F423654

General Info

Members Datasets Scaffolds Average Seq Length
365 216 356 217

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10002614|Ga0114129_1000261414
Length 245
Sequence MPTGPRQRSRRKLVRSKHEEDETMWGSRSKLAMPSKDKVLPGRSERMRVPAAHFVNRHPLAAPFPAGLEMAMFGLGCFWGAERKFWEAPGVFTTAVGYAAGFTPNPTYEEVCTGLTGHNEVVLVVFDPKVISYDGILKVFWESHDPTQGMRQGNDVGTQYRSGIYVYTPEQRRQAEASRDAYQRLLGKAGYGPITTEILDAPEFYYAEDYHQQYLAKNPGGYCGLGGTGVACPTGLVEAAGRATS

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
4 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
5 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
6 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
7 2849660919 Nostoc sp. T09 Isolate Unclassified
8 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
9 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
151 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
152 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.34
Metatranscriptomes 2.19
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.01
Nodule 0.55
Rhizoplane 0.55
Rhizosphere 89.59
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10007832 3300003323 Bacteria 40222
2 Ga0070658_10109897 3300005327 Bacteria 2283
3 Ga0068869_100257820 3300005334 Bacteria 1395
4 Ga0070666_10131101 3300005335 Bacteria 1742
5 Ga0070680_100358161 3300005336 Bacteria 1241
6 Ga0068868_100255725 3300005338 Bacteria 1475
7 Ga0070689_100098966 3300005340 Bacteria 2307
8 Ga0070668_100226252 3300005347 Bacteria 1545
9 Ga0070669_100170591 3300005353 Bacteria 1696
10 Ga0070675_100177128 3300005354 Bacteria 1842
11 Ga0070674_100004580 3300005356 Bacteria 7896
12 Ga0070674_100240812 3300005356 Bacteria 1416
13 Ga0070674_100300814 3300005356 Bacteria 1279
14 Ga0070673_100156194 3300005364 Bacteria 1936
15 Ga0070673_100183752 3300005364 Bacteria 1791
16 Ga0070673_100379818 3300005364 Bacteria 1259
17 Ga0070688_100000946 3300005365 Bacteria 14544
18 Ga0070705_100019878 3300005440 Bacteria 3541
19 Ga0070708_100789723 3300005445 Bacteria 893
20 Ga0070708_100937046 3300005445 Bacteria 813
21 Ga0070678_100076303 3300005456 Bacteria 2524
22 Ga0070678_100121914 3300005456 Bacteria 2057
23 Ga0068867_100009826 3300005459 Bacteria 6742
24 Ga0068867_100209474 3300005459 Bacteria 1565
25 Ga0068867_100302528 3300005459 Bacteria 1319
26 Ga0068867_100391979 3300005459 Bacteria 1169
27 Ga0070685_10000017 3300005466 Bacteria 110716
28 Ga0070685_10137960 3300005466 Bacteria 1532
29 Ga0070706_100242796 3300005467 Bacteria 1682
30 Ga0070706_100252886 3300005467 Bacteria 1645
31 Ga0070699_100556790 3300005518 Bacteria 1044
32 Ga0070695_100210433 3300005545 Bacteria 1395
33 Ga0070696_100029293 3300005546 Bacteria 3762
34 Ga0070704_100531493 3300005549 Bacteria 1025
35 Ga0068857_100512440 3300005577 Bacteria 1127
36 Ga0070702_100720009 3300005615 Bacteria 763
37 Ga0068852_100574957 3300005616 Bacteria 1129
38 Ga0068859_101116273 3300005617 Bacteria 867
39 Ga0068866_10033517 3300005718 Bacteria 2493
40 Ga0068861_100018420 3300005719 Bacteria 4975
41 Ga0068863_100049854 3300005841 Bacteria 3970
42 Ga0068863_100911404 3300005841 Bacteria 880
43 Ga0068858_100269568 3300005842 Bacteria 1620
44 Ga0068858_100693233 3300005842 Bacteria 991
45 Ga0068860_100000909 3300005843 Bacteria 32837
46 Ga0068860_100265809 3300005843 Bacteria 1673
47 Ga0068860_100307852 3300005843 Bacteria 1553
48 Ga0068862_100142682 3300005844 Bacteria 2127
49 Ga0068862_100763242 3300005844 Bacteria 942
50 Ga0081540_1054382 3300005983 Bacteria 1957
51 Ga0081539_10088734 3300005985 Bacteria 1603
52 Ga0075366_10005986 3300006195 Bacteria 6624
53 Ga0075366_10050278 3300006195 Bacteria 2475
54 Ga0097621_100015129 3300006237 Bacteria 5796
55 Ga0097621_100058268 3300006237 Bacteria 3160
56 Ga0097621_100143975 3300006237 Bacteria 2039
57 Ga0068871_100001175 3300006358 Bacteria 17558
58 Ga0068871_100003395 3300006358 Bacteria 10943
59 Ga0075428_100016908 3300006844 Bacteria 8056
60 Ga0075428_100905622 3300006844 Bacteria 935
61 Ga0075430_100015008 3300006846 Bacteria 6595
62 Ga0075430_100109810 3300006846 Bacteria 2300
63 Ga0075431_100050896 3300006847 Bacteria 4271
64 Ga0075431_100111409 3300006847 Bacteria 2824
65 Ga0075431_100129992 3300006847 Bacteria 2598
66 Ga0075431_100538266 3300006847 Bacteria 1156
67 Ga0075433_10000200 3300006852 Bacteria 33533
68 Ga0075433_10069859 3300006852 Bacteria 3085
69 Ga0075433_10249304 3300006852 Bacteria 1576
70 Ga0075434_100001883 3300006871 Bacteria 18167
71 Ga0075434_100083388 3300006871 Bacteria 3194
72 Ga0075434_100136140 3300006871 Bacteria 2475
73 Ga0075434_100159880 3300006871 Bacteria 2273
74 Ga0075429_100003065 3300006880 Bacteria 14160
75 Ga0075429_100013818 3300006880 Bacteria 7002
76 Ga0068865_100119157 3300006881 Bacteria 1959
77 Ga0068865_100119580 3300006881 Bacteria 1956
78 Ga0075436_100176800 3300006914 Bacteria 1508
79 Ga0097620_101116287 3300006931 Bacteria 867
80 Ga0075435_100002166 3300007076 Bacteria 12947
81 Ga0075435_100010977 3300007076 Bacteria 6640
82 Ga0075435_100032232 3300007076 Bacteria 4137
83 Ga0075435_100423484 3300007076 Bacteria 1147
84 Ga0099794_10058261 3300007265 Bacteria 1872
85 Ga0105240_10981633 3300009093 Bacteria 904
86 Ga0111539_10003270 3300009094 Bacteria 21420
87 Ga0111539_10015277 3300009094 Bacteria 9563
88 Ga0111539_10155488 3300009094 Bacteria 2676
89 Ga0111539_10579068 3300009094 Bacteria 1307
90 Ga0105245_10005347 3300009098 Bacteria 11279
91 Ga0105245_10097935 3300009098 Bacteria 2709
92 Ga0105245_10410050 3300009098 Bacteria 1356
93 Ga0114129_10002614 3300009147 Bacteria 25050
94 Ga0114129_10010293 3300009147 Bacteria 13344
95 Ga0114129_10027523 3300009147 Bacteria 8048
96 Ga0114129_10076272 3300009147 Bacteria 4668
97 Ga0114129_10086403 3300009147 Bacteria 4350
98 Ga0114129_10104949 3300009147 Bacteria 3905
99 Ga0114129_10113375 3300009147 Bacteria 3738
100 Ga0114129_10646604 3300009147 Bacteria 1365
101 Ga0105243_10163730 3300009148 Bacteria 1920
102 Ga0105243_10343078 3300009148 Bacteria 1369
103 Ga0105243_10780517 3300009148 Bacteria 940
104 Ga0105242_10008125 3300009176 Bacteria 8073
105 Ga0105242_10025015 3300009176 Bacteria 4720
106 Ga0105248_10098177 3300009177 Bacteria 3300
107 Ga0105249_10063958 3300009553 Bacteria 3381
108 Ga0157375_10223742 3300013308 Bacteria 2041
109 Ga0157380_10010864 3300014326 Bacteria 6566
110 Ga0157380_10074473 3300014326 Bacteria 2756
111 Ga0157380_10485508 3300014326 Bacteria 1196
112 Ga0157379_10155704 3300014968 Bacteria 2061
113 Ga0157376_10001277 3300014969 Bacteria 16548
114 Ga0157376_10025356 3300014969 Bacteria 4669
115 Ga0157376_10058442 3300014969 Bacteria 3230
116 Ga0182005_1006638 3300015265 Bacteria 3517
117 Ga0163161_10411168 3300017792 Bacteria 1087
118 Ga0197907_10140303 3300020069 Bacteria 1514
119 Ga0206356_11334441 3300020070 Bacteria 863
120 Ga0206349_1342846 3300020075 Bacteria 1275
121 Ga0206352_10728663 3300020078 Bacteria 1317
122 Ga0206354_10860443 3300020081 Bacteria 1440
123 Ga0206353_10934618 3300020082 Bacteria 1931
124 Ga0224712_10075237 3300022467 Bacteria 1381
125 Ga0207710_10015781 3300025900 Bacteria 3194
126 Ga0207680_10354339 3300025903 Bacteria 1031
127 Ga0207705_10072319 3300025909 Bacteria 2501
128 Ga0207684_10042229 3300025910 Bacteria 3865
129 Ga0207684_10273964 3300025910 Bacteria 1456
130 Ga0207684_10532232 3300025910 Bacteria 1006
131 Ga0207660_10317447 3300025917 Bacteria 1243
132 Ga0207681_10110755 3300025923 Bacteria 1997
133 Ga0207659_10163609 3300025926 Bacteria 1749
134 Ga0207659_10258495 3300025926 Bacteria 1416
135 Ga0207659_10490628 3300025926 Bacteria 1039
136 Ga0207709_10176941 3300025935 Bacteria 1503
137 Ga0207709_10264173 3300025935 Bacteria 1263
138 Ga0207669_10041261 3300025937 Bacteria 2685
139 Ga0207669_10314724 3300025937 Bacteria 1195
140 Ga0207669_10490180 3300025937 Bacteria 981
141 Ga0207704_10049903 3300025938 Bacteria 2521
142 Ga0207704_10411781 3300025938 Bacteria 1069
143 Ga0207691_10223931 3300025940 Bacteria 1630
144 Ga0207711_10054282 3300025941 Bacteria 3438
145 Ga0207711_10634363 3300025941 Bacteria 997
146 Ga0207667_10170253 3300025949 Bacteria 2239
147 Ga0207651_10263297 3300025960 Bacteria 1417
148 Ga0207712_10085432 3300025961 Bacteria 2309
149 Ga0207668_10223162 3300025972 Bacteria 1515
150 Ga0207703_10320580 3300026035 Bacteria 1419
151 Ga0207703_10384144 3300026035 Bacteria 1300
152 Ga0207678_10027730 3300026067 Bacteria 4945
153 Ga0207708_10512730 3300026075 Bacteria 1007
154 Ga0207641_10030761 3300026088 Bacteria 4448
155 Ga0207641_10092823 3300026088 Bacteria 2644
156 Ga0207641_10456063 3300026088 Bacteria 1236
157 Ga0207648_10052486 3300026089 Bacteria 3565
158 Ga0207648_10159230 3300026089 Bacteria 1994
159 Ga0207648_10248958 3300026089 Bacteria 1584
160 Ga0207675_100029594 3300026118 Bacteria 5101
161 Ga0207683_10083595 3300026121 Bacteria 2837
162 Ga0207683_10087474 3300026121 Bacteria 2771
163 Ga0207428_10000013 3300027907 Bacteria 346742
164 Ga0207428_10000235 3300027907 Bacteria 75923
165 Ga0207428_10045457 3300027907 Bacteria 3536
166 Ga0207428_10089117 3300027907 Bacteria 2398
167 Ga0268266_10056576 3300028379 Bacteria 3374
168 Ga0268266_10245425 3300028379 Bacteria 1654
169 Ga0268265_10038897 3300028380 Bacteria 3502
170 Ga0268265_10142289 3300028380 Bacteria 2010
171 Ga0268264_10000004 3300028381 Bacteria 1116842
172 Ga0268264_10209895 3300028381 Bacteria 1787
173 Ga0268264_10384874 3300028381 Bacteria 1344
174 Ga0265327_10018537 3300031251 Bacteria 4310
175 Ga0265316_10119827 3300031344 Bacteria 1988
176 Ga0307509_10119621 3300031507 Bacteria 2615
177 Ga0307408_100004156 3300031548 Bacteria 9864
178 Ga0307408_100064676 3300031548 Bacteria 2680
179 Ga0307408_100074357 3300031548 Bacteria 2521
180 Ga0307408_100457801 3300031548 Bacteria 1108
181 Ga0307508_10001844 3300031616 Bacteria 23446
182 Ga0316575_10023015 3300031665 Bacteria 2406
183 Ga0316575_10123633 3300031665 Bacteria 1059
184 Ga0316579_10120176 3300031691 Bacteria 1262
185 Ga0316579_10160277 3300031691 Bacteria 1087
186 Ga0316576_10085846 3300031727 Bacteria 2340
187 Ga0316576_10183122 3300031727 Bacteria 1580
188 Ga0316578_10074882 3300031728 Bacteria 2008
189 Ga0307516_10006556 3300031730 Bacteria 13617
190 Ga0316577_10011543 3300031733 Bacteria 4787
191 Ga0307413_10183322 3300031824 Bacteria 1495
192 Ga0307413_10205848 3300031824 Bacteria 1425
193 Ga0307406_10045792 3300031901 Bacteria 2749
194 Ga0307407_10459798 3300031903 Bacteria 925
195 Ga0307407_10555820 3300031903 Bacteria 849
196 Ga0307407_10833191 3300031903 Bacteria 704
197 Ga0307409_100251308 3300031995 Bacteria 1616
198 Ga0307416_100186163 3300032002 Bacteria 1952
199 Ga0307411_10157853 3300032005 Bacteria 1694
200 Ga0307411_11266089 3300032005 Bacteria 671
201 Ga0307415_100020936 3300032126 Bacteria 4007
202 Ga0316593_10005378 3300032168 Bacteria 3371
203 Ga0307507_10171105 3300033179 Bacteria 1578
204 Ga0373948_0001784 3300034817 Bacteria 3060
205 Ga0373959_0007139 3300034820 Bacteria 1874
206 Ga0373938_0011690 3300034957 Bacteria 1637
207 Ga0373929_0038482 3300035085 Bacteria 1052
208 Ga0373940_0002476 3300035088 Bacteria 3599
209 Ga0373949_0001151 3300035090 Bacteria 7930
210 Ga0373949_0018922 3300035090 Bacteria 1565
211 Ga0373951_0002436 3300035091 Bacteria 4691
212 Ga0373952_0000604 3300035092 Bacteria 6357
213 Ga0373932_0006068 3300035112 Bacteria 2851
214 Ga0373939_0002930 3300035114 Bacteria 4011
215 Ga0373939_0019250 3300035114 Bacteria 1840
216 Ga0373941_0028345 3300035115 Bacteria 1643
217 Ga0373941_0121320 3300035115 Bacteria 932
218 Ga0373960_0002612 3300035121 Bacteria 4071
219 Ga0373943_0475467 3300035170 Bacteria 728
220 Ga0373942_0002035 3300035207 Bacteria 5022
221 Ga0373961_0000018 3300035241 Bacteria 101570
222 Ga0373961_0002166 3300035241 Bacteria 5215
223 Ga0373962_0004725 3300035242 Bacteria 3286
224 Ga0316574_0023268 3300035398 Bacteria 3699
225 Ga0373931_0022318 3300035691 Bacteria 3184
226 Ga0373931_0126321 3300035691 Bacteria 1467
227 Ga0373937_0541349 3300036401 Bacteria 1106
228 Ga0316582_0014150 3300036647 Bacteria 4518
229 Ga0316584_0007104 3300036712 Bacteria 7630
230 Ga0316584_0526479 3300036712 Bacteria 828
231 Ga0316581_0000467 3300037588 Bacteria 7743
232 Ga0436364_0789343 3300037853 Bacteria 1551
233 Ga0400490_15945 3300038726 Bacteria 2102
234 Ga0400491_11277 3300038727 Bacteria 2023
235 Ga0400488_01816 3300038741 Unclassified 2538
236 Ga0400488_18280 3300038741 Bacteria 2663
237 Ga0400488_41388 3300038741 Bacteria 13211
238 Ga0400483_100798 3300039062 Bacteria 5030
239 Ga0400483_144406 3300039062 Bacteria 3180
240 Ga0400483_210902 3300039062 Bacteria 6829
241 Ga0400483_245064 3300039062 Bacteria 2308
242 Ga0400483_250616 3300039062 Bacteria 27210
243 Ga0400487_25585 3300039110 Bacteria 50614
244 Ga0436363_0276649 3300039450 Bacteria 1736
245 Ga0439441_037970 3300042001 Bacteria 956
246 Ga0439462_0072418 3300042015 Bacteria 936
247 Ga0451577_0078157 3300042876 Bacteria 2951
248 Ga0451577_0190344 3300042876 Bacteria 1851
249 Ga0453684_0008778 3300044712 Bacteria 17937
250 Ga0453684_0205023 3300044712 Bacteria 2296
251 Ga0451576_0017071 3300045051 Bacteria 7987
252 Ga0451576_0066766 3300045051 Bacteria 3744
253 Ga0451576_0072556 3300045051 Bacteria 3582
254 Ga0466958_0585215 3300045836 Bacteria 726
255 Ga0495629_0031313 3300046459 Bacteria 3767
256 Ga0495580_0003424 3300046472 Bacteria 13515
257 Ga0495608_0535016 3300046511 Bacteria 707
258 Ga0495630_0392600 3300046517 Bacteria 1063
259 Ga0495642_0045711 3300046528 Bacteria 1790
260 Ga0495640_0134453 3300046533 Bacteria 1598
261 Ga0495635_0142689 3300046663 Bacteria 1631
262 Ga0495659_0009709 3300046664 Bacteria 3078
263 Ga0495659_0101117 3300046664 Bacteria 1117
264 Ga0495658_0056892 3300046683 Bacteria 2232
265 Ga0495658_0080369 3300046683 Bacteria 1912
266 Ga0495613_0416320 3300046689 Bacteria 915
267 Ga0495636_0154440 3300047318 Bacteria 1031
268 Ga0495636_0179223 3300047318 Bacteria 961
269 Ga0495674_0192238 3300047319 Bacteria 1696
270 Ga0496105_0057714 3300048908 Bacteria 3205
271 Ga0496115_0520107 3300048918 Bacteria 954
272 Ga0501031_0119249 3300049568 Bacteria 1724
273 Ga0501032_0102665 3300049569 Bacteria 1895
274 Ga0501033_0307086 3300049570 Bacteria 1116
275 Ga0501034_0002434 3300049571 Bacteria 22482
276 Ga0501036_0130687 3300049572 Bacteria 2120
277 Ga0501036_0614288 3300049572 Bacteria 901
278 Ga0501037_0009708 3300049573 Bacteria 7064
279 Ga0501037_0217261 3300049573 Bacteria 1346
280 Ga0501038_0016356 3300049574 Bacteria 6725
281 Ga0501038_0048775 3300049574 Bacteria 3663
282 Ga0501043_0002326 3300049579 Bacteria 16096
283 Ga0501047_0050924 3300049581 Bacteria 3999
284 Ga0501047_0101796 3300049581 Unclassified 2752
285 Ga0501048_0133269 3300049582 Bacteria 1756
286 Ga0501067_0159543 3300049583 Bacteria 1256
287 Ga0501069_0108549 3300049585 Bacteria 1579
288 Ga0501070_0066046 3300049586 Bacteria 2995
289 Ga0501070_0168111 3300049586 Bacteria 1807
290 Ga0501073_0001711 3300049589 Bacteria 16281
291 Ga0501073_0027512 3300049589 Bacteria 4066
292 Ga0501075_0746662 3300049591 Bacteria 745
293 Ga0501080_0001724 3300049742 Bacteria 18686
294 Ga0501080_0224871 3300049742 Bacteria 1716
295 Ga0501083_0072877 3300049744 Bacteria 2282
296 Ga0501278_009967 3300049774 Bacteria 752
297 Ga0501044_0001009 3300049823 Bacteria 33822
298 Ga0501044_0001746 3300049823 Bacteria 25368
299 Ga0501044_0363695 3300049823 Bacteria 1364
300 nmdc:mga05p37_111526_c1 3300050507 Bacteria 3364
301 nmdc:mga05p37_12530_c1 3300050507 Bacteria 10124
302 nmdc:mga05p37_2483_c1 3300050507 Bacteria 21448
303 nmdc:mga05p37_569054_c1 3300050507 Bacteria 1286
304 nmdc:mga05p37_600642_c1 3300050507 Bacteria 1242
305 nmdc:mga05p37_73398_c1 3300050507 Bacteria 4211
306 nmdc:mga05p37_95407_c1 3300050507 Bacteria 3664
307 nmdc:mga05p37_99995_c1 3300050507 Bacteria 3572
308 nmdc:mga09592_171376_c1 3300050508 Bacteria 1877
309 nmdc:mga09592_241992_c1 3300050508 Bacteria 1563
310 nmdc:mga09592_3302_c1 3300050508 Bacteria 13063
311 nmdc:mga09592_49109_c1 3300050508 Bacteria 3558
312 nmdc:mga09592_671050_c1 3300050508 Bacteria 884
313 nmdc:mga0qj67_24909_c1 3300050509 Bacteria 4618
314 nmdc:mga0qj67_29653_c1 3300050509 Bacteria 4251
315 nmdc:mga06r32_114663_c1 3300050510 Bacteria 2653
316 nmdc:mga06r32_119334_c1 3300050510 Bacteria 2600
317 nmdc:mga06r32_18778_c1 3300050510 Bacteria 6336
318 nmdc:mga06r32_214773_c1 3300050510 Bacteria 1911
319 nmdc:mga06r32_229819_c1 3300050510 Bacteria 1843
320 nmdc:mga06r32_450509_c1 3300050510 Bacteria 1267
321 nmdc:mga08y16_111360_c1 3300050511 Bacteria 2850
322 nmdc:mga08y16_129506_c1 3300050511 Bacteria 2625
323 nmdc:mga08y16_175_c1 3300050511 Bacteria 56460
324 nmdc:mga08y16_3389_c1 3300050511 Bacteria 16523
325 nmdc:mga08y16_365238_c1 3300050511 Bacteria 1481
326 nmdc:mga08y16_7035_c1 3300050511 Bacteria 11807
327 nmdc:mga0n895_11171_c1 3300050512 Bacteria 7994
328 nmdc:mga0n895_228316_c1 3300050512 Bacteria 1890
329 nmdc:mga0n895_3884_c1 3300050512 Bacteria 12140
330 nmdc:mga0rr50_151762_c1 3300050513 Bacteria 1873
331 nmdc:mga0rr50_63248_c1 3300050513 Bacteria 2794
332 nmdc:mga0rr50_7832_c1 3300050513 Bacteria 6622
333 nmdc:mga0rr50_90430_c1 3300050513 Bacteria 2382
334 nmdc:mga08x19_140415_c1 3300050514 Bacteria 1631
335 nmdc:mga08x19_78072_c1 3300050514 Bacteria 2169
336 nmdc:mga0a205_23690_c3 3300050515 Bacteria 4198
337 nmdc:mga0a205_255549_c1 3300050515 Bacteria 1631
338 nmdc:mga0a205_28899_c1 3300050515 Bacteria 5302
339 nmdc:mga0a205_36035_c1 3300050515 Bacteria 4753
340 nmdc:mga0a205_405_c1 3300050515 Bacteria 33012
341 nmdc:mga0a205_84890_c2 3300050515 Bacteria 2514
342 nmdc:mga0a205_91101_c1 3300050515 Bacteria 2946
343 Ga0495601_0445315 3300053077 Bacteria 838
344 Ga0495619_0180912 3300053085 Bacteria 1459
345 Ga0500583_0091109 3300053092 Bacteria 1484
346 Ga0500566_0051093 3300053094 Bacteria 2365
347 Ga0500554_000029 3300053102 Bacteria 24088
348 Ga0500594_0131835 3300053118 Bacteria 792
349 Ga0500595_001201 3300053119 Bacteria 14317
350 Ga0500614_000061 3300053123 Bacteria 23293
351 Ga0500559_0000958 3300053136 Bacteria 18080
352 Ga0500564_004545 3300053138 Bacteria 5571
353 Ga0500603_003326 3300053150 Bacteria 3457
354 Ga0590074_014733 3300059423 Bacteria 1324
355 Ga0501082_0027714 3300060353 Bacteria 4877
356 Ga0501082_0318016 3300060353 Bacteria 1356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_241992_c1 nmdc:mga09592_241992_c1_120_728 187
2 3300050510 nmdc:mga06r32_229819_c1 nmdc:mga06r32_229819_c1_451_1059 187
3 3300005445 Ga0070708_100937046 Ga0070708_1009370461 188
4 3300006195 Ga0075366_10005986 Ga0075366_100059866 188
5 3300009094 Ga0111539_10155488 Ga0111539_101554881 194
6 3300050511 nmdc:mga08y16_129506_c1 nmdc:mga08y16_129506_c1_1937_2581 194
7 3300060353 Ga0501082_0318016 Ga0501082_0318016_39_692 196
8 3300005445 Ga0070708_100789723 Ga0070708_1007897231 199
9 3300025941 Ga0207711_10634363 Ga0207711_106343631 199
10 3300050514 nmdc:mga08x19_140415_c1 nmdc:mga08x19_140415_c1_301_954 199
11 3300005354 Ga0070675_100177128 Ga0070675_1001771282 201
12 3300005356 Ga0070674_100240812 Ga0070674_1002408122 201
13 3300005364 Ga0070673_100156194 Ga0070673_1001561942 201
14 3300005456 Ga0070678_100121914 Ga0070678_1001219142 201
15 3300005459 Ga0068867_100209474 Ga0068867_1002094742 201
16 3300006844 Ga0075428_100016908 Ga0075428_1000169084 201
17 3300006846 Ga0075430_100015008 Ga0075430_1000150082 201
18 3300006847 Ga0075431_100111409 Ga0075431_1001114092 201
19 3300009147 Ga0114129_10010293 Ga0114129_100102939 201
20 3300009147 Ga0114129_10086403 Ga0114129_100864033 201
21 3300009148 Ga0105243_10780517 Ga0105243_107805172 201
22 3300025926 Ga0207659_10490628 Ga0207659_104906282 201
23 3300025937 Ga0207669_10314724 Ga0207669_103147242 201
24 3300026121 Ga0207683_10087474 Ga0207683_100874744 201
25 3300031344 Ga0265316_10119827 Ga0265316_101198272 201
26 3300031507 Ga0307509_10119621 Ga0307509_101196212 201
27 3300035691 Ga0373931_0126321 Ga0373931_0126321_26_667 201
28 3300046664 Ga0495659_0101117 Ga0495659_0101117_417_1055 201
29 3300047318 Ga0495636_0154440 Ga0495636_0154440_94_732 201
30 3300050507 nmdc:mga05p37_111526_c1 nmdc:mga05p37_111526_c1_1211_1849 201
31 3300050511 nmdc:mga08y16_111360_c1 nmdc:mga08y16_111360_c1_1108_1746 201
32 3300050512 nmdc:mga0n895_11171_c1 nmdc:mga0n895_11171_c1_4980_5618 201
33 3300050513 nmdc:mga0rr50_151762_c1 nmdc:mga0rr50_151762_c1_209_841 201
34 3300050514 nmdc:mga08x19_78072_c1 nmdc:mga08x19_78072_c1_545_1183 201
35 3300050515 nmdc:mga0a205_36035_c1 nmdc:mga0a205_36035_c1_3679_4317 201
36 3300050515 nmdc:mga0a205_91101_c1 nmdc:mga0a205_91101_c1_138_776 201
37 3300045836 Ga0466958_0585215 Ga0466958_0585215_51_707 202
38 3300014326 Ga0157380_10010864 Ga0157380_100108646 203
39 3300005335 Ga0070666_10131101 Ga0070666_101311012 206
40 3300005338 Ga0068868_100255725 Ga0068868_1002557252 206
41 3300005340 Ga0070689_100098966 Ga0070689_1000989662 206
42 3300005356 Ga0070674_100300814 Ga0070674_1003008142 206
43 3300005364 Ga0070673_100379818 Ga0070673_1003798181 206
44 3300005456 Ga0070678_100076303 Ga0070678_1000763033 206
45 3300005466 Ga0070685_10137960 Ga0070685_101379602 206
46 3300005615 Ga0070702_100720009 Ga0070702_1007200091 206
47 3300005718 Ga0068866_10033517 Ga0068866_100335172 206
48 3300005842 Ga0068858_100693233 Ga0068858_1006932331 206
49 3300006237 Ga0097621_100058268 Ga0097621_1000582682 206
50 3300006358 Ga0068871_100001175 Ga0068871_1000011751 206
51 3300006881 Ga0068865_100119157 Ga0068865_1001191573 206
52 3300009098 Ga0105245_10005347 Ga0105245_1000534712 206
53 3300009176 Ga0105242_10025015 Ga0105242_100250152 206
54 3300013308 Ga0157375_10223742 Ga0157375_102237422 206
55 3300014969 Ga0157376_10001277 Ga0157376_100012773 206
56 3300017792 Ga0163161_10411168 Ga0163161_104111681 206
57 3300025903 Ga0207680_10354339 Ga0207680_103543392 206
58 3300025937 Ga0207669_10041261 Ga0207669_100412612 206
59 3300025938 Ga0207704_10049903 Ga0207704_100499032 206
60 3300025940 Ga0207691_10223931 Ga0207691_102239312 206
61 3300025941 Ga0207711_10054282 Ga0207711_100542823 206
62 3300026035 Ga0207703_10320580 Ga0207703_103205802 206
63 3300026089 Ga0207648_10052486 Ga0207648_100524863 206
64 3300026121 Ga0207683_10083595 Ga0207683_100835953 206
65 3300028379 Ga0268266_10056576 Ga0268266_100565762 206
66 3300036712 Ga0316584_0526479 Ga0316584_0526479_64_705 206
67 3300048908 Ga0496105_0057714 Ga0496105_0057714_533_1177 206
68 3300049570 Ga0501033_0307086 Ga0501033_0307086_66_701 206
69 3300049581 Ga0501047_0101796 Ga0501047_0101796_111_746 206
70 3300049582 Ga0501048_0133269 Ga0501048_0133269_851_1486 206
71 3300049823 Ga0501044_0001746 Ga0501044_0001746_76_711 206
72 3300053077 Ga0495601_0445315 Ga0495601_0445315_28_672 206
73 3300053085 Ga0495619_0180912 Ga0495619_0180912_592_1236 206
74 iso_pu_bacteria 2508501114 2509075683 206
75 iso_pu_bacteria 2738541276 2738715367 206
76 iso_pu_bacteria 2835312727 2835315275 206
77 iso_pu_bacteria 2842698319 2842702101 206
78 iso_pu_bacteria 2861691609 2861693810 206
79 3300005459 Ga0068867_100391979 Ga0068867_1003919792 207
80 3300005577 Ga0068857_100512440 Ga0068857_1005124401 207
81 3300005844 Ga0068862_100763242 Ga0068862_1007632422 207
82 3300009147 Ga0114129_10027523 Ga0114129_100275238 207
83 3300009147 Ga0114129_10646604 Ga0114129_106466041 207
84 3300026067 Ga0207678_10027730 Ga0207678_100277302 207
85 3300026089 Ga0207648_10159230 Ga0207648_101592304 207
86 3300031548 Ga0307408_100064676 Ga0307408_1000646763 207
87 3300031824 Ga0307413_10205848 Ga0307413_102058481 207
88 3300031903 Ga0307407_10833191 Ga0307407_108331911 207
89 3300032005 Ga0307411_11266089 Ga0307411_112660891 207
90 3300050507 nmdc:mga05p37_2483_c1 nmdc:mga05p37_2483_c1_20722_21363 207
91 3300050507 nmdc:mga05p37_569054_c1 nmdc:mga05p37_569054_c1_98_736 207
92 3300050509 nmdc:mga0qj67_24909_c1 nmdc:mga0qj67_24909_c1_3703_4344 207
93 3300050510 nmdc:mga06r32_450509_c1 nmdc:mga06r32_450509_c1_361_1002 207
94 3300050515 nmdc:mga0a205_255549_c1 nmdc:mga0a205_255549_c1_322_960 207
95 iso_pu_bacteria 2848694841 2848695741 207
96 iso_pu_bacteria 2849660919 2849662609 207
97 3300005347 Ga0070668_100226252 Ga0070668_1002262522 208
98 3300025949 Ga0207667_10170253 Ga0207667_101702532 208
99 3300031903 Ga0307407_10555820 Ga0307407_105558201 208
100 3300032002 Ga0307416_100186163 Ga0307416_1001861632 208
101 3300042015 Ga0439462_0072418 Ga0439462_0072418_264_914 208
102 3300050507 nmdc:mga05p37_73398_c1 nmdc:mga05p37_73398_c1_1016_1663 208
103 iso_pu_bacteria 2522572158 2523104093 208
104 3300005334 Ga0068869_100257820 Ga0068869_1002578202 209
105 3300005336 Ga0070680_100358161 Ga0070680_1003581613 209
106 3300005353 Ga0070669_100170591 Ga0070669_1001705912 209
107 3300005356 Ga0070674_100004580 Ga0070674_1000045807 209
108 3300005364 Ga0070673_100183752 Ga0070673_1001837521 209
109 3300005440 Ga0070705_100019878 Ga0070705_1000198783 209
110 3300005459 Ga0068867_100302528 Ga0068867_1003025281 209
111 3300005467 Ga0070706_100242796 Ga0070706_1002427962 209
112 3300005467 Ga0070706_100252886 Ga0070706_1002528862 209
113 3300005518 Ga0070699_100556790 Ga0070699_1005567902 209
114 3300005545 Ga0070695_100210433 Ga0070695_1002104332 209
115 3300005546 Ga0070696_100029293 Ga0070696_1000292933 209
116 3300005616 Ga0068852_100574957 Ga0068852_1005749571 209
117 3300005719 Ga0068861_100018420 Ga0068861_1000184205 209
118 3300005841 Ga0068863_100911404 Ga0068863_1009114042 209
119 3300005842 Ga0068858_100269568 Ga0068858_1002695682 209
120 3300005843 Ga0068860_100265809 Ga0068860_1002658091 209
121 3300005843 Ga0068860_100307852 Ga0068860_1003078522 209
122 3300005844 Ga0068862_100142682 Ga0068862_1001426823 209
123 3300005983 Ga0081540_1054382 Ga0081540_10543822 209
124 3300005985 Ga0081539_10088734 Ga0081539_100887341 209
125 3300006195 Ga0075366_10050278 Ga0075366_100502782 209
126 3300006237 Ga0097621_100143975 Ga0097621_1001439751 209
127 3300006844 Ga0075428_100905622 Ga0075428_1009056221 209
128 3300006846 Ga0075430_100109810 Ga0075430_1001098102 209
129 3300006847 Ga0075431_100050896 Ga0075431_1000508963 209
130 3300006847 Ga0075431_100129992 Ga0075431_1001299922 209
131 3300006847 Ga0075431_100538266 Ga0075431_1005382662 209
132 3300006852 Ga0075433_10000200 Ga0075433_1000020019 209
133 3300006852 Ga0075433_10069859 Ga0075433_100698593 209
134 3300006852 Ga0075433_10249304 Ga0075433_102493042 209
135 3300006871 Ga0075434_100001883 Ga0075434_10000188316 209
136 3300006871 Ga0075434_100083388 Ga0075434_1000833882 209
137 3300006871 Ga0075434_100136140 Ga0075434_1001361403 209
138 3300006871 Ga0075434_100159880 Ga0075434_1001598803 209
139 3300006880 Ga0075429_100003065 Ga0075429_1000030652 209
140 3300006880 Ga0075429_100013818 Ga0075429_1000138186 209
141 3300006914 Ga0075436_100176800 Ga0075436_1001768003 209
142 3300007076 Ga0075435_100002166 Ga0075435_1000021663 209
143 3300007076 Ga0075435_100010977 Ga0075435_1000109774 209
144 3300007076 Ga0075435_100032232 Ga0075435_1000322325 209
145 3300007076 Ga0075435_100423484 Ga0075435_1004234842 209
146 3300007265 Ga0099794_10058261 Ga0099794_100582611 209
147 3300009094 Ga0111539_10003270 Ga0111539_100032707 209
148 3300009094 Ga0111539_10015277 Ga0111539_100152772 209
149 3300009094 Ga0111539_10579068 Ga0111539_105790681 209
150 3300009098 Ga0105245_10097935 Ga0105245_100979352 209
151 3300009147 Ga0114129_10076272 Ga0114129_100762725 209
152 3300009147 Ga0114129_10104949 Ga0114129_101049492 209
153 3300009147 Ga0114129_10113375 Ga0114129_101133752 209
154 3300009148 Ga0105243_10163730 Ga0105243_101637302 209
155 3300009177 Ga0105248_10098177 Ga0105248_100981772 209
156 3300009553 Ga0105249_10063958 Ga0105249_100639582 209
157 3300014326 Ga0157380_10074473 Ga0157380_100744733 209
158 3300014969 Ga0157376_10058442 Ga0157376_100584422 209
159 3300015265 Ga0182005_1006638 Ga0182005_10066386 209
160 3300020069 Ga0197907_10140303 Ga0197907_101403033 209
161 3300020070 Ga0206356_11334441 Ga0206356_113344411 209
162 3300020075 Ga0206349_1342846 Ga0206349_13428462 209
163 3300020078 Ga0206352_10728663 Ga0206352_107286632 209
164 3300020081 Ga0206354_10860443 Ga0206354_108604432 209
165 3300020082 Ga0206353_10934618 Ga0206353_109346183 209
166 3300022467 Ga0224712_10075237 Ga0224712_100752372 209
167 3300025910 Ga0207684_10042229 Ga0207684_100422293 209
168 3300025910 Ga0207684_10273964 Ga0207684_102739642 209
169 3300025910 Ga0207684_10532232 Ga0207684_105322321 209
170 3300025917 Ga0207660_10317447 Ga0207660_103174473 209
171 3300025923 Ga0207681_10110755 Ga0207681_101107552 209
172 3300025926 Ga0207659_10163609 Ga0207659_101636092 209
173 3300025935 Ga0207709_10264173 Ga0207709_102641732 209
174 3300025937 Ga0207669_10490180 Ga0207669_104901801 209
175 3300025938 Ga0207704_10411781 Ga0207704_104117812 209
176 3300025960 Ga0207651_10263297 Ga0207651_102632972 209
177 3300025961 Ga0207712_10085432 Ga0207712_100854322 209
178 3300025972 Ga0207668_10223162 Ga0207668_102231621 209
179 3300026035 Ga0207703_10384144 Ga0207703_103841442 209
180 3300026075 Ga0207708_10512730 Ga0207708_105127301 209
181 3300026088 Ga0207641_10456063 Ga0207641_104560632 209
182 3300026089 Ga0207648_10248958 Ga0207648_102489582 209
183 3300026118 Ga0207675_100029594 Ga0207675_1000295945 209
184 3300027907 Ga0207428_10000013 Ga0207428_10000013148 209
185 3300027907 Ga0207428_10000235 Ga0207428_1000023545 209
186 3300027907 Ga0207428_10045457 Ga0207428_100454572 209
187 3300027907 Ga0207428_10089117 Ga0207428_100891174 209
188 3300028380 Ga0268265_10038897 Ga0268265_100388972 209
189 3300028381 Ga0268264_10209895 Ga0268264_102098952 209
190 3300028381 Ga0268264_10384874 Ga0268264_103848741 209
191 3300031251 Ga0265327_10018537 Ga0265327_100185375 209
192 3300031548 Ga0307408_100074357 Ga0307408_1000743572 209
193 3300031548 Ga0307408_100457801 Ga0307408_1004578012 209
194 3300031665 Ga0316575_10023015 Ga0316575_100230151 209
195 3300031665 Ga0316575_10123633 Ga0316575_101236331 209
196 3300031691 Ga0316579_10120176 Ga0316579_101201761 209
197 3300031691 Ga0316579_10160277 Ga0316579_101602771 209
198 3300031727 Ga0316576_10085846 Ga0316576_100858462 209
199 3300031727 Ga0316576_10183122 Ga0316576_101831222 209
200 3300031728 Ga0316578_10074882 Ga0316578_100748823 209
201 3300031730 Ga0307516_10006556 Ga0307516_1000655611 209
202 3300031733 Ga0316577_10011543 Ga0316577_100115435 209
203 3300031824 Ga0307413_10183322 Ga0307413_101833222 209
204 3300031901 Ga0307406_10045792 Ga0307406_100457922 209
205 3300031903 Ga0307407_10459798 Ga0307407_104597982 209
206 3300031995 Ga0307409_100251308 Ga0307409_1002513082 209
207 3300032005 Ga0307411_10157853 Ga0307411_101578533 209
208 3300032126 Ga0307415_100020936 Ga0307415_1000209366 209
209 3300032168 Ga0316593_10005378 Ga0316593_100053784 209
210 3300034817 Ga0373948_0001784 Ga0373948_0001784_371_1039 209
211 3300034820 Ga0373959_0007139 Ga0373959_0007139_288_938 209
212 3300034957 Ga0373938_0011690 Ga0373938_0011690_176_826 209
213 3300035085 Ga0373929_0038482 Ga0373929_0038482_267_917 209
214 3300035088 Ga0373940_0002476 Ga0373940_0002476_644_1294 209
215 3300035090 Ga0373949_0001151 Ga0373949_0001151_4223_4873 209
216 3300035090 Ga0373949_0018922 Ga0373949_0018922_70_738 209
217 3300035091 Ga0373951_0002436 Ga0373951_0002436_1627_2277 209
218 3300035092 Ga0373952_0000604 Ga0373952_0000604_2539_3189 209
219 3300035112 Ga0373932_0006068 Ga0373932_0006068_1771_2421 209
220 3300035114 Ga0373939_0002930 Ga0373939_0002930_1130_1780 209
221 3300035114 Ga0373939_0019250 Ga0373939_0019250_531_1184 209
222 3300035115 Ga0373941_0028345 Ga0373941_0028345_972_1622 209
223 3300035115 Ga0373941_0121320 Ga0373941_0121320_141_809 209
224 3300035121 Ga0373960_0002612 Ga0373960_0002612_2497_3147 209
225 3300035207 Ga0373942_0002035 Ga0373942_0002035_1194_1844 209
226 3300035241 Ga0373961_0002166 Ga0373961_0002166_1814_2464 209
227 3300035242 Ga0373962_0004725 Ga0373962_0004725_2484_3134 209
228 3300035398 Ga0316574_0023268 Ga0316574_0023268_2580_3215 209
229 3300035691 Ga0373931_0022318 Ga0373931_0022318_1605_2255 209
230 3300036647 Ga0316582_0014150 Ga0316582_0014150_338_973 209
231 3300036712 Ga0316584_0007104 Ga0316584_0007104_4312_4968 209
232 3300037588 Ga0316581_0000467 Ga0316581_0000467_6660_7295 209
233 3300038726 Ga0400490_15945 Ga0400490_15945_1419_2054 209
234 3300038727 Ga0400491_11277 Ga0400491_11277_1302_1937 209
235 3300038741 Ga0400488_01816 Ga0400488_01816_325_960 209
236 3300038741 Ga0400488_18280 Ga0400488_18280_465_1100 209
237 3300038741 Ga0400488_41388 Ga0400488_41388_11696_12331 209
238 3300039062 Ga0400483_100798 Ga0400483_100798_3963_4598 209
239 3300039062 Ga0400483_144406 Ga0400483_144406_2037_2672 209
240 3300039062 Ga0400483_210902 Ga0400483_210902_5767_6402 209
241 3300039062 Ga0400483_245064 Ga0400483_245064_445_1080 209
242 3300039062 Ga0400483_250616 Ga0400483_250616_24815_25465 209
243 3300039110 Ga0400487_25585 Ga0400487_25585_24122_24757 209
244 3300042001 Ga0439441_037970 Ga0439441_037970_188_844 209
245 3300042876 Ga0451577_0078157 Ga0451577_0078157_1843_2496 209
246 3300042876 Ga0451577_0190344 Ga0451577_0190344_360_1028 209
247 3300044712 Ga0453684_0205023 Ga0453684_0205023_1012_1641 209
248 3300045051 Ga0451576_0066766 Ga0451576_0066766_2090_2740 209
249 3300045051 Ga0451576_0072556 Ga0451576_0072556_1426_2094 209
250 3300046533 Ga0495640_0134453 Ga0495640_0134453_332_982 209
251 3300046664 Ga0495659_0009709 Ga0495659_0009709_2246_2914 209
252 3300047318 Ga0495636_0179223 Ga0495636_0179223_233_901 209
253 3300048918 Ga0496115_0520107 Ga0496115_0520107_120_782 209
254 3300049585 Ga0501069_0108549 Ga0501069_0108549_364_1008 209
255 3300049591 Ga0501075_0746662 Ga0501075_0746662_81_734 209
256 3300049744 Ga0501083_0072877 Ga0501083_0072877_402_1049 209
257 3300049774 Ga0501278_009967 Ga0501278_009967_49_708 209
258 3300050507 nmdc:mga05p37_600642_c1 nmdc:mga05p37_600642_c1_504_1172 209
259 3300050507 nmdc:mga05p37_95407_c1 nmdc:mga05p37_95407_c1_1580_2236 209
260 3300050507 nmdc:mga05p37_99995_c1 nmdc:mga05p37_99995_c1_1841_2509 209
261 3300050508 nmdc:mga09592_171376_c1 nmdc:mga09592_171376_c1_684_1349 209
262 3300050508 nmdc:mga09592_49109_c1 nmdc:mga09592_49109_c1_1955_2623 209
263 3300050508 nmdc:mga09592_671050_c1 nmdc:mga09592_671050_c1_159_815 209
264 3300050509 nmdc:mga0qj67_29653_c1 nmdc:mga0qj67_29653_c1_1064_1732 209
265 3300050510 nmdc:mga06r32_119334_c1 nmdc:mga06r32_119334_c1_750_1415 209
266 3300050510 nmdc:mga06r32_18778_c1 nmdc:mga06r32_18778_c1_3277_3945 209
267 3300050510 nmdc:mga06r32_214773_c1 nmdc:mga06r32_214773_c1_879_1547 209
268 3300050511 nmdc:mga08y16_175_c1 nmdc:mga08y16_175_c1_33825_34481 209
269 3300050511 nmdc:mga08y16_3389_c1 nmdc:mga08y16_3389_c1_9248_9898 209
270 3300050511 nmdc:mga08y16_365238_c1 nmdc:mga08y16_365238_c1_346_996 209
271 3300050511 nmdc:mga08y16_7035_c1 nmdc:mga08y16_7035_c1_4232_4900 209
272 3300050513 nmdc:mga0rr50_63248_c1 nmdc:mga0rr50_63248_c1_1407_2075 209
273 3300050515 nmdc:mga0a205_23690_c3 nmdc:mga0a205_23690_c3_3511_4179 209
274 3300050515 nmdc:mga0a205_84890_c2 nmdc:mga0a205_84890_c2_331_981 209
275 3300059423 Ga0590074_014733 Ga0590074_014733_174_827 209
276 iso_pu_bacteria 2939669807 2939674397 209
277 3300003323 rootH1_10007832 rootH1_100078328 210
278 3300005327 Ga0070658_10109897 Ga0070658_101098973 210
279 3300005365 Ga0070688_100000946 Ga0070688_1000009466 210
280 3300005459 Ga0068867_100009826 Ga0068867_1000098267 210
281 3300005466 Ga0070685_10000017 Ga0070685_1000001735 210
282 3300005549 Ga0070704_100531493 Ga0070704_1005314931 210
283 3300005617 Ga0068859_101116273 Ga0068859_1011162732 210
284 3300005841 Ga0068863_100049854 Ga0068863_1000498541 210
285 3300005843 Ga0068860_100000909 Ga0068860_10000090931 210
286 3300006237 Ga0097621_100015129 Ga0097621_1000151292 210
287 3300006358 Ga0068871_100003395 Ga0068871_1000033954 210
288 3300006881 Ga0068865_100119580 Ga0068865_1001195803 210
289 3300006931 Ga0097620_101116287 Ga0097620_1011162872 210
290 3300009093 Ga0105240_10981633 Ga0105240_109816331 210
291 3300009098 Ga0105245_10410050 Ga0105245_104100502 210
292 3300009147 Ga0114129_10002614 Ga0114129_1000261414 210
293 3300009148 Ga0105243_10343078 Ga0105243_103430781 210
294 3300009176 Ga0105242_10008125 Ga0105242_100081254 210
295 3300014326 Ga0157380_10485508 Ga0157380_104855082 210
296 3300014968 Ga0157379_10155704 Ga0157379_101557042 210
297 3300014969 Ga0157376_10025356 Ga0157376_100253564 210
298 3300025900 Ga0207710_10015781 Ga0207710_100157813 210
299 3300025909 Ga0207705_10072319 Ga0207705_100723193 210
300 3300025926 Ga0207659_10258495 Ga0207659_102584952 210
301 3300025935 Ga0207709_10176941 Ga0207709_101769412 210
302 3300026088 Ga0207641_10030761 Ga0207641_100307611 210
303 3300026088 Ga0207641_10092823 Ga0207641_100928232 210
304 3300028379 Ga0268266_10245425 Ga0268266_102454252 210
305 3300028380 Ga0268265_10142289 Ga0268265_101422892 210
306 3300028381 Ga0268264_10000004 Ga0268264_10000004185 210
307 3300031548 Ga0307408_100004156 Ga0307408_1000041567 210
308 3300031616 Ga0307508_10001844 Ga0307508_1000184423 210
309 3300033179 Ga0307507_10171105 Ga0307507_101711052 210
310 3300035170 Ga0373943_0475467 Ga0373943_0475467_60_716 210
311 3300035241 Ga0373961_0000018 Ga0373961_0000018_29567_30250 210
312 3300036401 Ga0373937_0541349 Ga0373937_0541349_45_701 210
313 3300037853 Ga0436364_0789343 Ga0436364_0789343_576_1283 210
314 3300039450 Ga0436363_0276649 Ga0436363_0276649_323_1030 210
315 3300044712 Ga0453684_0008778 Ga0453684_0008778_15548_16201 210
316 3300045051 Ga0451576_0017071 Ga0451576_0017071_3512_4171 210
317 3300046459 Ga0495629_0031313 Ga0495629_0031313_2831_3487 210
318 3300046472 Ga0495580_0003424 Ga0495580_0003424_11576_12241 210
319 3300046511 Ga0495608_0535016 Ga0495608_0535016_38_694 210
320 3300046517 Ga0495630_0392600 Ga0495630_0392600_28_681 210
321 3300046528 Ga0495642_0045711 Ga0495642_0045711_748_1413 210
322 3300046663 Ga0495635_0142689 Ga0495635_0142689_922_1575 210
323 3300046683 Ga0495658_0056892 Ga0495658_0056892_1377_2033 210
324 3300046683 Ga0495658_0080369 Ga0495658_0080369_1175_1828 210
325 3300046689 Ga0495613_0416320 Ga0495613_0416320_128_784 210
326 3300047319 Ga0495674_0192238 Ga0495674_0192238_474_1127 210
327 3300049568 Ga0501031_0119249 Ga0501031_0119249_55_723 210
328 3300049569 Ga0501032_0102665 Ga0501032_0102665_775_1443 210
329 3300049571 Ga0501034_0002434 Ga0501034_0002434_7293_7934 210
330 3300049572 Ga0501036_0130687 Ga0501036_0130687_695_1363 210
331 3300049572 Ga0501036_0614288 Ga0501036_0614288_138_779 210
332 3300049573 Ga0501037_0009708 Ga0501037_0009708_4721_5362 210
333 3300049573 Ga0501037_0217261 Ga0501037_0217261_389_1057 210
334 3300049574 Ga0501038_0016356 Ga0501038_0016356_1320_1961 210
335 3300049574 Ga0501038_0048775 Ga0501038_0048775_1972_2640 210
336 3300049579 Ga0501043_0002326 Ga0501043_0002326_6238_6879 210
337 3300049581 Ga0501047_0050924 Ga0501047_0050924_2737_3378 210
338 3300049583 Ga0501067_0159543 Ga0501067_0159543_130_798 210
339 3300049586 Ga0501070_0066046 Ga0501070_0066046_1333_2001 210
340 3300049586 Ga0501070_0168111 Ga0501070_0168111_192_854 210
341 3300049589 Ga0501073_0001711 Ga0501073_0001711_11861_12502 210
342 3300049589 Ga0501073_0027512 Ga0501073_0027512_2389_3057 210
343 3300049742 Ga0501080_0001724 Ga0501080_0001724_11010_11651 210
344 3300049742 Ga0501080_0224871 Ga0501080_0224871_291_959 210
345 3300049823 Ga0501044_0001009 Ga0501044_0001009_30572_31213 210
346 3300049823 Ga0501044_0363695 Ga0501044_0363695_17_685 210
347 3300050507 nmdc:mga05p37_12530_c1 nmdc:mga05p37_12530_c1_110_847 210
348 3300050508 nmdc:mga09592_3302_c1 nmdc:mga09592_3302_c1_2305_3042 210
349 3300050510 nmdc:mga06r32_114663_c1 nmdc:mga06r32_114663_c1_978_1715 210
350 3300050512 nmdc:mga0n895_228316_c1 nmdc:mga0n895_228316_c1_759_1418 210
351 3300050512 nmdc:mga0n895_3884_c1 nmdc:mga0n895_3884_c1_11294_12031 210
352 3300050513 nmdc:mga0rr50_7832_c1 nmdc:mga0rr50_7832_c1_2752_3489 210
353 3300050513 nmdc:mga0rr50_90430_c1 nmdc:mga0rr50_90430_c1_232_891 210
354 3300050515 nmdc:mga0a205_28899_c1 nmdc:mga0a205_28899_c1_1854_2513 210
355 3300050515 nmdc:mga0a205_405_c1 nmdc:mga0a205_405_c1_11063_11800 210
356 3300053092 Ga0500583_0091109 Ga0500583_0091109_706_1386 210
357 3300053094 Ga0500566_0051093 Ga0500566_0051093_1305_1976 210
358 3300053102 Ga0500554_000029 Ga0500554_000029_18642_19313 210
359 3300053118 Ga0500594_0131835 Ga0500594_0131835_44_724 210
360 3300053119 Ga0500595_001201 Ga0500595_001201_12631_13302 210
361 3300053123 Ga0500614_000061 Ga0500614_000061_15513_16184 210
362 3300053136 Ga0500559_0000958 Ga0500559_0000958_1562_2233 210
363 3300053138 Ga0500564_004545 Ga0500564_004545_2696_3337 210
364 3300053150 Ga0500603_003326 Ga0500603_003326_1995_2675 210
365 3300060353 Ga0501082_0027714 Ga0501082_0027714_120_761 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

70

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9832 9 198
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9824 12 210
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9781 9 198
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9763 10 208
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9726 11 193
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.986 46 194 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9724 44 197 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9713 10 196 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9661 46 194 3.30.1060.10
3e0mA01 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9528 46 203 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9948 36 184 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A2D5CGW7-F1-model_v4 deleted 0.9936 7 198
AF-A0A3C1GHX2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9932 8 139 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-H1G068-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9931 7 210 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-E1VQ90-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9924 10 210 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456

Feature Viewer

pLDDT pTM Quality
92.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map