F422708

General Info

Members Datasets Scaffolds Average Seq Length
362 218 724 154

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0054071|Ga0466967_0054071_1910_2443
Length 177
Sequence VVGGPAGRPTFRRGEAVSAPGGRHPVAVGDVAPDFTLRDQNNEAVTLSSFRGAKVVLIVFYPLAFTGICTGELCAVRDDLAAFQNDEVQVLTISVDSAYSHKIFSEREGYKFPLLSDFWPHGAVAQAYGVFNEKTGFSNRGTFLVDKDGVVRFAEMNSPGEGRDPQVWRDAIAALVG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
217 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
218 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 3.59
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 7.73
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0054071 3300045976 Bacteria 3532
2 JGI24735J21928_10001535 3300002067 Bacteria 8184
3 Ga0058863_10067698 3300004799 Bacteria 1254
4 Ga0058861_12040849 3300004800 Bacteria 1123
5 Ga0058862_12686184 3300004803 Bacteria 1355
6 Ga0070658_10001274 3300005327 Bacteria 21563
7 Ga0070683_100133667 3300005329 Bacteria 2348
8 Ga0070683_100225274 3300005329 Bacteria 1782
9 Ga0070690_100160517 3300005330 Bacteria 1540
10 Ga0070670_100555927 3300005331 Bacteria 1024
11 Ga0070670_100706649 3300005331 Bacteria 907
12 Ga0070666_10032517 3300005335 Bacteria 3446
13 Ga0070666_10383411 3300005335 Bacteria 1009
14 Ga0070680_100018053 3300005336 Bacteria 5572
15 Ga0070682_100227395 3300005337 Bacteria 1332
16 Ga0070660_100017114 3300005339 Bacteria 5278
17 Ga0070660_100791826 3300005339 Bacteria 797
18 Ga0070689_100070587 3300005340 Bacteria 2728
19 Ga0070687_100087083 3300005343 Bacteria 1718
20 Ga0070661_100306401 3300005344 Bacteria 1237
21 Ga0070692_10084328 3300005345 Bacteria 1717
22 Ga0070668_100055848 3300005347 Bacteria 3048
23 Ga0070668_100101152 3300005347 Bacteria 2284
24 Ga0070668_100413474 3300005347 Bacteria 1154
25 Ga0070669_100534868 3300005353 Bacteria 976
26 Ga0070671_100125915 3300005355 Bacteria 2157
27 Ga0070673_100022590 3300005364 Bacteria 4582
28 Ga0070659_100012844 3300005366 Bacteria 6222
29 Ga0070659_100112498 3300005366 Bacteria 2198
30 Ga0070659_100209896 3300005366 Bacteria 1605
31 Ga0070667_100005372 3300005367 Bacteria 10699
32 Ga0070667_100086197 3300005367 Bacteria 2694
33 Ga0070667_100639744 3300005367 Bacteria 982
34 Ga0070709_10096290 3300005434 Bacteria 1962
35 Ga0070714_100298660 3300005435 Bacteria 1501
36 Ga0070714_100440222 3300005435 Bacteria 1237
37 Ga0070714_100782851 3300005435 Bacteria 923
38 Ga0070714_101414740 3300005435 Bacteria 679
39 Ga0070713_100177591 3300005436 Bacteria 1912
40 Ga0070713_100275564 3300005436 Bacteria 1542
41 Ga0070713_100654570 3300005436 Bacteria 1001
42 Ga0070710_10004373 3300005437 Bacteria 6692
43 Ga0070705_100300198 3300005440 Bacteria 1150
44 Ga0070708_100196541 3300005445 Bacteria 1887
45 Ga0070663_100092486 3300005455 Bacteria 2243
46 Ga0070663_100497287 3300005455 Bacteria 1012
47 Ga0070678_100040451 3300005456 Bacteria 3299
48 Ga0070681_10175229 3300005458 Bacteria 2066
49 Ga0070685_10366530 3300005466 Bacteria 989
50 Ga0070698_100502986 3300005471 Bacteria 1150
51 Ga0070679_100644133 3300005530 Bacteria 1002
52 Ga0070665_100948246 3300005548 Bacteria 873
53 Ga0070665_100949884 3300005548 Bacteria 872
54 Ga0070704_100023091 3300005549 Bacteria 4055
55 Ga0068855_100031067 3300005563 Bacteria 6381
56 Ga0068855_100451185 3300005563 Bacteria 1403
57 Ga0070664_100660201 3300005564 Bacteria 972
58 Ga0068857_100230891 3300005577 Bacteria 1692
59 Ga0068854_100209305 3300005578 Bacteria 1537
60 Ga0070702_100016903 3300005615 Bacteria 3754
61 Ga0068852_100028112 3300005616 Bacteria 4597
62 Ga0068852_100138804 3300005616 Bacteria 2247
63 Ga0068852_100427175 3300005616 Bacteria 1308
64 Ga0068859_100042579 3300005617 Bacteria 4561
65 Ga0068864_100066716 3300005618 Bacteria 3124
66 Ga0068866_10158405 3300005718 Bacteria 1318
67 Ga0068861_100009891 3300005719 Bacteria 6599
68 Ga0068861_100259989 3300005719 Bacteria 1486
69 Ga0068870_10292475 3300005840 Bacteria 1025
70 Ga0068863_100012260 3300005841 Bacteria 8276
71 Ga0068863_100034919 3300005841 Bacteria 4790
72 Ga0068860_100000102 3300005843 Bacteria 140115
73 Ga0068860_101682004 3300005843 Bacteria 656
74 Ga0068862_100138986 3300005844 Bacteria 2155
75 Ga0081455_10012561 3300005937 Bacteria 8447
76 Ga0081540_1000395 3300005983 Bacteria 43174
77 Ga0070717_10384503 3300006028 Bacteria 1259
78 Ga0070716_100008941 3300006173 Bacteria 4982
79 Ga0070712_100030634 3300006175 Bacteria 3618
80 Ga0097621_100013731 3300006237 Bacteria 6047
81 Ga0075428_100764306 3300006844 Bacteria 1028
82 Ga0075433_10034999 3300006852 Bacteria 4317
83 Ga0075434_100027038 3300006871 Bacteria 5630
84 Ga0075436_100014193 3300006914 Bacteria 5453
85 Ga0097620_100042575 3300006931 Bacteria 4561
86 Ga0105250_10125541 3300009092 Bacteria 1057
87 Ga0105240_10435718 3300009093 Bacteria 1470
88 Ga0105240_10841275 3300009093 Bacteria 991
89 Ga0105240_10913245 3300009093 Bacteria 944
90 Ga0111539_10266736 3300009094 Bacteria 1993
91 Ga0105245_10187297 3300009098 Bacteria 1980
92 Ga0105245_11453834 3300009098 Bacteria 736
93 Ga0105247_10023810 3300009101 Bacteria 3691
94 Ga0105247_10673727 3300009101 Bacteria 775
95 Ga0105243_10822032 3300009148 Bacteria 918
96 Ga0105243_11640507 3300009148 Bacteria 671
97 Ga0105241_10122110 3300009174 Bacteria 2099
98 Ga0105242_10020968 3300009176 Bacteria 5126
99 Ga0105248_10534834 3300009177 Bacteria 1322
100 Ga0105248_10687663 3300009177 Bacteria 1154
101 Ga0105237_10438735 3300009545 Bacteria 1311
102 Ga0105249_10025180 3300009553 Bacteria 5355
103 Ga0105249_11001318 3300009553 Bacteria 904
104 Ga0105035_101331 3300009988 Bacteria 1693
105 Ga0105239_10062793 3300010375 Bacteria 4077
106 Ga0105239_12542768 3300010375 Bacteria 597
107 Ga0157371_10006168 3300013102 Bacteria 9949
108 Ga0157371_10065140 3300013102 Bacteria 2580
109 Ga0157370_10052213 3300013104 Bacteria 3903
110 Ga0157370_10607149 3300013104 Bacteria 1001
111 Ga0157369_10000585 3300013105 Bacteria 47583
112 Ga0157369_10032399 3300013105 Bacteria 5749
113 Ga0157369_10134722 3300013105 Bacteria 2616
114 Ga0157374_10168263 3300013296 Bacteria 2137
115 Ga0163162_10123346 3300013306 Bacteria 2696
116 Ga0163162_10268471 3300013306 Bacteria 1838
117 Ga0157372_10178089 3300013307 Bacteria 2461
118 Ga0157372_10374436 3300013307 Bacteria 1659
119 Ga0157375_10020063 3300013308 Bacteria 6098
120 Ga0157515_127078 3300013875 Bacteria 1467
121 Ga0157377_10047896 3300014745 Bacteria 2396
122 Ga0157379_10016489 3300014968 Bacteria 6498
123 Ga0157379_10046256 3300014968 Bacteria 3883
124 Ga0157379_10526279 3300014968 Bacteria 1098
125 Ga0163161_10096411 3300017792 Bacteria 2195
126 Ga0197907_11278716 3300020069 Bacteria 1106
127 Ga0206356_10420927 3300020070 Bacteria 2262
128 Ga0206349_1653309 3300020075 Bacteria 1239
129 Ga0206355_1618480 3300020076 Bacteria 653
130 Ga0206350_10038033 3300020080 Bacteria 1234
131 Ga0206354_10049365 3300020081 Bacteria 1646
132 Ga0206353_10656915 3300020082 Bacteria 2255
133 Ga0206353_11749350 3300020082 Bacteria 753
134 Ga0213875_10000235 3300021388 Bacteria 56070
135 Ga0224712_10021576 3300022467 Bacteria 2206
136 Ga0224712_10163699 3300022467 Bacteria 994
137 Ga0207642_10097963 3300025899 Bacteria 1465
138 Ga0207710_10128592 3300025900 Bacteria 1215
139 Ga0207688_10003200 3300025901 Bacteria 8938
140 Ga0207688_10019066 3300025901 Bacteria 3734
141 Ga0207680_10016573 3300025903 Bacteria 3873
142 Ga0207680_10022188 3300025903 Bacteria 3448
143 Ga0207680_10869779 3300025903 Bacteria 646
144 Ga0207647_10148993 3300025904 Bacteria 1368
145 Ga0207647_10339775 3300025904 Bacteria 851
146 Ga0207705_10019630 3300025909 Bacteria 4832
147 Ga0207705_10073542 3300025909 Bacteria 2480
148 Ga0207705_10141558 3300025909 Bacteria 1797
149 Ga0207705_10462104 3300025909 Bacteria 985
150 Ga0207654_10029837 3300025911 Bacteria 2990
151 Ga0207654_10305646 3300025911 Bacteria 1083
152 Ga0207707_10227218 3300025912 Bacteria 1624
153 Ga0207695_10062494 3300025913 Bacteria 3843
154 Ga0207695_10694726 3300025913 Bacteria 898
155 Ga0207695_10726526 3300025913 Bacteria 873
156 Ga0207671_10258204 3300025914 Bacteria 1371
157 Ga0207663_10246376 3300025916 Bacteria 1313
158 Ga0207660_10801811 3300025917 Bacteria 768
159 Ga0207662_10018075 3300025918 Bacteria 3994
160 Ga0207657_10038168 3300025919 Bacteria 4280
161 Ga0207657_10063563 3300025919 Bacteria 3155
162 Ga0207649_10179415 3300025920 Bacteria 1481
163 Ga0207681_10390076 3300025923 Bacteria 1123
164 Ga0207687_10063587 3300025927 Bacteria 2613
165 Ga0207687_10124164 3300025927 Bacteria 1935
166 Ga0207664_10149962 3300025929 Bacteria 1980
167 Ga0207664_10307611 3300025929 Bacteria 1396
168 Ga0207664_10537713 3300025929 Bacteria 1048
169 Ga0207664_10920397 3300025929 Bacteria 785
170 Ga0207690_10016096 3300025932 Bacteria 4546
171 Ga0207690_10510587 3300025932 Bacteria 973
172 Ga0207709_10146494 3300025935 Bacteria 1630
173 Ga0207709_10730593 3300025935 Bacteria 794
174 Ga0207669_11338222 3300025937 Bacteria 609
175 Ga0207704_10261475 3300025938 Bacteria 1305
176 Ga0207665_10715094 3300025939 Bacteria 788
177 Ga0207711_10839684 3300025941 Bacteria 855
178 Ga0207661_10062787 3300025944 Bacteria 3006
179 Ga0207661_10296129 3300025944 Bacteria 1449
180 Ga0207668_10099615 3300025972 Bacteria 2156
181 Ga0207668_10840190 3300025972 Bacteria 815
182 Ga0207640_10284167 3300025981 Bacteria 1301
183 Ga0207658_10009894 3300025986 Bacteria 6480
184 Ga0207703_10026132 3300026035 Bacteria 4594
185 Ga0207678_10444977 3300026067 Bacteria 1126
186 Ga0207708_10577963 3300026075 Bacteria 950
187 Ga0207641_10003193 3300026088 Bacteria 14672
188 Ga0207641_10008908 3300026088 Bacteria 8289
189 Ga0207674_10033153 3300026116 Bacteria 5408
190 Ga0207675_100304068 3300026118 Bacteria 1554
191 Ga0207683_10694539 3300026121 Bacteria 943
192 Ga0207698_10063569 3300026142 Bacteria 2889
193 Ga0207698_10376156 3300026142 Bacteria 1350
194 Ga0268266_10018101 3300028379 Bacteria 6005
195 Ga0268266_10190204 3300028379 Bacteria 1874
196 Ga0268266_10380771 3300028379 Bacteria 1331
197 Ga0268266_10724740 3300028379 Bacteria 959
198 Ga0268265_10195404 3300028380 Bacteria 1751
199 Ga0268264_10000171 3300028381 Bacteria 141050
200 Ga0268264_10890696 3300028381 Bacteria 893
201 Ga0307513_10466162 3300031456 Bacteria 985
202 Ga0307508_10183476 3300031616 Bacteria 1695
203 Ga0307413_10271508 3300031824 Bacteria 1270
204 Ga0326468_10005891 3300031889 Bacteria 1118
205 Ga0307406_10304355 3300031901 Bacteria 1226
206 Ga0307406_10439353 3300031901 Bacteria 1044
207 Ga0307415_101169017 3300032126 Bacteria 723
208 Ga0373948_0086924 3300034817 Bacteria 721
209 Ga0373938_0010400 3300034957 Bacteria 1709
210 Ga0373929_0083661 3300035085 Bacteria 782
211 Ga0373940_0063257 3300035088 Bacteria 1063
212 Ga0373951_0011056 3300035091 Bacteria 2025
213 Ga0373960_0012578 3300035121 Bacteria 2105
214 Ga0373942_0194151 3300035207 Bacteria 670
215 Ga0373931_0014146 3300035691 Bacteria 3896
216 Ga0395900_0684760 3300037418 Bacteria 960
217 Ga0436364_0282469 3300037853 Bacteria 49422
218 Ga0395901_0147245 3300038443 Bacteria 2475
219 Ga0451800_1096045 3300041459 Bacteria 642
220 Ga0439459_0135364 3300042438 Bacteria 633
221 Ga0439440_0069158 3300042993 Bacteria 916
222 Ga0466969_0061125 3300044656 Bacteria 1831
223 Ga0466972_0098500 3300044658 Bacteria 1384
224 Ga0466972_0146247 3300044658 Bacteria 1112
225 Ga0466965_0342188 3300044683 Bacteria 818
226 Ga0466966_0057120 3300044684 Bacteria 2468
227 Ga0466966_0063457 3300044684 Bacteria 2328
228 Ga0466966_0181836 3300044684 Bacteria 1276
229 Ga0466966_0705883 3300044684 Bacteria 608
230 Ga0466961_0022652 3300044693 Bacteria 4041
231 Ga0466961_0034058 3300044693 Bacteria 3271
232 Ga0466961_0085237 3300044693 Bacteria 1998
233 Ga0466961_0086201 3300044693 Bacteria 1985
234 Ga0466961_0161984 3300044693 Bacteria 1394
235 Ga0466961_0199417 3300044693 Bacteria 1238
236 Ga0466961_0246561 3300044693 Bacteria 1097
237 Ga0466961_0325392 3300044693 Bacteria 937
238 Ga0466961_0398411 3300044693 Bacteria 835
239 Ga0466961_0412382 3300044693 Bacteria 819
240 Ga0466963_0004902 3300044694 Bacteria 7806
241 Ga0466963_0006898 3300044694 Bacteria 6758
242 Ga0466963_0051748 3300044694 Bacteria 2723
243 Ga0466963_0080549 3300044694 Bacteria 2204
244 Ga0466963_0159567 3300044694 Bacteria 1569
245 Ga0466963_0602083 3300044694 Bacteria 776
246 Ga0466964_0003662 3300044706 Bacteria 5620
247 Ga0466971_0031715 3300044719 Bacteria 2367
248 Ga0466968_0524820 3300044735 Bacteria 592
249 Ga0466970_0023432 3300044765 Bacteria 3224
250 Ga0466970_0024514 3300044765 Bacteria 3155
251 Ga0466970_0854808 3300044765 Bacteria 534
252 Ga0466957_0005909 3300044842 Bacteria 6900
253 Ga0466957_0070791 3300044842 Bacteria 2155
254 Ga0466957_0123831 3300044842 Bacteria 1650
255 Ga0466957_0168689 3300044842 Bacteria 1425
256 Ga0466957_0537863 3300044842 Bacteria 813
257 Ga0466960_0002456 3300044901 Bacteria 6972
258 Ga0466960_0255052 3300044901 Bacteria 975
259 Ga0466960_0493223 3300044901 Bacteria 717
260 Ga0466959_0241281 3300045049 Bacteria 1248
261 Ga0466959_0255453 3300045049 Bacteria 1208
262 Ga0466959_0301209 3300045049 Bacteria 1098
263 Ga0466959_0305601 3300045049 Bacteria 1089
264 Ga0466959_0309502 3300045049 Bacteria 1081
265 Ga0466959_0382032 3300045049 Bacteria 958
266 Ga0466959_0490365 3300045049 Bacteria 831
267 Ga0466959_0559004 3300045049 Bacteria 771
268 Ga0466959_0594176 3300045049 Bacteria 745
269 Ga0466958_0009359 3300045836 Bacteria 5459
270 Ga0466958_0021544 3300045836 Bacteria 3768
271 Ga0466958_0041044 3300045836 Bacteria 2782
272 Ga0466958_0049014 3300045836 Bacteria 2554
273 Ga0466958_0104650 3300045836 Bacteria 1763
274 Ga0466958_0294795 3300045836 Bacteria 1041
275 Ga0466958_0397163 3300045836 Bacteria 890
276 Ga0466958_0527820 3300045836 Bacteria 766
277 Ga0466967_0040210 3300045976 Bacteria 4025
278 Ga0466967_0044560 3300045976 Bacteria 3849
279 Ga0466967_0119391 3300045976 Bacteria 2433
280 Ga0466967_0290222 3300045976 Bacteria 1571
281 Ga0466967_0528770 3300045976 Bacteria 1159
282 Ga0466967_0553195 3300045976 Bacteria 1133
283 Ga0466967_0649737 3300045976 Bacteria 1043
284 Ga0466967_0723875 3300045976 Bacteria 986
285 Ga0466967_0901122 3300045976 Bacteria 879
286 Ga0466967_1542856 3300045976 Bacteria 661
287 Ga0495603_0651018 3300046455 Bacteria 603
288 Ga0496100_0001367 3300048903 Bacteria 11958
289 Ga0496100_0566665 3300048903 Bacteria 880
290 Ga0496101_0003299 3300048904 Bacteria 10042
291 Ga0496101_0259498 3300048904 Bacteria 1355
292 Ga0496102_0000102 3300048905 Bacteria 122251
293 Ga0496102_0000636 3300048905 Bacteria 35737
294 Ga0496102_0242295 3300048905 Bacteria 1700
295 Ga0496102_0480239 3300048905 Bacteria 1164
296 Ga0496103_0000090 3300048906 Bacteria 101941
297 Ga0496103_0124083 3300048906 Bacteria 1646
298 Ga0496103_0316048 3300048906 Bacteria 1005
299 Ga0496103_0340532 3300048906 Bacteria 964
300 Ga0496104_0017390 3300048907 Bacteria 6547
301 Ga0496104_0408993 3300048907 Bacteria 1269
302 Ga0496105_0009369 3300048908 Bacteria 7657
303 Ga0496105_0100015 3300048908 Bacteria 2395
304 Ga0496106_0763867 3300048909 Bacteria 768
305 Ga0496107_0139272 3300048910 Bacteria 1793
306 Ga0496108_0087170 3300048911 Bacteria 2651
307 Ga0496108_0158120 3300048911 Bacteria 1957
308 Ga0496109_0005991 3300048912 Bacteria 10213
309 Ga0496109_0204547 3300048912 Bacteria 1856
310 Ga0496110_0002939 3300048913 Bacteria 12909
311 Ga0496110_0032227 3300048913 Bacteria 4525
312 Ga0496110_0074925 3300048913 Bacteria 3006
313 Ga0496112_0455906 3300048915 Bacteria 1216
314 Ga0496115_0399385 3300048918 Bacteria 1116
315 Ga0496116_0000364 3300048919 Bacteria 69617
316 Ga0496117_0000148 3300048920 Bacteria 149369
317 Ga0496118_0000042 3300048921 Bacteria 287521
318 Ga0496118_0109147 3300048921 Bacteria 1842
319 Ga0496119_0000333 3300048922 Bacteria 65888
320 Ga0496120_0001652 3300048923 Bacteria 25805
321 Ga0496120_0009093 3300048923 Bacteria 7091
322 Ga0496121_0008183 3300048924 Bacteria 12415
323 Ga0496121_0009667 3300048924 Bacteria 11046
324 Ga0496124_0013106 3300048927 Bacteria 8117
325 Ga0496125_0035678 3300048928 Bacteria 4356
326 Ga0496126_0000013 3300048929 Bacteria 690046
327 Ga0496126_0001819 3300048929 Bacteria 31173
328 Ga0501031_0111275 3300049568 Bacteria 1788
329 Ga0501031_0701182 3300049568 Bacteria 650
330 Ga0501032_0004017 3300049569 Bacteria 11151
331 Ga0501033_0035640 3300049570 Bacteria 3730
332 Ga0501033_0156317 3300049570 Bacteria 1643
333 Ga0501034_0075461 3300049571 Bacteria 3379
334 Ga0501037_0249988 3300049573 Bacteria 1241
335 Ga0501038_0001921 3300049574 Bacteria 19179
336 Ga0501039_0543511 3300049575 Bacteria 912
337 Ga0501043_0114210 3300049579 Bacteria 2120
338 Ga0501046_0227174 3300049580 Bacteria 1380
339 Ga0501047_0021131 3300049581 Bacteria 6250
340 Ga0501047_0498524 3300049581 Bacteria 1044
341 Ga0501048_0001498 3300049582 Bacteria 17679
342 Ga0501067_0214921 3300049583 Bacteria 1071
343 Ga0501070_0017844 3300049586 Bacteria 5959
344 Ga0501073_0287107 3300049589 Bacteria 1135
345 Ga0501081_0137753 3300049743 Bacteria 1748
346 Ga0501035_0262322 3300049822 Bacteria 1464
347 Ga0501044_0037054 3300049823 Bacteria 5099
348 Ga0501044_0419205 3300049823 Bacteria 1249
349 nmdc:mga09592_464904_c1 3300050508 Bacteria 1091
350 nmdc:mga08y16_412387_c1 3300050511 Bacteria 1381
351 nmdc:mga0n895_176747_c1 3300050512 Bacteria 2166
352 nmdc:mga08x19_33592_c1 3300050514 Bacteria 3237
353 nmdc:mga0a205_97901_c1 3300050515 Bacteria 2832
354 Ga0500559_0007932 3300053136 Bacteria 4680
355 Ga0466962_0005190 3300061719 Bacteria 6267
356 Ga0466962_0079626 3300061719 Bacteria 1566
357 Ga0466962_0102251 3300061719 Bacteria 1376
358 Ga0466962_0157551 3300061719 Bacteria 1103
359 Ga0466962_0306952 3300061719 Bacteria 786
360 2558907619 2558860112 Bacteria 9931328
361 2867347339 2867346516 Bacteria 7608576
362 8054476002 8054472261 Bacteria 7464355
363 Ga0466967_0054071
364 JGI24735J21928_10001535
365 Ga0058863_10067698
366 Ga0058861_12040849
367 Ga0058862_12686184
368 Ga0070658_10001274
369 Ga0070683_100133667
370 Ga0070683_100225274
371 Ga0070690_100160517
372 Ga0070670_100555927
373 Ga0070670_100706649
374 Ga0070666_10032517
375 Ga0070666_10383411
376 Ga0070680_100018053
377 Ga0070682_100227395
378 Ga0070660_100017114
379 Ga0070660_100791826
380 Ga0070689_100070587
381 Ga0070687_100087083
382 Ga0070661_100306401
383 Ga0070692_10084328
384 Ga0070668_100055848
385 Ga0070668_100101152
386 Ga0070668_100413474
387 Ga0070669_100534868
388 Ga0070671_100125915
389 Ga0070673_100022590
390 Ga0070659_100012844
391 Ga0070659_100112498
392 Ga0070659_100209896
393 Ga0070667_100005372
394 Ga0070667_100086197
395 Ga0070667_100639744
396 Ga0070709_10096290
397 Ga0070714_100298660
398 Ga0070714_100440222
399 Ga0070714_100782851
400 Ga0070714_101414740
401 Ga0070713_100177591
402 Ga0070713_100275564
403 Ga0070713_100654570
404 Ga0070710_10004373
405 Ga0070705_100300198
406 Ga0070708_100196541
407 Ga0070663_100092486
408 Ga0070663_100497287
409 Ga0070678_100040451
410 Ga0070681_10175229
411 Ga0070685_10366530
412 Ga0070698_100502986
413 Ga0070679_100644133
414 Ga0070665_100948246
415 Ga0070665_100949884
416 Ga0070704_100023091
417 Ga0068855_100031067
418 Ga0068855_100451185
419 Ga0070664_100660201
420 Ga0068857_100230891
421 Ga0068854_100209305
422 Ga0070702_100016903
423 Ga0068852_100028112
424 Ga0068852_100138804
425 Ga0068852_100427175
426 Ga0068859_100042579
427 Ga0068864_100066716
428 Ga0068866_10158405
429 Ga0068861_100009891
430 Ga0068861_100259989
431 Ga0068870_10292475
432 Ga0068863_100012260
433 Ga0068863_100034919
434 Ga0068860_100000102
435 Ga0068860_101682004
436 Ga0068862_100138986
437 Ga0081455_10012561
438 Ga0081540_1000395
439 Ga0070717_10384503
440 Ga0070716_100008941
441 Ga0070712_100030634
442 Ga0097621_100013731
443 Ga0075428_100764306
444 Ga0075433_10034999
445 Ga0075434_100027038
446 Ga0075436_100014193
447 Ga0097620_100042575
448 Ga0105250_10125541
449 Ga0105240_10435718
450 Ga0105240_10841275
451 Ga0105240_10913245
452 Ga0111539_10266736
453 Ga0105245_10187297
454 Ga0105245_11453834
455 Ga0105247_10023810
456 Ga0105247_10673727
457 Ga0105243_10822032
458 Ga0105243_11640507
459 Ga0105241_10122110
460 Ga0105242_10020968
461 Ga0105248_10534834
462 Ga0105248_10687663
463 Ga0105237_10438735
464 Ga0105249_10025180
465 Ga0105249_11001318
466 Ga0105035_101331
467 Ga0105239_10062793
468 Ga0105239_12542768
469 Ga0157371_10006168
470 Ga0157371_10065140
471 Ga0157370_10052213
472 Ga0157370_10607149
473 Ga0157369_10000585
474 Ga0157369_10032399
475 Ga0157369_10134722
476 Ga0157374_10168263
477 Ga0163162_10123346
478 Ga0163162_10268471
479 Ga0157372_10178089
480 Ga0157372_10374436
481 Ga0157375_10020063
482 Ga0157515_127078
483 Ga0157377_10047896
484 Ga0157379_10016489
485 Ga0157379_10046256
486 Ga0157379_10526279
487 Ga0163161_10096411
488 Ga0197907_11278716
489 Ga0206356_10420927
490 Ga0206349_1653309
491 Ga0206355_1618480
492 Ga0206350_10038033
493 Ga0206354_10049365
494 Ga0206353_10656915
495 Ga0206353_11749350
496 Ga0213875_10000235
497 Ga0224712_10021576
498 Ga0224712_10163699
499 Ga0207642_10097963
500 Ga0207710_10128592
501 Ga0207688_10003200
502 Ga0207688_10019066
503 Ga0207680_10016573
504 Ga0207680_10022188
505 Ga0207680_10869779
506 Ga0207647_10148993
507 Ga0207647_10339775
508 Ga0207705_10019630
509 Ga0207705_10073542
510 Ga0207705_10141558
511 Ga0207705_10462104
512 Ga0207654_10029837
513 Ga0207654_10305646
514 Ga0207707_10227218
515 Ga0207695_10062494
516 Ga0207695_10694726
517 Ga0207695_10726526
518 Ga0207671_10258204
519 Ga0207663_10246376
520 Ga0207660_10801811
521 Ga0207662_10018075
522 Ga0207657_10038168
523 Ga0207657_10063563
524 Ga0207649_10179415
525 Ga0207681_10390076
526 Ga0207687_10063587
527 Ga0207687_10124164
528 Ga0207664_10149962
529 Ga0207664_10307611
530 Ga0207664_10537713
531 Ga0207664_10920397
532 Ga0207690_10016096
533 Ga0207690_10510587
534 Ga0207709_10146494
535 Ga0207709_10730593
536 Ga0207669_11338222
537 Ga0207704_10261475
538 Ga0207665_10715094
539 Ga0207711_10839684
540 Ga0207661_10062787
541 Ga0207661_10296129
542 Ga0207668_10099615
543 Ga0207668_10840190
544 Ga0207640_10284167
545 Ga0207658_10009894
546 Ga0207703_10026132
547 Ga0207678_10444977
548 Ga0207708_10577963
549 Ga0207641_10003193
550 Ga0207641_10008908
551 Ga0207674_10033153
552 Ga0207675_100304068
553 Ga0207683_10694539
554 Ga0207698_10063569
555 Ga0207698_10376156
556 Ga0268266_10018101
557 Ga0268266_10190204
558 Ga0268266_10380771
559 Ga0268266_10724740
560 Ga0268265_10195404
561 Ga0268264_10000171
562 Ga0268264_10890696
563 Ga0307513_10466162
564 Ga0307508_10183476
565 Ga0307413_10271508
566 Ga0326468_10005891
567 Ga0307406_10304355
568 Ga0307406_10439353
569 Ga0307415_101169017
570 Ga0373948_0086924
571 Ga0373938_0010400
572 Ga0373929_0083661
573 Ga0373940_0063257
574 Ga0373951_0011056
575 Ga0373960_0012578
576 Ga0373942_0194151
577 Ga0373931_0014146
578 Ga0395900_0684760
579 Ga0436364_0282469
580 Ga0395901_0147245
581 Ga0451800_1096045
582 Ga0439459_0135364
583 Ga0439440_0069158
584 Ga0466969_0061125
585 Ga0466972_0098500
586 Ga0466972_0146247
587 Ga0466965_0342188
588 Ga0466966_0057120
589 Ga0466966_0063457
590 Ga0466966_0181836
591 Ga0466966_0705883
592 Ga0466961_0022652
593 Ga0466961_0034058
594 Ga0466961_0085237
595 Ga0466961_0086201
596 Ga0466961_0161984
597 Ga0466961_0199417
598 Ga0466961_0246561
599 Ga0466961_0325392
600 Ga0466961_0398411
601 Ga0466961_0412382
602 Ga0466963_0004902
603 Ga0466963_0006898
604 Ga0466963_0051748
605 Ga0466963_0080549
606 Ga0466963_0159567
607 Ga0466963_0602083
608 Ga0466964_0003662
609 Ga0466971_0031715
610 Ga0466968_0524820
611 Ga0466970_0023432
612 Ga0466970_0024514
613 Ga0466970_0854808
614 Ga0466957_0005909
615 Ga0466957_0070791
616 Ga0466957_0123831
617 Ga0466957_0168689
618 Ga0466957_0537863
619 Ga0466960_0002456
620 Ga0466960_0255052
621 Ga0466960_0493223
622 Ga0466959_0241281
623 Ga0466959_0255453
624 Ga0466959_0301209
625 Ga0466959_0305601
626 Ga0466959_0309502
627 Ga0466959_0382032
628 Ga0466959_0490365
629 Ga0466959_0559004
630 Ga0466959_0594176
631 Ga0466958_0009359
632 Ga0466958_0021544
633 Ga0466958_0041044
634 Ga0466958_0049014
635 Ga0466958_0104650
636 Ga0466958_0294795
637 Ga0466958_0397163
638 Ga0466958_0527820
639 Ga0466967_0040210
640 Ga0466967_0044560
641 Ga0466967_0119391
642 Ga0466967_0290222
643 Ga0466967_0528770
644 Ga0466967_0553195
645 Ga0466967_0649737
646 Ga0466967_0723875
647 Ga0466967_0901122
648 Ga0466967_1542856
649 Ga0495603_0651018
650 Ga0496100_0001367
651 Ga0496100_0566665
652 Ga0496101_0003299
653 Ga0496101_0259498
654 Ga0496102_0000102
655 Ga0496102_0000636
656 Ga0496102_0242295
657 Ga0496102_0480239
658 Ga0496103_0000090
659 Ga0496103_0124083
660 Ga0496103_0316048
661 Ga0496103_0340532
662 Ga0496104_0017390
663 Ga0496104_0408993
664 Ga0496105_0009369
665 Ga0496105_0100015
666 Ga0496106_0763867
667 Ga0496107_0139272
668 Ga0496108_0087170
669 Ga0496108_0158120
670 Ga0496109_0005991
671 Ga0496109_0204547
672 Ga0496110_0002939
673 Ga0496110_0032227
674 Ga0496110_0074925
675 Ga0496112_0455906
676 Ga0496115_0399385
677 Ga0496116_0000364
678 Ga0496117_0000148
679 Ga0496118_0000042
680 Ga0496118_0109147
681 Ga0496119_0000333
682 Ga0496120_0001652
683 Ga0496120_0009093
684 Ga0496121_0008183
685 Ga0496121_0009667
686 Ga0496124_0013106
687 Ga0496125_0035678
688 Ga0496126_0000013
689 Ga0496126_0001819
690 Ga0501031_0111275
691 Ga0501031_0701182
692 Ga0501032_0004017
693 Ga0501033_0035640
694 Ga0501033_0156317
695 Ga0501034_0075461
696 Ga0501037_0249988
697 Ga0501038_0001921
698 Ga0501039_0543511
699 Ga0501043_0114210
700 Ga0501046_0227174
701 Ga0501047_0021131
702 Ga0501047_0498524
703 Ga0501048_0001498
704 Ga0501067_0214921
705 Ga0501070_0017844
706 Ga0501073_0287107
707 Ga0501081_0137753
708 Ga0501035_0262322
709 Ga0501044_0037054
710 Ga0501044_0419205
711 nmdc:mga09592_464904_c1
712 nmdc:mga08y16_412387_c1
713 nmdc:mga0n895_176747_c1
714 nmdc:mga08x19_33592_c1
715 nmdc:mga0a205_97901_c1
716 Ga0500559_0007932
717 Ga0466962_0005190
718 Ga0466962_0079626
719 Ga0466962_0102251
720 Ga0466962_0157551
721 Ga0466962_0306952
722 2558907619
723 2867347339
724 8054476002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

28

154

0.99

PF08534

Redoxin

Redoxin

27

170

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9976 6 157
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9847 6 157
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9817 6 157
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9816 4 159
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9692 4 159
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9816 4 159 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9692 4 159 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9422 8 157 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.924 8 157 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.918 8 157 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A109IF60-F1-model_v4 Peroxiredoxin (Alkyl hydroperoxide reductase subunit C) 1.001 6 156 GO:0004601
AF-A0A538N2J3-F1-model_v4 Peroxiredoxin 1 6 159 GO:0016209
GO:0016491
AF-A0A8B4EPB4-F1-model_v4 deleted 1 8 159
AF-A0A0B2YIS2-F1-model_v4 deleted 1 8 157
AF-E6TFF8-F1-model_v4 Peroxiredoxin 0.9994 8 159 GO:0016209
GO:0016491

Map