga0207676_11132800
615 Ga0207676_11329554
616 Ga0207674_10000222
617 Ga0207674_10248913
618 Ga0207675_100745051
619 Ga0207683_10226364
620 Ga0207683_10306548
621 Ga0209179_1000037
622 Ga0209588_1113179
623 Ga0209998_10019224
624 Ga0209974_10000747
625 Ga0207428_10002585
626 Ga0207428_10177992
627 Ga0268266_10000001
628 Ga0268266_10054894
629 Ga0268266_10232672
630 Ga0268265_10107939
631 Ga0268265_12253604
632 Ga0268264_11355830
633 Ga0265319_1002297
634 Ga0265319_1010232
635 Ga0265318_10027051
636 Ga0307517_10075046
637 Ga0307515_10092935
638 Ga0265320_10003029
639 Ga0265320_10026361
640 Ga0265320_10050018
641 Ga0265327_10002147
642 Ga0265316_10206610
643 Ga0307513_10188051
644 Ga0316579_10000089
645 Ga0316579_10304005
646 Ga0316576_10002784
647 Ga0316578_10004565
648 Ga0307516_10011669
649 Ga0307405_10384921
650 Ga0316577_10000123
651 Ga0307410_10162475
652 Ga0307407_10288381
653 Ga0307409_100727108
654 Ga0307416_102269491
655 Ga0307411_10684497
656 Ga0307411_10690988
657 Ga0307415_102488753
658 Ga0316583_10017232
659 Ga0316585_10000003
660 Ga0316580_10000158
661 Ga0316593_10173635
662 Ga0316592_1025783
663 Ga0316588_1216182
664 Ga0316587_1118249
665 Ga0316596_1148690
666 Ga0373934_0000505
667 Ga0373953_0428780
668 Ga0373954_0152396
669 Ga0373956_0000714
670 Ga0373956_0263228
671 Ga0373957_0053917
672 Ga0373955_0020377
673 Ga0373955_0310826
674 Ga0373955_0864605
675 Ga0316574_0000235
676 Ga0373935_1280602
677 Ga0373933_0001085
678 Ga0373937_0009066
679 Ga0373937_0228630
680 Ga0316582_0000039
681 Ga0316582_1029977
682 Ga0316584_0008168
683 Ga0395900_0466708
684 Ga0395905_0097496
685 Ga0395905_0796295
686 Ga0395901_0166662
687 Ga0436361_0145339
688 Ga0436361_0489507
689 Ga0436361_0692684
690 Ga0436361_0995722
691 Ga0436363_1397264
692 Ga0436362_0689483
693 Ga0451793_0055725
694 Ga0451802_1378827
695 Ga0451804_1150957
696 Ga0451807_0820953
697 Ga0451837_1015958
698 Ga0451843_0244435
699 Ga0451843_0531498
700 Ga0451853_3026828
701 Ga0453683_0371880
702 Ga0453684_0413560
703 Ga0453684_1161611
704 Ga0495592_0089458
705 Ga0495592_0114627
706 Ga0495638_0028827
707 Ga0495651_0011710
708 Ga0495651_0208743
709 Ga0495651_0848888
710 Ga0495653_0138313
711 Ga0495596_0169966
712 Ga0495628_0030075
713 Ga0495628_0459219
714 Ga0495642_0304743
715 Ga0495652_0020710
716 Ga0495652_0481404
717 Ga0495587_0068190
718 Ga0495587_0584604
719 Ga0495621_0121005
720 Ga0495645_0002551
721 Ga0495645_0075603
722 Ga0495625_0263635
723 Ga0495635_0226193
724 Ga0495599_0032345
725 Ga0495599_0188020
726 Ga0495623_0175191
727 Ga0495604_0298287
728 Ga0495602_0304372
729 Ga0495615_0090895
730 Ga0496106_0827203
731 Ga0496114_0747965
732 Ga0496114_1371636
733 Ga0496115_0000014
734 Ga0496126_0000047
735 Ga0501036_1329353
736 Ga0501039_1195600
737 Ga0501067_0312747
738 Ga0501068_1061571
739 Ga0501075_1288307
740 Ga0501076_0815971
741 Ga0501079_0662559
742 nmdc:mga05p37_2520_c1
743 nmdc:mga09592_207_c1
744 nmdc:mga09592_838436_c1
745 nmdc:mga09592_932319_c1
746 nmdc:mga0qj67_1195529_c1
747 nmdc:mga0qj67_65087_c2
748 nmdc:mga0qj67_7555_c1
749 nmdc:mga06r32_166373_c1
750 nmdc:mga06r32_519_c1
751 nmdc:mga06r32_644993_c1
752 nmdc:mga08y16_41344_c1
753 nmdc:mga08y16_4144_c1
754 nmdc:mga0n895_75384_c1
755 nmdc:mga08x19_8127_c1
756 nmdc:mga0a205_29586_c1
757 Ga0495601_0126717
758 Ga0495619_0079780
759 Ga0500628_092806
760 Ga0500645_054298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15919

HicB_lk_antitox

HicB_like antitoxin of bacterial toxin-antitoxin system

17

83

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsy-assembly1.cif.gz_C crystal structure of ttha0281 from thermus thermophilus hb8 0.9128 5 58
6g1c-assembly1.cif.gz_C crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.9106 1 56
6g1c-assembly1.cif.gz_V crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.908 5 62
6g1n-assembly1.cif.gz_D crystal structure of the burkholderia pseudomallei antitoxin hicb 0.9046 5 62
6g1n-assembly1.cif.gz_B crystal structure of the burkholderia pseudomallei antitoxin hicb 0.8947 1 62
ID Description Score Start End Superfamily
af_Q9SP32_1731_1808_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8514 2 53 3.30.160.20
3k6qA02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8417 1 53 3.30.160.620
af_Q7ZW47_490_558_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8323 2 48 3.30.160.20
af_P67697_1_89_3.30.160.250 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8232 1 71 3.30.160.250
4p78B00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8107 3 62 3.30.160.250
ID Description Score Start End GO Terms
AF-A0A256W9Y4-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.005 1 51
AF-A0A7G7T1Q6-F1-model_v4 HicB_like antitoxin of bacterial toxin-antitoxin system 1.004 1 70
AF-A0A1W9R4W4-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.004 1 52
AF-A0A368T6M0-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 1.003 2 58
AF-A0A849SLR7-F1-model_v4 Type II toxin-antitoxin system HicB family antitoxin 1 1 69

Map